254780390

254780390

nucleoside diphosphate kinase

GeneID in NCBI database:8209375Locus tag:CLIBASIA_01375
Protein GI in NCBI database:254780390Protein Accession:YP_003064803.1
Gene range:-(289840, 290262)Protein Length:140aa
Gene description:nucleoside diphosphate kinase
COG prediction:[F] Nucleoside diphosphate kinase
KEGG prediction:ndk; nucleoside diphosphate kinase (EC:2.7.4.6); K00940 nucleoside-diphosphate kinase [EC:2.7.4.6]
SEED prediction:Nucleoside diphosphate kinase (EC 2.7.4.6)
Pathway involved in KEGG:Purine metabolism [PATH:las00230]
Pyrimidine metabolism [PATH:las00240]
Subsystem involved in SEED:pyrimidine conversions;
Purine conversions
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140
MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLKTALEEISYWFARNEIIG
ccccEEEEEEccHHHHcccHHHHHHHHHHcccEEEEEEEEcccHHHHHHHHHHHcccccHHHHHHHHccccEEEEEEEcccHHHHHHHHHccccHHHcccccHHHHHHccHHHcEEEEcccHHHHHHHHHHHccHHHHcc
ccEEEEEEEEcHHHHHcccHHHHHHHHHHcccEEEEEEEEcccHHHHHHHcHHHcccccHHHHHHHHccccEEEEEEEEEcHHHHHHHHHccccHHHcccccHHHHHccccccccEEEcccHHHHHHHHHHHccHHHccc
mviektfsmikpdavKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDfylihkdrpffPELVQAMISGPVFLQVLKGEEAISknrevmgdtdpkkalkgtirnkygisigensihgsDSLKTALEEISYWFARNEIIG
mviektfsmikpdavkrNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPELVQAMISGPVFLQVLKGEEAisknrevmgdtdpkkalkgtirnkygisigensihgsdSLKTALEEISYWFARNEIIG
MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLKTALEEISYWFARNEIIG
**IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLKTALEEISYWFARNEIIG
MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLKTALEEISYWFARNEIIG
*VIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLKTALEEISYWFARNEI*G
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLKTALEEISYWFARNEIIG
MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLKTALEEISYWFARNEIIG
MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLKTALEEISYWFARNEIIG

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target140 nucleoside diphosphate kinase [Candidatus Liberibacter
315122198140 nucleoside diphosphate kinase [Candidatus Liberibacter 1 1e-64
150395999140 nucleoside diphosphate kinase [Sinorhizobium medicae WS 1 2e-49
15964917140 nucleoside diphosphate kinase [Sinorhizobium meliloti 1 1 8e-49
227821486140 nucleoside diphosphate kinase [Sinorhizobium fredii NGR 1 1e-48
110634329140 nucleoside diphosphate kinase [Mesorhizobium sp. BNC1] 1 2e-48
148559468140 nucleoside diphosphate kinase [Brucella ovis ATCC 25840 1 2e-48
17987539140 nucleoside diphosphate kinase [Brucella melitensis bv. 1 2e-48
240850240140 nucleoside diphosphate kinase [Bartonella grahamii as4a 1 2e-48
23501581140 nucleoside diphosphate kinase [Brucella suis 1330] Leng 1 2e-48
86357110140 nucleoside diphosphate kinase [Rhizobium etli CFN 42] L 1 2e-48
>gi|315122198|ref|YP_004062687.1| nucleoside diphosphate kinase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 140 Back     alignment and organism information
 Score =  249 bits (635), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 116/140 (82%), Positives = 130/140 (92%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+TFSMIKPDAVKRNLIGSI+KELED GL +VAAKFC MN+KQAEDFY+IHKDR FF
Sbjct: 1   MGIERTFSMIKPDAVKRNLIGSIIKELEDNGLRMVAAKFCLMNKKQAEDFYIIHKDRSFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            ELVQAM SGPVFLQVL+GE A+SKNRE+MGDTDPKKA KG+IRN+YG+SIGENSIHGSD
Sbjct: 61  SELVQAMTSGPVFLQVLEGENAVSKNREIMGDTDPKKAFKGSIRNQYGLSIGENSIHGSD 120

Query: 121 SLKTALEEISYWFARNEIIG 140
           SL+TA+EEISYWFA+NEI G
Sbjct: 121 SLQTAVEEISYWFAKNEIFG 140


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|150395999|ref|YP_001326466.1| nucleoside diphosphate kinase [Sinorhizobium medicae WSM419] Length = 140 Back     alignment and organism information
>gi|15964917|ref|NP_385270.1| nucleoside diphosphate kinase [Sinorhizobium meliloti 1021] Length = 140 Back     alignment and organism information
>gi|227821486|ref|YP_002825456.1| nucleoside diphosphate kinase [Sinorhizobium fredii NGR234] Length = 140 Back     alignment and organism information
>gi|110634329|ref|YP_674537.1| nucleoside diphosphate kinase [Mesorhizobium sp. BNC1] Length = 140 Back     alignment and organism information
>gi|148559468|ref|YP_001258675.1| nucleoside diphosphate kinase [Brucella ovis ATCC 25840] Length = 140 Back     alignment and organism information
>gi|17987539|ref|NP_540173.1| nucleoside diphosphate kinase [Brucella melitensis bv. 1 str. 16M] Length = 140 Back     alignment and organism information
>gi|240850240|ref|YP_002971633.1| nucleoside diphosphate kinase [Bartonella grahamii as4aup] Length = 140 Back     alignment and organism information
>gi|23501581|ref|NP_697708.1| nucleoside diphosphate kinase [Brucella suis 1330] Length = 140 Back     alignment and organism information
>gi|86357110|ref|YP_469002.1| nucleoside diphosphate kinase [Rhizobium etli CFN 42] Length = 140 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target140 nucleoside diphosphate kinase [Candidatus Liberibacter
PRK00668134 PRK00668, ndk, mulitfunctional nucleoside diphosphate k 2e-58
cd04413130 cd04413, NDPk_I, Nucleoside diphosphate kinase Group I 2e-48
smart00562135 smart00562, NDK, These are enzymes that catalyze nonsub 2e-48
COG0105135 COG0105, Ndk, Nucleoside diphosphate kinase [Nucleotide 3e-47
PTZ00093149 PTZ00093, PTZ00093, nucleoside diphosphate kinase, cyto 4e-35
cd00595133 cd00595, NDPk, Nucleoside diphosphate kinases (NDP kina 7e-34
PRK14545139 PRK14545, PRK14545, nucleoside diphosphate kinase; Prov 4e-32
KOG0888156 KOG0888, KOG0888, KOG0888, Nucleoside diphosphate kinas 6e-32
PRK14541140 PRK14541, PRK14541, nucleoside diphosphate kinase; Prov 4e-30
PRK14542137 PRK14542, PRK14542, nucleoside diphosphate kinase; Prov 2e-28
PRK14540134 PRK14540, PRK14540, nucleoside diphosphate kinase; Prov 4e-28
PLN02619238 PLN02619, PLN02619, nucleoside-diphosphate kinase 6e-27
cd04415131 cd04415, NDPk7A, Nucleoside diphosphate kinase 7 domain 6e-26
PRK14543169 PRK14543, PRK14543, nucleoside diphosphate kinase; Prov 4e-24
PRK14544183 PRK14544, PRK14544, nucleoside diphosphate kinase; Prov 8e-24
cd04414135 cd04414, NDPk6, Nucleoside diphosphate kinase 6 (NDP ki 1e-23
PLN02931177 PLN02931, PLN02931, nucleoside diphosphate kinase famil 1e-22
cd04416132 cd04416, NDPk_TX, NDP kinase domain of thioredoxin doma 1e-21
cd04412134 cd04412, NDPk7B, Nucleoside diphosphate kinase 7 domain 1e-19
cd04418132 cd04418, NDPk5, Nucleoside diphosphate kinase homolog 5 3e-18
pfam00334135 pfam00334, NDK, Nucleoside diphosphate kinase 1e-52
>gnl|CDD|179085 PRK00668, ndk, mulitfunctional nucleoside diphosphate kinase/apyrimidinic endonuclease/3'-; Validated Back     alignment and domain information
>gnl|CDD|58528 cd04413, NDPk_I, Nucleoside diphosphate kinase Group I (NDPk_I)-like: NDP kinase domains are present in a large family of structurally and functionally conserved proteins from bacteria to humans that generally catalyze the transfer of gamma-phosphates of a nucleoside triphosphate (NTP) donor onto a nucleoside diphosphate (NDP) acceptor through a phosphohistidine intermediate Back     alignment and domain information
>gnl|CDD|128834 smart00562, NDK, These are enzymes that catalyze nonsubstrate specific conversions of nucleoside diphosphates to nucleoside triphosphates Back     alignment and domain information
>gnl|CDD|30454 COG0105, Ndk, Nucleoside diphosphate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|173387 PTZ00093, PTZ00093, nucleoside diphosphate kinase, cytosolic; Provisional Back     alignment and domain information
>gnl|CDD|73220 cd00595, NDPk, Nucleoside diphosphate kinases (NDP kinases, NDPks): NDP kinases, responsible for the synthesis of nucleoside triphosphates (NTPs), are involved in numerous regulatory processes associated with proliferation, development, and differentiation Back     alignment and domain information
>gnl|CDD|184734 PRK14545, PRK14545, nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>gnl|CDD|36106 KOG0888, KOG0888, KOG0888, Nucleoside diphosphate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|173007 PRK14541, PRK14541, nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>gnl|CDD|173008 PRK14542, PRK14542, nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>gnl|CDD|184733 PRK14540, PRK14540, nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>gnl|CDD|178228 PLN02619, PLN02619, nucleoside-diphosphate kinase Back     alignment and domain information
>gnl|CDD|58530 cd04415, NDPk7A, Nucleoside diphosphate kinase 7 domain A (NDPk7A): The nm23-H7 class of nucleoside diphosphate kinase (NDPk7) consists of an N-terminal DM10 domain and two functional catalytic NDPk modules, NDPk7A and NDPk7B Back     alignment and domain information
>gnl|CDD|173009 PRK14543, PRK14543, nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>gnl|CDD|173010 PRK14544, PRK14544, nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>gnl|CDD|58529 cd04414, NDPk6, Nucleoside diphosphate kinase 6 (NDP kinase 6, NDPk6, NM23-H6; NME6; Inhibitor of p53-induced apoptosis-alpha, IPIA-alpha): The nm23-H6 gene encoding NDPk6 is expressed mainly in mitochondria, but also found at a lower level in most tissues Back     alignment and domain information
>gnl|CDD|178519 PLN02931, PLN02931, nucleoside diphosphate kinase family protein Back     alignment and domain information
>gnl|CDD|58531 cd04416, NDPk_TX, NDP kinase domain of thioredoxin domain-containing proteins (TXNDC3 and TXNDC6): Txl-2 (TXNDC6) and Sptrx-2 (TXNDC3) are fusion proteins of Group II N-terminal thioredoxin domains followed by one or three NDP kinase domains, respectively Back     alignment and domain information
>gnl|CDD|58527 cd04412, NDPk7B, Nucleoside diphosphate kinase 7 domain B (NDPk7B): The nm23-H7 class of nucleoside diphosphate kinase (NDPk7) consists of an N-terminal DM10 domain and two functional catalytic NDPk modules, NDPk7A and NDPk7B Back     alignment and domain information
>gnl|CDD|58532 cd04418, NDPk5, Nucleoside diphosphate kinase homolog 5 (NDP kinase homolog 5, NDPk5, NM23-H5; Inhibitor of p53-induced apoptosis-beta, IPIA-beta): In human, mRNA for NDPk5 is almost exclusively found in testis, especially in the flagella of spermatids and spermatozoa, in association with axoneme microtubules, and may play a role in spermatogenesis by increasing the ability of late-stage spermatids to eliminate reactive oxygen species Back     alignment and domain information
>gnl|CDD|144066 pfam00334, NDK, Nucleoside diphosphate kinase Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 140 nucleoside diphosphate kinase [Candidatus Liberibacter
PTZ00093149 nucleoside diphosphate kinase; Provisional 100.0
smart00562135 NDK These are enzymes that catalyze nonsubstrate specif 100.0
pfam00334135 NDK Nucleoside diphosphate kinase. 100.0
PRK00668131 ndk nucleoside diphosphate kinase; Validated 100.0
cd04413130 NDPk_I Nucleoside diphosphate kinase Group I (NDPk_I)-l 100.0
COG0105135 Ndk Nucleoside diphosphate kinase [Nucleotide transport 100.0
cd04414135 NDPk6 Nucleoside diphosphate kinase 6 (NDP kinase 6, ND 100.0
cd04418132 NDPk5 Nucleoside diphosphate kinase homolog 5 (NDP kina 100.0
cd00595133 NDPk Nucleoside diphosphate kinases (NDP kinases, NDPks 100.0
cd04412134 NDPk7B Nucleoside diphosphate kinase 7 domain B (NDPk7B 100.0
cd04416132 NDPk_TX NDP kinase domain of thioredoxin domain-contain 100.0
cd04415131 NDPk7A Nucleoside diphosphate kinase 7 domain A (NDPk7A 100.0
KOG0888156 consensus 100.0
>PTZ00093 nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>smart00562 NDK These are enzymes that catalyze nonsubstrate specific conversions of nucleoside diphosphates to nucleoside triphosphates Back     alignment and domain information
>pfam00334 NDK Nucleoside diphosphate kinase Back     alignment and domain information
>PRK00668 ndk nucleoside diphosphate kinase; Validated Back     alignment and domain information
>cd04413 NDPk_I Nucleoside diphosphate kinase Group I (NDPk_I)-like: NDP kinase domains are present in a large family of structurally and functionally conserved proteins from bacteria to humans that generally catalyze the transfer of gamma-phosphates of a nucleoside triphosphate (NTP) donor onto a nucleoside diphosphate (NDP) acceptor through a phosphohistidine intermediate Back     alignment and domain information
>COG0105 Ndk Nucleoside diphosphate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd04414 NDPk6 Nucleoside diphosphate kinase 6 (NDP kinase 6, NDPk6, NM23-H6; NME6; Inhibitor of p53-induced apoptosis-alpha, IPIA-alpha): The nm23-H6 gene encoding NDPk6 is expressed mainly in mitochondria, but also found at a lower level in most tissues Back     alignment and domain information
>cd04418 NDPk5 Nucleoside diphosphate kinase homolog 5 (NDP kinase homolog 5, NDPk5, NM23-H5; Inhibitor of p53-induced apoptosis-beta, IPIA-beta): In human, mRNA for NDPk5 is almost exclusively found in testis, especially in the flagella of spermatids and spermatozoa, in association with axoneme microtubules, and may play a role in spermatogenesis by increasing the ability of late-stage spermatids to eliminate reactive oxygen species Back     alignment and domain information
>cd00595 NDPk Nucleoside diphosphate kinases (NDP kinases, NDPks): NDP kinases, responsible for the synthesis of nucleoside triphosphates (NTPs), are involved in numerous regulatory processes associated with proliferation, development, and differentiation Back     alignment and domain information
>cd04412 NDPk7B Nucleoside diphosphate kinase 7 domain B (NDPk7B): The nm23-H7 class of nucleoside diphosphate kinase (NDPk7) consists of an N-terminal DM10 domain and two functional catalytic NDPk modules, NDPk7A and NDPk7B Back     alignment and domain information
>cd04416 NDPk_TX NDP kinase domain of thioredoxin domain-containing proteins (TXNDC3 and TXNDC6): Txl-2 (TXNDC6) and Sptrx-2 (TXNDC3) are fusion proteins of Group II N-terminal thioredoxin domains followed by one or three NDP kinase domains, respectively Back     alignment and domain information
>cd04415 NDPk7A Nucleoside diphosphate kinase 7 domain A (NDPk7A): The nm23-H7 class of nucleoside diphosphate kinase (NDPk7) consists of an N-terminal DM10 domain and two functional catalytic NDPk modules, NDPk7A and NDPk7B Back     alignment and domain information
>KOG0888 consensus Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target140 nucleoside diphosphate kinase [Candidatus Liberibacter
3ngr_A151 Crystal Structure Of Leishmania Nucleoside Diphosph 1e-46
1ndl_A153 The Awd Nucleotide Diphosphate Kinase From Drosophi 2e-45
3l7u_A172 Crystal Structure Of Human Nm23-H1 Length = 172 1e-44
1nsk_R152 The Crystal Structure Of A Human Nucleoside Diphosp 2e-44
1nue_A151 X-Ray Structure Of Nm23 Human Nucleoside Diphosphat 2e-44
3bbc_A151 Crystal Structure Of R88a Mutant Of The Nm23-H2 Tra 2e-44
1jxv_A152 Crystal Structure Of Human Nucleoside Diphosphate K 2e-44
1be4_A151 Nucleoside Diphosphate Kinase Isoform B From Bovine 3e-44
1bhn_A152 Nucleoside Diphosphate Kinase Isoform A From Bovine 6e-44
1nsq_A153 Mechanism Of Phosphate Transfer By Nucleoside Dipho 2e-43
1zs6_A169 Structure Of Human Nucleoside-Diphosphate Kinase 3 2e-43
2hve_A152 S120g Mutant Of Human Nucleoside Diphosphate Kinase 4e-43
1ucn_A152 X-Ray Structure Of Human Nucleoside Diphosphate Kin 6e-43
1npk_A154 Refined X-Ray Structure Of Dictyostelium Nucleoside 9e-43
1s57_A153 Crystal Structure Of Nucleoside Diphosphate Kinase 9e-43
1ndp_A155 Adenosine 5'-Diphosphate Binding And The Active Sit 2e-42
1wkj_A137 Crystal Structure Of Nucleoside Diphosphate Kinase 3e-42
2cwk_A160 Crystal Structure Of Nucleotide Diphosphate Kinase 3e-42
3pj9_A140 Crystal Structure Of A Nucleoside Diphosphate Kinas 3e-42
1u8w_A149 Crystal Structure Of Arabidopsis Thaliana Nucleosid 6e-42
3b54_A161 Saccharomyces Cerevisiae Nucleoside Diphosphate Kin 6e-42
1leo_A150 P100s Nucleoside Diphosphate Kinase Length = 150 6e-42
3r9l_A155 Crystal Structure Of Nucleoside Diphosphate Kinase 1e-41
1ehw_A162 Human Nucleoside Diphosphate Kinase 4 Length = 162 2e-41
1ncl_A150 Thermal Stability Of Hexameric And Tetrameric Nucle 3e-41
1ndk_A155 X-Ray Structure Of Nucleoside Diphosphate Kinase Le 3e-41
1lwx_A155 Azt Diphosphate Binding To Nucleoside Diphosphate K 5e-41
1w7w_A182 Structure And Mutational Analysis Of A Plant Mitoch 6e-41
1hhq_A155 Role Of Active Site Resiude Lys16 In Nucleoside Dip 7e-41
1nsp_A155 Mechanism Of Phosphate Transfer By Nucleoside Dipho 1e-40
1b4s_A155 Structure Of Nucleoside Diphosphate Kinase H122g Mu 2e-40
1hlw_A155 Structure Of The H122a Mutant Of The Nucleoside Dip 2e-40
2hur_A142 Escherichia Coli Nucleoside Diphosphate Kinase Leng 2e-40
1pae_X155 Nucleoside Diphosphate Kinase Length = 155 5e-40
2nck_R144 Crystal Structure Of Myxococcus Xanthus Nucleoside 9e-40
1pku_A150 Crystal Structure Of Nucleoside Diphosphate Kinase 1e-39
2zua_A174 Crystal Structure Of Nucleoside Diphosphate Kinase 1e-39
1mn7_A155 Ndp Kinase Mutant (H122g;n119s;f64w) In Complex Wit 1e-39
2vu5_A148 Crystal Structure Of Pndk From Bacillus Anthracis L 2e-39
1k44_A136 Mycobacterium Tuberculosis Nucleoside Diphosphate K 5e-39
1xiq_A157 Plasmodium Falciparum Nucleoside Diphosphate Kinase 3e-38
2az1_A181 Structure Of A Halophilic Nucleoside Diphosphate Ki 2e-37
2az3_A164 Structure Of A Halophilic Nucleoside Diphosphate Ki 3e-37
1nb2_A150 Crystal Structure Of Nucleoside Diphosphate Kinase 2e-36
3js9_A156 Crystal Structure Of Nucleoside Diphosphate Kinase 2e-36
3mpd_A151 Crystal Structure Of Nucleoside Diphosphate Kinase 2e-33
3emt_A146 Crystal Structure Of The Mimivirus Ndk +kpn-R107g D 2e-33
3ddi_A146 Crystal Structure Of The Mimivirus Ndk +kpn-N62l-R1 3e-33
3ejm_A146 Crystal Structure Of The Mimivirus Ndk +kpn Mutant 8e-33
3em1_A146 Crystal Structure Of The Mimivirus Ndk +kpn-N62l Do 9e-33
1xqi_A195 Crystal Structure Analysis Of An Ndp Kinase From Py 3e-29
3evw_A142 Crystal Structure Of The Mimivirus Ndk R107g Mutant 3e-28
2b8p_A157 Crystal Structure Of Acanthamoeba Polyphaga Mimivir 3e-28
3fbe_A142 Crystal Structure Of The Mimivirus Ndk N62l-R107g D 3e-28
2b8q_A142 X-Ray Structure Of Acanthamoeba Ployphaga Mimivirus 9e-28
3fbf_A142 Crystal Structure Of The Mimivirus Ndk N62l Mutant 1e-27
gi|330689466|pdb|3NGR|A Chain A, Crystal Structure Of Leishmania Nucleoside Diphosphate Kinase B With Unordered Nucleotide-Binding Loop. Length = 151 Back     alignment and structure
 Score =  189 bits (481), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 53/138 (38%), Positives = 80/138 (57%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+TF  +KPD V+R L+G I+   E  G  +VA K      +QA+  Y     +PFF
Sbjct: 1   MSSERTFIAVKPDGVQRGLVGEIIARFERKGYKLVALKILQPTTEQAQGHYKDLCSKPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
           P LV+   SGP+   V +G+  +   R ++G T+P  +  GTIR  + + +G N  HGSD
Sbjct: 61  PALVKYFSSGPIVCMVWEGKNVVKSGRVLLGATNPADSQPGTIRGDFAVDVGRNVCHGSD 120

Query: 121 SLKTALEEISYWFARNEI 138
           S+++A  EI++WF  +EI
Sbjct: 121 SVESAEREIAFWFKADEI 138


gi|515218|pdb|1NDL|A Chain A, The Awd Nucleotide Diphosphate Kinase From Drosophila Length = 153 Back     alignment and structure
>gi|311772088|pdb|3L7U|A Chain A, Crystal Structure Of Human Nm23-H1 Length = 172 Back     alignment and structure
gi|1311287|pdb|1NSK|R Chain R, The Crystal Structure Of A Human Nucleoside Diphosphate Kinase, Nm23-H2 Length = 152 Back     alignment and structure
>gi|1421609|pdb|1NUE|A Chain A, X-Ray Structure Of Nm23 Human Nucleoside Diphosphate Kinase B Complexed With Gdp At 2 Angstroms Resolution Length = 151 Back     alignment and structure
>gi|206581872|pdb|3BBC|A Chain A, Crystal Structure Of R88a Mutant Of The Nm23-H2 Transcription Factor Length = 151 Back     alignment and structure
gi|20663967|pdb|1JXV|A Chain A, Crystal Structure Of Human Nucleoside Diphosphate Kinase A Length = 152 Back     alignment and structure
>gi|4389317|pdb|1BE4|A Chain A, Nucleoside Diphosphate Kinase Isoform B From Bovine Retina Length = 151 Back     alignment and structure
gi|4558116|pdb|1BHN|A Chain A, Nucleoside Diphosphate Kinase Isoform A From Bovine Retina Length = 152 Back     alignment and structure
>gi|157879424|pdb|1NSQ|A Chain A, Mechanism Of Phosphate Transfer By Nucleoside Diphosphate Kinase: X-Ray Structures Of A Phospho-Histidine Intermediate Of The Enzymes From Drosophila And Dictyostelium Length = 153 Back     alignment and structure
gi|71042461|pdb|1ZS6|A Chain A, Structure Of Human Nucleoside-Diphosphate Kinase 3 Length = 169 Back     alignment and structure
>gi|116667867|pdb|2HVE|A Chain A, S120g Mutant Of Human Nucleoside Diphosphate Kinase A Complexed With Adp Length = 152 Back     alignment and structure
>gi|37928159|pdb|1UCN|A Chain A, X-Ray Structure Of Human Nucleoside Diphosphate Kinase A Complexed With Adp At 2 A Resolution Length = 152 Back     alignment and structure
>gi|157832164|pdb|1NPK|A Chain A, Refined X-Ray Structure Of Dictyostelium Nucleoside Diphosphate Kinase At 1,8 Angstroms Resolution Length = 154 Back     alignment and structure
>gi|56965987|pdb|1S57|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase 2 From Arabidopsis Length = 153 Back     alignment and structure
gi|515221|pdb|1NDP|A Chain A, Adenosine 5'-Diphosphate Binding And The Active Site Of Nucleoside Diphosphate Kinase Length = 155 Back     alignment and structure
gi|75765323|pdb|1WKJ|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase From Thermus Thermophilus Hb8 Length = 137 Back     alignment and structure
gi|85544432|pdb|2CWK|A Chain A, Crystal Structure Of Nucleotide Diphosphate Kinase From Pyrococcus Horikoshii Length = 160 Back     alignment and structure
>gi|312597562|pdb|3PJ9|A Chain A, Crystal Structure Of A Nucleoside Diphosphate Kinase From Campylobacter Jejuni Length = 140 Back     alignment and structure
gi|56966225|pdb|1U8W|A Chain A, Crystal Structure Of Arabidopsis Thaliana Nucleoside Diphosphate Kinase 1 Length = 149 Back     alignment and structure
>gi|209156411|pdb|3B54|A Chain A, Saccharomyces Cerevisiae Nucleoside Diphosphate Kinase Length = 161 Back     alignment and structure
>gi|157831795|pdb|1LEO|A Chain A, P100s Nucleoside Diphosphate Kinase Length = 150 Back     alignment and structure
>gi|329666291|pdb|3R9L|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase From Giardia Lamblia Featuring A Disordered Dinucleotide Binding Site Length = 155 Back     alignment and structure
>gi|8569508|pdb|1EHW|A Chain A, Human Nucleoside Diphosphate Kinase 4 Length = 162 Back     alignment and structure
>gi|157832086|pdb|1NCL|A Chain A, Thermal Stability Of Hexameric And Tetrameric Nucleoside, Diphosphate Kinases Length = 150 Back     alignment and structure
>gi|157832095|pdb|1NDK|A Chain A, X-Ray Structure Of Nucleoside Diphosphate Kinase Length = 155 Back     alignment and structure
>gi|2392444|pdb|1LWX|A Chain A, Azt Diphosphate Binding To Nucleoside Diphosphate Kinase Length = 155 Back     alignment and structure
>gi|56554363|pdb|1W7W|A Chain A, Structure And Mutational Analysis Of A Plant Mitochondrial Nucleoside Diphosphate Kinase: Identification Of Residues Involved In Serine Phosphorylation And Oligomerization. Length = 182 Back     alignment and structure
>gi|14488646|pdb|1HHQ|A Chain A, Role Of Active Site Resiude Lys16 In Nucleoside Diphosphate Kinase Length = 155 Back     alignment and structure
>gi|157832172|pdb|1NSP|A Chain A, Mechanism Of Phosphate Transfer By Nucleoside Diphosphate Kinase: X-Ray Structures Of A Phospho-Histidine Intermediate Of The Enzymes From Drosophila And Dictyostelium Length = 155 Back     alignment and structure
>gi|5542068|pdb|1B4S|A Chain A, Structure Of Nucleoside Diphosphate Kinase H122g Mutant Length = 155 Back     alignment and structure
>gi|13399612|pdb|1HLW|A Chain A, Structure Of The H122a Mutant Of The Nucleoside Diphosphate Kinase Length = 155 Back     alignment and structure
>gi|146387513|pdb|2HUR|A Chain A, Escherichia Coli Nucleoside Diphosphate Kinase Length = 142 Back     alignment and structure
>gi|39654456|pdb|1PAE|X Chain X, Nucleoside Diphosphate Kinase Length = 155 Back     alignment and structure
>gi|494821|pdb|2NCK|R Chain R, Crystal Structure Of Myxococcus Xanthus Nucleoside Diphosphate Kinase And Its Interaction With A Nucleotide Substrate At 2.0 Angstroms Resolution Length = 144 Back     alignment and structure
>gi|61679782|pdb|1PKU|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase From Rice Length = 150 Back     alignment and structure
>gi|256599561|pdb|2ZUA|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase From Haloarcula Quadrata Length = 174 Back     alignment and structure
>gi|24159112|pdb|1MN7|A Chain A, Ndp Kinase Mutant (H122g;n119s;f64w) In Complex With Abazttp Length = 155 Back     alignment and structure
>gi|224983364|pdb|2VU5|A Chain A, Crystal Structure Of Pndk From Bacillus Anthracis Length = 148 Back     alignment and structure
gi|21465772|pdb|1K44|A Chain A, Mycobacterium Tuberculosis Nucleoside Diphosphate Kinase Length = 136 Back     alignment and structure
>gi|56554566|pdb|1XIQ|A Chain A, Plasmodium Falciparum Nucleoside Diphosphate Kinase B Length = 157 Back     alignment and structure
>gi|85544178|pdb|2AZ1|A Chain A, Structure Of A Halophilic Nucleoside Diphosphate Kinase From Halobacterium Salinarum Length = 181 Back     alignment and structure
>gi|85544184|pdb|2AZ3|A Chain A, Structure Of A Halophilic Nucleoside Diphosphate Kinase From Halobacterium Salinarum In Complex With Cdp Length = 164 Back     alignment and structure
>gi|30749604|pdb|1NB2|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase From Bacillus Halodenitrificans Length = 150 Back     alignment and structure
>gi|259090394|pdb|3JS9|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase Family Protein From Babesia Bovis Length = 156 Back     alignment and structure
>gi|295982576|pdb|3MPD|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase From Encephalitozoon Cuniculi, Cubic Form, Apo Length = 151 Back     alignment and structure
>gi|255917859|pdb|3EMT|A Chain A, Crystal Structure Of The Mimivirus Ndk +kpn-R107g Double Mutant Complexed With Dgdp Length = 146 Back     alignment and structure
>gi|240104306|pdb|3DDI|A Chain A, Crystal Structure Of The Mimivirus Ndk +kpn-N62l-R107g Triple Mutant Complexed With Tdp Length = 146 Back     alignment and structure
>gi|256599600|pdb|3EJM|A Chain A, Crystal Structure Of The Mimivirus Ndk +kpn Mutant Complexed With Gdp Length = 146 Back     alignment and structure
>gi|255917857|pdb|3EM1|A Chain A, Crystal Structure Of The Mimivirus Ndk +kpn-N62l Double Mutant Complexed With Dtdp Length = 146 Back     alignment and structure
>gi|78100965|pdb|1XQI|A Chain A, Crystal Structure Analysis Of An Ndp Kinase From Pyrobaculum Aerophilum Length = 195 Back     alignment and structure
>gi|255917867|pdb|3EVW|A Chain A, Crystal Structure Of The Mimivirus Ndk R107g Mutant Complexed With Dtdp Length = 142 Back     alignment and structure
>gi|83754301|pdb|2B8P|A Chain A, Crystal Structure Of Acanthamoeba Polyphaga Mimivirus Ndk, The First Viral Nucleoside Diphosphate Kinase Length = 157 Back     alignment and structure
>gi|240104412|pdb|3FBE|A Chain A, Crystal Structure Of The Mimivirus Ndk N62l-R107g Double Mutant Complexed With Gdp Length = 142 Back     alignment and structure
>gi|83754303|pdb|2B8Q|A Chain A, X-Ray Structure Of Acanthamoeba Ployphaga Mimivirus Nucleoside Diphosphate Kinase Complexed With Tdp Length = 142 Back     alignment and structure
>gi|255917889|pdb|3FBF|A Chain A, Crystal Structure Of The Mimivirus Ndk N62l Mutant Complexed With Dtdp Length = 142 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target140 nucleoside diphosphate kinase [Candidatus Liberibacter
1ehw_A162 NDPK H4, nucleoside diphosphate kinase; NM23, mitochond 1e-47
1nhk_R144 Nucleoside diphosphate kinase; phosphotransferase; HET: 1e-44
3l7u_A172 Nucleoside diphosphate kinase A; ATP-binding, nucleotid 8e-44
1k44_A136 Nucleoside diphosphate kinase; nucleoside triphosphate, 5e-43
3mpd_A151 Nucleoside diphosphate kinase; ssgcid, NIH, niaid, SBRI 5e-42
1nb2_A150 Nucleoside diphosphate kinase; bacillus halodenitrifian 2e-41
1pku_A150 Nucleoside diphosphate kinase I; RICE, transferase; 2.5 3e-41
1wkj_A137 Nucleoside diphosphate kinase; thermus thermophilus HB8 6e-39
2hur_A142 NDK, nucleoside diphosphate kinase, NDP kinase; type II 2e-38
1xqi_A195 Nucleoside diphosphate kinase; alpha/beta sandwich, fer 7e-38
1xiq_A157 Nucleoside diphosphate kinase B; protein structure init 1e-37
1w7w_A182 Nucleoside diphosphate kinase; NDPK3, transferase; 2.80 2e-37
1zs6_A169 Nucleoside diphosphate kinase 3; nucleotide metabolism, 2e-37
3bbb_A151 Nucleoside diphosphate kinase B; transcription factor, 3e-37
3js9_A156 Nucleoside diphosphate kinase family protein; niaid, ss 1e-36
2vu5_A148 Nucleoside diphosphate kinase; nucleotide-binding, ATP- 3e-36
1u8w_A149 Nucleoside diphosphate kinase I; nucleotide diphosphate 4e-36
3b54_A161 NDK, NDP kinase, nucleoside diphosphate kinase; alpha/b 6e-36
1s57_A153 Nucleoside diphosphate kinase II; transferase; HET: EPE 7e-36
3evo_A146 NDP kinase, NDK, nucleoside diphosphate kinase; phospho 9e-35
2az3_A164 Nucleoside diphosphate kinase; halophilic, transferase; 9e-34
3fkb_A155 NDP kinase, NDK, nucleoside diphosphate kinase, cytosol 1e-33
2dxe_A160 Nucleoside diphosphate kinase; nucleoside binding, stru 4e-33
>1ehw_A NDPK H4, nucleoside diphosphate kinase; NM23, mitochondrial, killer- OF-prune, transferase; 2.40A {Homo sapiens} SCOP: d.58.6.1 Length = 162 Back     alignment and structure
 Score =  183 bits (466), Expect = 1e-47
 Identities = 47/136 (34%), Positives = 74/136 (54%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+T   +KPD V+R L+G +++  E  G  +V  K          + Y   + +PF+P L
Sbjct: 25  ERTLVAVKPDGVQRRLVGDVIQRFERRGFTLVGMKMLQAPESVLAEHYQDLRRKPFYPAL 84

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           ++ M SGPV   V +G   +  +R ++G TD  +A  GTIR  + + I  N IH SDS++
Sbjct: 85  IRYMSSGPVVAMVWEGYNVVRASRAMIGHTDSAEAAPGTIRGDFSVHISRNVIHASDSVE 144

Query: 124 TALEEISYWFARNEII 139
            A  EI  WF  +E++
Sbjct: 145 GAQREIQLWFQSSELV 160


>1nhk_R Nucleoside diphosphate kinase; phosphotransferase; HET: CMP; 1.90A {Myxococcus xanthus} SCOP: d.58.6.1 PDB: 1nlk_R* 2nck_R Length = 144 Back     alignment and structure
>3l7u_A Nucleoside diphosphate kinase A; ATP-binding, nucleotide-binding, transferase, tumor suppressor; 2.10A {Homo sapiens} Length = 172 Back     alignment and structure
>1k44_A Nucleoside diphosphate kinase; nucleoside triphosphate, transferase; 2.60A {Mycobacterium tuberculosis} SCOP: d.58.6.1 Length = 136 Back     alignment and structure
>3mpd_A Nucleoside diphosphate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, encepha cuniculi, structural genomics; 2.08A {Encephalitozoon cuniculi} Length = 151 Back     alignment and structure
>1nb2_A Nucleoside diphosphate kinase; bacillus halodenitrifians, transferase; 2.20A {Virgibacillus halodenitrificans} SCOP: d.58.6.1 Length = 150 Back     alignment and structure
>1pku_A Nucleoside diphosphate kinase I; RICE, transferase; 2.50A {Oryza sativa} SCOP: d.58.6.1 Length = 150 Back     alignment and structure
>1wkj_A Nucleoside diphosphate kinase; thermus thermophilus HB8, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.00A {Thermus thermophilus} SCOP: d.58.6.1 PDB: 1wkk_A* 1wkl_A* Length = 137 Back     alignment and structure
>2hur_A NDK, nucleoside diphosphate kinase, NDP kinase; type II tetramer, signaling protein,transferase; 1.62A {Escherichia coli} Length = 142 Back     alignment and structure
>1xqi_A Nucleoside diphosphate kinase; alpha/beta sandwich, ferredoxin fold, transferase; HET: PGE; 2.50A {Pyrobaculum aerophilum} SCOP: d.58.6.1 Length = 195 Back     alignment and structure
>1xiq_A Nucleoside diphosphate kinase B; protein structure initiative, structural genomics, SGPP, PSI; 3.05A {Plasmodium falciparum 3D7} SCOP: d.58.6.1 Length = 157 Back     alignment and structure
>1w7w_A Nucleoside diphosphate kinase; NDPK3, transferase; 2.80A {Pisum sativum} SCOP: d.58.6.1 Length = 182 Back     alignment and structure
>1zs6_A Nucleoside diphosphate kinase 3; nucleotide metabolism, apoptosis, transferase, structural genomics, structural genomics consortium, SGC; HET: ADP; 2.30A {Homo sapiens} SCOP: d.58.6.1 Length = 169 Back     alignment and structure
>3bbb_A Nucleoside diphosphate kinase B; transcription factor, cancer, NM23 GEN, hexamer, activator, anti-oncogene, ATP-binding, cell cycle, cytoplasm; HET: DG DA; 1.30A {Homo sapiens} SCOP: d.58.6.1 PDB: 1nue_A* 3bbf_A* 1nsk_R 3bbc_A 1be4_A* 1bhn_A* 2hvd_A* 1jxv_A* 2hve_A* 1ucn_A* 1nsq_A* 1ndl_A* Length = 151 Back     alignment and structure
>3js9_A Nucleoside diphosphate kinase family protein; niaid, ssgcid, seattle structural genomics center for infectious disease, babesiosis; 2.50A {Babesia bovis T2BO} Length = 156 Back     alignment and structure
>2vu5_A Nucleoside diphosphate kinase; nucleotide-binding, ATP-binding, metal-binding, phosphoprotein, nucleotide metabolism, cytoplasm, magnesium; 2.0A {Bacillus anthracis} Length = 148 Back     alignment and structure
>1u8w_A Nucleoside diphosphate kinase I; nucleotide diphosphate, transferase; 2.40A {Arabidopsis thaliana} SCOP: d.58.6.1 Length = 149 Back     alignment and structure
>3b54_A NDK, NDP kinase, nucleoside diphosphate kinase; alpha/beta sandwich, ATP-binding, cytoplasm, magnesium, metal-binding, mitochondrion; 3.10A {Saccharomyces cerevisiae} Length = 161 Back     alignment and structure
>1s57_A Nucleoside diphosphate kinase II; transferase; HET: EPE; 1.80A {Arabidopsis thaliana} SCOP: d.58.6.1 PDB: 1s59_A* Length = 153 Back     alignment and structure
>3evo_A NDP kinase, NDK, nucleoside diphosphate kinase; phosphotransferase nucleotide binding, ATP-binding, magnesium, metal-binding; HET: TYD; 1.50A {Acanthamoeba polyphaga mimivirus} PDB: 3ejm_A* 3emt_A* 3em1_A* 3fc9_A* 3g2x_A* 3ena_A* 3dkd_A* 3ddi_A* 3etm_A* 3evm_A* 3fcv_A* 3b6b_A* 2b8p_A* 3gp9_A* 2b8q_A* 3ee3_A* 3elh_A* 3eic_A* 3evw_A* 3gpa_A* ... Length = 146 Back     alignment and structure
>2az3_A Nucleoside diphosphate kinase; halophilic, transferase; HET: CDP; 2.20A {Halobacterium salinarum} SCOP: d.58.6.1 PDB: 2az1_A 2zua_A Length = 164 Back     alignment and structure
>3fkb_A NDP kinase, NDK, nucleoside diphosphate kinase, cytosolic; AN hexamer structure, ATP-binding, cytoplasm, magnesium, metal-binding; HET: TNM TNV; 1.65A {Dictyostelium discoideum} PDB: 1b4s_A* 1mn9_A* 1f3f_A* 1hlw_A 1ndk_A 1pae_X 1f6t_A* 1bux_A* 1b99_A* 1hiy_A* 1kdn_A* 1ndc_A* 1ndp_A* 1nsp_A* 1s5z_A* 2bef_A* 1mn7_A* 1hhq_A 1lwx_A* 1npk_A ... Length = 155 Back     alignment and structure
>2dxe_A Nucleoside diphosphate kinase; nucleoside binding, structural genomics, NPPSFA; HET: GDP; 1.70A {Pyrococcus horikoshii OT3} SCOP: d.58.6.1 PDB: 2dxd_A* 2cwk_A* 2dxf_A* 2dy9_A* 2dya_A* Length = 160 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target140 nucleoside diphosphate kinase [Candidatus Liberibacter
1xqi_A195 Nucleoside diphosphate kinase; alpha/beta sandwich, fer 100.0
3js9_A156 Nucleoside diphosphate kinase family protein; niaid, ss 100.0
1w7w_A182 Nucleoside diphosphate kinase; NDPK3, transferase; 2.80 100.0
1xiq_A157 Nucleoside diphosphate kinase B; protein structure init 100.0
1zs6_A169 Nucleoside diphosphate kinase 3; nucleotide metabolism, 100.0
3bbb_A151 Nucleoside diphosphate kinase B; transcription factor, 100.0
3fkb_A155 NDP kinase, NDK, nucleoside diphosphate kinase, cytosol 100.0
1s57_A153 Nucleoside diphosphate kinase II; transferase; HET: EPE 100.0
2vu5_A148 Nucleoside diphosphate kinase; nucleotide-binding, ATP- 100.0
1ehw_A162 NDPK H4, nucleoside diphosphate kinase; NM23, mitochond 100.0
1wkj_A137 Nucleoside diphosphate kinase; thermus thermophilus HB8 100.0
3l7u_A172 Nucleoside diphosphate kinase A; ATP-binding, nucleotid 100.0
2hur_A142 NDK, nucleoside diphosphate kinase, NDP kinase; type II 100.0
1nhk_R144 Nucleoside diphosphate kinase; phosphotransferase; HET: 100.0
1nb2_A150 Nucleoside diphosphate kinase; bacillus halodenitrifian 100.0
1u8w_A149 Nucleoside diphosphate kinase I; nucleotide diphosphate 100.0
3mpd_A151 Nucleoside diphosphate kinase; ssgcid, NIH, niaid, SBRI 100.0
3b54_A161 NDK, NDP kinase, nucleoside diphosphate kinase; alpha/b 100.0
2az3_A164 Nucleoside diphosphate kinase; halophilic, transferase; 100.0
1pku_A150 Nucleoside diphosphate kinase I; RICE, transferase; 2.5 100.0
3evo_A146 NDP kinase, NDK, nucleoside diphosphate kinase; phospho 100.0
2dxe_A160 Nucleoside diphosphate kinase; nucleoside binding, stru 100.0
1k44_A136 Nucleoside diphosphate kinase; nucleoside triphosphate, 100.0
3bh7_B352 Protein XRP2; protein-protein complex, GTPase activatin 97.91
>1xqi_A Nucleoside diphosphate kinase; alpha/beta sandwich, ferredoxin fold, transferase; HET: PGE; 2.50A {Pyrobaculum aerophilum} SCOP: d.58.6.1 Back     alignment and structure
Probab=100.00  E-value=0  Score=367.61  Aligned_cols=139  Identities=39%  Similarity=0.604  Sum_probs=134.9

Q ss_pred             CCCCEEEEEECCHHHHCCCHHHHHHHHHHCCCEEEEHHHCCCCHHHHHHHHHHHC-------------------------
Q ss_conf             9631023045523771898799999997255589210011269999999988851-------------------------
Q gi|254780390|r    1 MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHK-------------------------   55 (140)
Q Consensus         1 m~~e~Tl~iIKPDav~~~~~g~Ii~~i~~~Gf~I~~~k~~~ls~e~a~~fY~~~~-------------------------   55 (140)
                      |.+||||+|||||||+++++|+|+++|+++||+|+++|++++|+++|++||.+|+                         
T Consensus        13 m~~ErTl~iIKPDav~r~lvgeIi~rie~~Gf~Iv~~k~~~lt~e~ae~fY~~h~~~~~~~~~~~~~~~~~~~~~~~~~~   92 (195)
T 1xqi_A           13 MPVEKTLLILKPDAVARGLVDEIISRFKKAGLKIVALKMVKASPEEIERFYPSSEEWLQSAGQKLLKAYQELGIDPRAKI   92 (195)
T ss_dssp             -CCCEEEEEECHHHHHTTCHHHHHHHHHHHTCEEEEEEEECCCHHHHHHHSCCCHHHHHHHHHHHHHHHHHHTCCHHHHH
T ss_pred             HHHHHEEEEECCHHHCCCCHHHHHHHHHHCCCEEEEEEEECCCHHHHHHHHHHHHHHHHHCCCHHHHHHHHHCCCCCCCC
T ss_conf             06754188989435324789999999998799999875123899999999999888775302012245665313520000


Q ss_pred             --------CCCCCCHHHHHCCCCCEEEEECCCCCHHHHHHHHCCCCCHHHCCCCCCCHHCCCCH----------HHEEEE
Q ss_conf             --------47421001221001115771111640178999661889977768997000101152----------210044
Q gi|254780390|r   56 --------DRPFFPELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISI----------GENSIH  117 (140)
Q Consensus        56 --------~k~ff~~lv~~m~sGpv~alvl~g~naV~~~R~l~Gptdp~~a~p~tiR~~fg~~~----------~~N~vH  117 (140)
                              |||||++|++||+||||++|+|+|+|||+.||+|+|||||.+|+|+||||+||.+.          ++|+||
T Consensus        93 ~~~~~~~~Gk~f~~~Lv~~MtSGPvva~vl~g~~aV~~~R~l~GpTdP~~A~PgTIRg~fg~d~~~~~~~~~~~~rN~vH  172 (195)
T 1xqi_A           93 GTDDPVEVGRIIKRNLVKYMTSGPNVVMVLKGNRAVEIVRKLVGPTSPHSAPPGTIRGDYSIDSPDLAAEEGRVVFNLVH  172 (195)
T ss_dssp             SCCCHHHHHHHHHHHHHHHHTSSCEEEEEEESTTHHHHHHHHHCCSCGGGSCTTSHHHHHCCCCHHHHHHTTSCCCCSEE
T ss_pred             CCCCCCCCCCCCHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHCCCCCCCCCCCCHHHHHCCCCHHHCCCCCCCCCEEEE
T ss_conf             23342115886338899998379769999736888999998828998364899971776466720100113667543068


Q ss_pred             ECCCHHHHHHHHHHHCCHHHCC
Q ss_conf             0699899999998726856506
Q gi|254780390|r  118 GSDSLKTALEEISYWFARNEII  139 (140)
Q Consensus       118 ~Sds~e~a~rEi~~fF~~~ei~  139 (140)
                      ||||+|+|+|||+||||++||+
T Consensus       173 aSDs~e~A~rEi~~fF~~~ei~  194 (195)
T 1xqi_A          173 ASDSPSEAEREIRFWFREEEVL  194 (195)
T ss_dssp             ECSSHHHHHHHHHHHCCGGGSC
T ss_pred             CCCCHHHHHHHHHHCCCHHHCC
T ss_conf             8999999999999668944227



>3js9_A Nucleoside diphosphate kinase family protein; niaid, ssgcid, seattle structural genomics center for infectious disease, babesiosis; 2.50A {Babesia bovis T2BO} Back     alignment and structure
>1w7w_A Nucleoside diphosphate kinase; NDPK3, transferase; 2.80A {Pisum sativum} SCOP: d.58.6.1 Back     alignment and structure
>1xiq_A Nucleoside diphosphate kinase B; protein structure initiative, structural genomics, SGPP, PSI; 3.05A {Plasmodium falciparum 3D7} SCOP: d.58.6.1 Back     alignment and structure
>1zs6_A Nucleoside diphosphate kinase 3; nucleotide metabolism, apoptosis, transferase, structural genomics, structural genomics consortium, SGC; HET: ADP; 2.30A {Homo sapiens} SCOP: d.58.6.1 Back     alignment and structure
>3bbb_A Nucleoside diphosphate kinase B; transcription factor, cancer, NM23 GEN, hexamer, activator, oncogene, ATP-binding, cell cycle, DNA-binding; HET: DG DA; 1.30A {Homo sapiens} SCOP: d.58.6.1 PDB: 1nue_A* 3bbf_A* 1nsk_R 3bbc_A 1be4_A* 1bhn_A* 2hvd_A* 1jxv_A* 2hve_A* 1ucn_A* 1nsq_A* 1ndl_A* Back     alignment and structure
>3fkb_A NDP kinase, NDK, nucleoside diphosphate kinase, cytosolic; AN hexamer structure, ATP-binding, cytoplasm, magnesium, metal-binding; HET: TNM TNV; 1.65A {Dictyostelium discoideum} PDB: 1b4s_A* 1mn9_A* 1f3f_A* 1hlw_A 1ndk_A 1pae_X 1f6t_A* 1bux_A* 1b99_A* 1hiy_A* 1kdn_A* 1ndc_A* 1ndp_A* 1nsp_A* 1s5z_A* 2bef_A* 1mn7_A* 1hhq_A 1lwx_A* 1npk_A ... Back     alignment and structure
>1s57_A Nucleoside diphosphate kinase II; transferase; HET: EPE; 1.80A {Arabidopsis thaliana} SCOP: d.58.6.1 PDB: 1s59_A* Back     alignment and structure
>2vu5_A Nucleoside diphosphate kinase; nucleotide-binding, ATP-binding, metal-binding, phosphoprotein, nucleotide metabolism, cytoplasm, magnesium; 2.0A {Bacillus anthracis} Back     alignment and structure
>1ehw_A NDPK H4, nucleoside diphosphate kinase; NM23, mitochondrial, killer- OF-prune, transferase; 2.40A {Homo sapiens} SCOP: d.58.6.1 Back     alignment and structure
>1wkj_A Nucleoside diphosphate kinase; thermus thermophilus HB8, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.00A {Thermus thermophilus} SCOP: d.58.6.1 PDB: 1wkk_A* 1wkl_A* Back     alignment and structure
>3l7u_A Nucleoside diphosphate kinase A; ATP-binding, nucleotide-binding, transferase, tumor suppressor; 2.10A {Homo sapiens} Back     alignment and structure
>2hur_A NDK, nucleoside diphosphate kinase, NDP kinase; type II tetramer, signaling protein,transferase; 1.62A {Escherichia coli} Back     alignment and structure
>1nhk_R Nucleoside diphosphate kinase; phosphotransferase; HET: CMP; 1.90A {Myxococcus xanthus} SCOP: d.58.6.1 PDB: 1nlk_R* 2nck_R Back     alignment and structure
>1nb2_A Nucleoside diphosphate kinase; bacillus halodenitrifians, transferase; 2.20A {Virgibacillus halodenitrificans} SCOP: d.58.6.1 Back     alignment and structure
>1u8w_A Nucleoside diphosphate kinase I; nucleotide diphosphate, transferase; 2.40A {Arabidopsis thaliana} SCOP: d.58.6.1 Back     alignment and structure
>3mpd_A Nucleoside diphosphate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, encepha cuniculi, structural genomics; 2.08A {Encephalitozoon cuniculi} Back     alignment and structure
>3b54_A NDK, NDP kinase, nucleoside diphosphate kinase; alpha/beta sandwich, ATP-binding, cytoplasm, magnesium, metal-binding, mitochondrion; 3.10A {Saccharomyces cerevisiae} Back     alignment and structure
>2az3_A Nucleoside diphosphate kinase; halophilic, transferase; HET: CDP; 2.20A {Halobacterium salinarum} SCOP: d.58.6.1 PDB: 2az1_A 2zua_A Back     alignment and structure
>1pku_A Nucleoside diphosphate kinase I; RICE, transferase; 2.50A {Oryza sativa} SCOP: d.58.6.1 Back     alignment and structure
>3evo_A NDP kinase, NDK, nucleoside diphosphate kinase; phosphotransferase nucleotide binding, ATP-binding, magnesium, metal-binding; HET: TYD; 1.50A {Acanthamoeba polyphaga mimivirus} PDB: 3ejm_A* 3emt_A* 3em1_A* 3fc9_A* 3g2x_A* 3ena_A* 3dkd_A* 3ddi_A* 3etm_A* 3evm_A* 3fcv_A* 3b6b_A* 2b8p_A* 3gp9_A* 2b8q_A* 3ee3_A* 3elh_A* 3eic_A* 3evw_A* 3gpa_A* ... Back     alignment and structure
>2dxe_A Nucleoside diphosphate kinase; nucleoside binding, structural genomics, NPPSFA; HET: GDP; 1.70A {Pyrococcus horikoshii OT3} SCOP: d.58.6.1 PDB: 2dxd_A* 2cwk_A* 2dxf_A* 2dy9_A* 2dya_A* Back     alignment and structure
>1k44_A Nucleoside diphosphate kinase; nucleoside triphosphate, transferase; 2.60A {Mycobacterium tuberculosis} SCOP: d.58.6.1 Back     alignment and structure
>3bh7_B Protein XRP2; protein-protein complex, GTPase activating protein and GTPase, retinitis pigmentosa, GTP-binding, lipoprotein, myristate; HET: GDP; 1.90A {Homo sapiens} PDB: 3bh6_B* 2bx6_A Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 140 nucleoside diphosphate kinase [Candidatus Liberibacter
d1wkja1137 d.58.6.1 (A:1-137) Nucleoside diphosphate kinase, NDK { 1e-39
d3bbba1150 d.58.6.1 (A:2-151) Nucleoside diphosphate kinase, NDK { 3e-39
d1nhkl_143 d.58.6.1 (L:) Nucleoside diphosphate kinase, NDK {Myxoc 1e-38
d1xqia1182 d.58.6.1 (A:14-195) Nucleoside diphosphate kinase, NDK 2e-38
d1zs6a1152 d.58.6.1 (A:18-169) Nucleoside diphosphate kinase, NDK 3e-37
d1ehwa_143 d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Human 4e-37
d1w7wa_151 d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Pea ( 1e-36
d1s57a_153 d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Thale 3e-36
d1k44a_135 d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Mycob 3e-36
d1xiqa_149 d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Plasm 5e-36
d1u8wa_149 d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Thale 6e-36
d1hlwa_150 d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Dicty 7e-35
d2az3a1152 d.58.6.1 (A:4-155) Nucleoside diphosphate kinase, NDK { 2e-34
d2dyaa1153 d.58.6.1 (A:6-158) Nucleoside diphosphate kinase, NDK { 2e-33
d1nb2a_149 d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Bacil 5e-33
d2b8qa1128 d.58.6.1 (A:2-129) Nucleoside diphosphate kinase, NDK { 1e-29
>d1wkja1 d.58.6.1 (A:1-137) Nucleoside diphosphate kinase, NDK {Thermus thermophilus [TaxId: 274]} Length = 137 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: Nucleoside diphosphate kinase, NDK
family: Nucleoside diphosphate kinase, NDK
domain: Nucleoside diphosphate kinase, NDK
species: Thermus thermophilus [TaxId: 274]
 Score =  155 bits (394), Expect = 1e-39
 Identities = 59/137 (43%), Positives = 88/137 (64%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF MIKPD V+R L+G I+   E  G  + A K   ++++ AE  Y  H+++PFFP 
Sbjct: 1   MERTFVMIKPDGVRRGLVGEILARFERKGFRIAALKLMQISQELAERHYAEHREKPFFPG 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV+ + SGPV   VL+G   +++ R++MG T PK AL GTIR  +  +I EN IHGS +L
Sbjct: 61  LVRFITSGPVVAMVLEGPGVVAEVRKMMGATHPKDALPGTIRGDFATTIDENVIHGSATL 120

Query: 123 KTALEEISYWFARNEII 139
           + A  EI+ +F   E++
Sbjct: 121 EDAQREIALFFRPEELL 137


>d3bbba1 d.58.6.1 (A:2-151) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens) [TaxId: 9606]} Length = 150 Back     information, alignment and structure
>d1nhkl_ d.58.6.1 (L:) Nucleoside diphosphate kinase, NDK {Myxococcus xanthus [TaxId: 34]} Length = 143 Back     information, alignment and structure
>d1xqia1 d.58.6.1 (A:14-195) Nucleoside diphosphate kinase, NDK {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 182 Back     information, alignment and structure
>d1zs6a1 d.58.6.1 (A:18-169) Nucleoside diphosphate kinase, NDK {Human(Homo sapiens), NDK3 [TaxId: 9606]} Length = 152 Back     information, alignment and structure
>d1ehwa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens), NDK4 [TaxId: 9606]} Length = 143 Back     information, alignment and structure
>d1w7wa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Pea (Pisum sativum) [TaxId: 3888]} Length = 151 Back     information, alignment and structure
>d1s57a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Thale cress (Arabidopsis thaliana), chloroplast NDK2 [TaxId: 3702]} Length = 153 Back     information, alignment and structure
>d1k44a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Mycobacterium tuberculosis [TaxId: 1773]} Length = 135 Back     information, alignment and structure
>d1xiqa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Length = 149 Back     information, alignment and structure
>d1u8wa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 149 Back     information, alignment and structure
>d1hlwa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Dictyostelium discoideum [TaxId: 44689]} Length = 150 Back     information, alignment and structure
>d2az3a1 d.58.6.1 (A:4-155) Nucleoside diphosphate kinase, NDK {Archaeon Halobacterium salinarum [TaxId: 2242]} Length = 152 Back     information, alignment and structure
>d2dyaa1 d.58.6.1 (A:6-158) Nucleoside diphosphate kinase, NDK {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 153 Back     information, alignment and structure
>d1nb2a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Bacillus halodenitrificans [TaxId: 1482]} Length = 149 Back     information, alignment and structure
>d2b8qa1 d.58.6.1 (A:2-129) Nucleoside diphosphate kinase, NDK {Mimivirus [TaxId: 315393]} Length = 128 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target140 nucleoside diphosphate kinase [Candidatus Liberibacter
d1ehwa_143 Nucleoside diphosphate kinase, NDK {Human (Homo sapiens 100.0
d1nhkl_143 Nucleoside diphosphate kinase, NDK {Myxococcus xanthus 100.0
d1w7wa_151 Nucleoside diphosphate kinase, NDK {Pea (Pisum sativum) 100.0
d1hlwa_150 Nucleoside diphosphate kinase, NDK {Dictyostelium disco 100.0
d1zs6a1152 Nucleoside diphosphate kinase, NDK {Human(Homo sapiens) 100.0
d1xqia1182 Nucleoside diphosphate kinase, NDK {Archaeon Pyrobaculu 100.0
d1xiqa_149 Nucleoside diphosphate kinase, NDK {Plasmodium falcipar 100.0
d1wkja1137 Nucleoside diphosphate kinase, NDK {Thermus thermophilu 100.0
d3bbba1150 Nucleoside diphosphate kinase, NDK {Human (Homo sapiens 100.0
d1s57a_153 Nucleoside diphosphate kinase, NDK {Thale cress (Arabid 100.0
d1u8wa_149 Nucleoside diphosphate kinase, NDK {Thale cress (Arabid 100.0
d1nb2a_149 Nucleoside diphosphate kinase, NDK {Bacillus halodenitr 100.0
d2az3a1152 Nucleoside diphosphate kinase, NDK {Archaeon Halobacter 100.0
d2dyaa1153 Nucleoside diphosphate kinase, NDK {Archaeon Pyrococcus 100.0
d1k44a_135 Nucleoside diphosphate kinase, NDK {Mycobacterium tuber 100.0
d2b8qa1128 Nucleoside diphosphate kinase, NDK {Mimivirus [TaxId: 3 100.0
>d1ehwa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens), NDK4 [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: Nucleoside diphosphate kinase, NDK
family: Nucleoside diphosphate kinase, NDK
domain: Nucleoside diphosphate kinase, NDK
species: Human (Homo sapiens), NDK4 [TaxId: 9606]
Probab=100.00  E-value=0  Score=359.79  Aligned_cols=139  Identities=35%  Similarity=0.643  Sum_probs=136.4

Q ss_pred             CC-CCEEEEEECCHHHHCCCHHHHHHHHHHCCCEEEEHHHCCCCHHHHHHHHHHHCCCCCCCHHHHHCCCCCEEEEECCC
Q ss_conf             96-31023045523771898799999997255589210011269999999988851474210012210011157711116
Q gi|254780390|r    1 MV-IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPELVQAMISGPVFLQVLKG   79 (140)
Q Consensus         1 m~-~e~Tl~iIKPDav~~~~~g~Ii~~i~~~Gf~I~~~k~~~ls~e~a~~fY~~~~~k~ff~~lv~~m~sGpv~alvl~g   79 (140)
                      |+ .||||+||||||++++++|+|+++|+++||.|+++|++++|+++|++||.+|++||||++|++||+||||+||+|+|
T Consensus         2 m~~~E~Tl~iIKPDav~~~~~g~Ii~~i~~~Gf~Iv~~k~~~lt~e~a~~~Y~~~~~k~f~~~lv~~m~sGp~~a~~l~g   81 (143)
T d1ehwa_           2 MGTRERTLVAVKPDGVQRRLVGDVIQRFERRGFTLVGMKMLQAPESVLAEHYQDLRRKPFYPALIRYMSSGPVVAMVWEG   81 (143)
T ss_dssp             CGGGCEEEEEECHHHHHTTCHHHHHHHHHHTTCEEEEEEEECCCHHHHHHHTGGGTTSTTHHHHHHHHTSSCEEEEEEES
T ss_pred             CCCCCEEEEEECCHHHHCCCHHHHHHHHHHCCCEEEEEEEEECCHHHHHHHHHHHHCCHHHHHHHHEECCCCEEEEECCH
T ss_conf             87611699999934650378999999999859989660555169999999999983232455455100478887775230


Q ss_pred             CCHHHHHHHHCCCCCHHHCCCCCCCHHCCCCHHHEEEEECCCHHHHHHHHHHHCCHHHCC
Q ss_conf             401789996618899777689970001011522100440699899999998726856506
Q gi|254780390|r   80 EEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLKTALEEISYWFARNEII  139 (140)
Q Consensus        80 ~naV~~~R~l~Gptdp~~a~p~tiR~~fg~~~~~N~vH~Sds~e~a~rEi~~fF~~~ei~  139 (140)
                      +|||..||+++|||||.+|+|+||||+||++.++|+||||||+++|+||++||||++||+
T Consensus        82 ~naV~~~R~l~Gpt~p~~a~p~siR~~yg~~~~~N~vH~Sds~e~A~~Ei~~fF~~~ei~  141 (143)
T d1ehwa_          82 YNVVRASRAMIGHTDSAEAAPGTIRGDFSVHISRNVIHASDSVEGAQREIQLWFQSSELV  141 (143)
T ss_dssp             TTHHHHHHHHHCCSSGGGSCTTSHHHHHCCCSSCCSEEECSSHHHHHHHHHHHCCGGGCC
T ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCHHHHHCCCCCCCEECCCCHHHHHHHHHHHCCHHHCC
T ss_conf             237899998756898353899980766527435788577899999999999719933324



>d1nhkl_ d.58.6.1 (L:) Nucleoside diphosphate kinase, NDK {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1w7wa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1hlwa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1zs6a1 d.58.6.1 (A:18-169) Nucleoside diphosphate kinase, NDK {Human(Homo sapiens), NDK3 [TaxId: 9606]} Back     information, alignment and structure
>d1xqia1 d.58.6.1 (A:14-195) Nucleoside diphosphate kinase, NDK {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1xiqa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1wkja1 d.58.6.1 (A:1-137) Nucleoside diphosphate kinase, NDK {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d3bbba1 d.58.6.1 (A:2-151) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s57a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Thale cress (Arabidopsis thaliana), chloroplast NDK2 [TaxId: 3702]} Back     information, alignment and structure
>d1u8wa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1nb2a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Bacillus halodenitrificans [TaxId: 1482]} Back     information, alignment and structure
>d2az3a1 d.58.6.1 (A:4-155) Nucleoside diphosphate kinase, NDK {Archaeon Halobacterium salinarum [TaxId: 2242]} Back     information, alignment and structure
>d2dyaa1 d.58.6.1 (A:6-158) Nucleoside diphosphate kinase, NDK {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1k44a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2b8qa1 d.58.6.1 (A:2-129) Nucleoside diphosphate kinase, NDK {Mimivirus [TaxId: 315393]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 140 nucleoside diphosphate kinase [Candidatus Liberiba
1xiq_A_157 (A:) Nucleoside diphosphate kinase B; protein stru 1e-39
1nhk_R_144 (R:) Nucleoside diphosphate kinase; phosphotransfe 2e-39
1zs6_A_169 (A:) Nucleoside diphosphate kinase 3; nucleotide m 2e-39
2vu5_A_148 (A:) Nucleoside diphosphate kinase; nucleotide-bin 2e-39
3bbb_A_151 (A:) Nucleoside diphosphate kinase B; transcriptio 2e-39
1wkj_A_137 (A:) Nucleoside diphosphate kinase; thermus thermo 4e-39
1s57_A_153 (A:) Nucleoside diphosphate kinase II; transferase 5e-39
3js9_A_156 (A:) Nucleoside diphosphate kinase family protein; 5e-39
2az3_A_164 (A:) Nucleoside diphosphate kinase; halophilic, tr 6e-39
1ehw_A_162 (A:) NDPK H4, nucleoside diphosphate kinase; NM23, 8e-39
1pku_A_150 (A:) Nucleoside diphosphate kinase I; RICE, transf 9e-39
3fkb_A_155 (A:) NDP kinase, NDK, nucleoside diphosphate kinas 1e-38
3b54_A_161 (A:) NDK, NDP kinase, nucleoside diphosphate kinas 2e-38
2hur_A_142 (A:) NDK, nucleoside diphosphate kinase, NDP kinas 3e-38
1nb2_A_150 (A:) Nucleoside diphosphate kinase; bacillus halod 3e-38
2dxe_A_160 (A:) Nucleoside diphosphate kinase; nucleoside bin 5e-38
1w7w_A_182 (A:) Nucleoside diphosphate kinase; NDPK3, transfe 6e-38
1u8w_A_149 (A:) Nucleoside diphosphate kinase I; nucleotide d 1e-37
1k44_A_136 (A:) Nucleoside diphosphate kinase; nucleoside tri 1e-36
3evo_A_146 (A:) NDP kinase, NDK, nucleoside diphosphate kinas 1e-36
1xqi_A_195 (A:) Nucleoside diphosphate kinase; alpha/beta san 3e-33
3bh7_B_214-352139 (B:214-352) Protein XRP2; protein-protein complex, 4e-29
>1xiq_A (A:) Nucleoside diphosphate kinase B; protein structure initiative, structural genomics, SGPP, PSI; 3.05A {Plasmodium falciparum 3D7}Length = 157 Back     alignment and structure
 Score =  156 bits (394), Expect = 1e-39
 Identities = 51/139 (36%), Positives = 83/139 (59%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
             +EK+F MIKPD V+R L+G+I+K  E  G  ++A K      +  ++ Y    D+PFF
Sbjct: 7   HHMEKSFIMIKPDGVQRGLVGTIIKRFEKKGYKLIAIKMLNPTEEILKEHYKELSDQPFF 66

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV  +  GPV   V +G + + + R+++G+T+P  +  GTIR  + + + +N IHGSD
Sbjct: 67  KNLVAYISKGPVVAMVWEGVDMVKQGRKLIGETNPLTSNTGTIRGDFCLEVSKNVIHGSD 126

Query: 121 SLKTALEEISYWFARNEII 139
           S+ +A +EI+ WF   E+ 
Sbjct: 127 SVASANKEINIWFKAEELT 145


>1nhk_R (R:) Nucleoside diphosphate kinase; phosphotransferase; HET: CMP; 1.90A {Myxococcus xanthus}Length = 144 Back     alignment and structure
>1zs6_A (A:) Nucleoside diphosphate kinase 3; nucleotide metabolism, apoptosis, transferase, structural genomics, structural genomics consortium, SGC; HET: ADP; 2.30A {Homo sapiens}Length = 169 Back     alignment and structure
>2vu5_A (A:) Nucleoside diphosphate kinase; nucleotide-binding, ATP-binding, metal-binding, phosphoprotein, nucleotide metabolism, cytoplasm, magnesium; 2.0A {Bacillus anthracis}Length = 148 Back     alignment and structure
>3bbb_A (A:) Nucleoside diphosphate kinase B; transcription factor, cancer, NM23 GEN, hexamer, activator, anti-oncogene, ATP-binding, cell cycle, cytoplasm; HET: DG DA; 1.30A {Homo sapiens}Length = 151 Back     alignment and structure
>1wkj_A (A:) Nucleoside diphosphate kinase; thermus thermophilus HB8, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.00A {Thermus thermophilus}Length = 137 Back     alignment and structure
>1s57_A (A:) Nucleoside diphosphate kinase II; transferase; HET: EPE; 1.80A {Arabidopsis thaliana}Length = 153 Back     alignment and structure
>3js9_A (A:) Nucleoside diphosphate kinase family protein; niaid, ssgcid, seattle structural genomics center for infectious disease, babesiosis; 2.50A {Babesia bovis T2BO}Length = 156 Back     alignment and structure
>2az3_A (A:) Nucleoside diphosphate kinase; halophilic, transferase; HET: CDP; 2.20A {Halobacterium salinarum}Length = 164 Back     alignment and structure
>1ehw_A (A:) NDPK H4, nucleoside diphosphate kinase; NM23, mitochondrial, killer- OF-prune, transferase; 2.40A {Homo sapiens}Length = 162 Back     alignment and structure
>1pku_A (A:) Nucleoside diphosphate kinase I; RICE, transferase; 2.50A {Oryza sativa}Length = 150 Back     alignment and structure
>3fkb_A (A:) NDP kinase, NDK, nucleoside diphosphate kinase, cytosolic; AN hexamer structure, ATP-binding, cytoplasm, magnesium, metal-binding; HET: TNM TNV; 1.65A {Dictyostelium discoideum} PDB: 1b4s_A* 1mn9_A* 1f3f_A* 1hlw_A 1ndk_A 1pae_X 1f6t_A* 1bux_A* 1b99_A* 1hiy_A* 1kdn_A* 1ndc_A* 1ndp_A* 1nsp_A* 1s5z_A* 2bef_A* 1mn7_A* 1hhq_A 1lwx_A* 1npk_A ...Length = 155 Back     alignment and structure
>3b54_A (A:) NDK, NDP kinase, nucleoside diphosphate kinase; alpha/beta sandwich, ATP-binding, cytoplasm, magnesium, metal-binding, mitochondrion; 3.10A {Saccharomyces cerevisiae}Length = 161 Back     alignment and structure
>2hur_A (A:) NDK, nucleoside diphosphate kinase, NDP kinase; type II tetramer, signaling protein,transferase; 1.62A {Escherichia coli}Length = 142 Back     alignment and structure
>1nb2_A (A:) Nucleoside diphosphate kinase; bacillus halodenitrifians, transferase; 2.20A {Virgibacillus halodenitrificans}Length = 150 Back     alignment and structure
>2dxe_A (A:) Nucleoside diphosphate kinase; nucleoside binding, structural genomics, NPPSFA; HET: GDP; 1.70A {Pyrococcus horikoshii OT3}Length = 160 Back     alignment and structure
>1w7w_A (A:) Nucleoside diphosphate kinase; NDPK3, transferase; 2.80A {Pisum sativum}Length = 182 Back     alignment and structure
>1u8w_A (A:) Nucleoside diphosphate kinase I; nucleotide diphosphate, transferase; 2.40A {Arabidopsis thaliana}Length = 149 Back     alignment and structure
>1k44_A (A:) Nucleoside diphosphate kinase; nucleoside triphosphate, transferase; 2.60A {Mycobacterium tuberculosis}Length = 136 Back     alignment and structure
>3evo_A (A:) NDP kinase, NDK, nucleoside diphosphate kinase; phosphotransferase nucleotide binding, ATP-binding, magnesium, metal-binding; HET: TYD; 1.50A {Acanthamoeba polyphaga mimivirus} PDB: 3ejm_A* 3emt_A* 3em1_A* 3fc9_A* 3g2x_A* 3ena_A* 3dkd_A* 3ddi_A* 3etm_A* 3evm_A* 3fcv_A* 3b6b_A* 2b8p_A* 3gp9_A* 2b8q_A* 3ee3_A* 3elh_A* 3eic_A* 3evw_A* 3gpa_A* ...Length = 146 Back     alignment and structure
>1xqi_A (A:) Nucleoside diphosphate kinase; alpha/beta sandwich, ferredoxin fold, transferase; HET: PGE; 2.50A {Pyrobaculum aerophilum}Length = 195 Back     alignment and structure
>3bh7_B (B:214-352) Protein XRP2; protein-protein complex, GTPase activating protein and GTPase, retinitis pigmentosa, GTP-binding, lipoprotein, myristate; HET: GDP; 1.90A {Homo sapiens} PDB: 3bh6_B* 2bx6_ALength = 139 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target140 nucleoside diphosphate kinase [Candidatus Liberibacter
1xqi_A_195 Nucleoside diphosphate kinase; alpha/beta sandwich 100.0
2az3_A_164 Nucleoside diphosphate kinase; halophilic, transfe 100.0
2hur_A_142 NDK, nucleoside diphosphate kinase, NDP kinase; ty 100.0
1wkj_A_137 Nucleoside diphosphate kinase; thermus thermophilu 100.0
2vu5_A_148 Nucleoside diphosphate kinase; nucleotide-binding, 100.0
3js9_A_156 Nucleoside diphosphate kinase family protein; niai 100.0
3b54_A_161 NDK, NDP kinase, nucleoside diphosphate kinase; al 100.0
1s57_A_153 Nucleoside diphosphate kinase II; transferase; HET 100.0
3fkb_A_155 NDP kinase, NDK, nucleoside diphosphate kinase, cy 100.0
3bbb_A_151 Nucleoside diphosphate kinase B; transcription fac 100.0
1nhk_R_144 Nucleoside diphosphate kinase; phosphotransferase; 100.0
1zs6_A_169 Nucleoside diphosphate kinase 3; nucleotide metabo 100.0
1pku_A_150 Nucleoside diphosphate kinase I; RICE, transferase 100.0
1w7w_A_182 Nucleoside diphosphate kinase; NDPK3, transferase; 100.0
1xiq_A_157 Nucleoside diphosphate kinase B; protein structure 100.0
1ehw_A_162 NDPK H4, nucleoside diphosphate kinase; NM23, mito 100.0
1u8w_A_149 Nucleoside diphosphate kinase I; nucleotide diphos 100.0
3evo_A_146 NDP kinase, NDK, nucleoside diphosphate kinase; ph 100.0
1nb2_A_150 Nucleoside diphosphate kinase; bacillus halodenitr 100.0
1k44_A_136 Nucleoside diphosphate kinase; nucleoside triphosp 100.0
2dxe_A_160 Nucleoside diphosphate kinase; nucleoside binding, 100.0
3bh7_B_214-352139 Protein XRP2; protein-protein complex, GTPase acti 100.0
>1xqi_A (A:) Nucleoside diphosphate kinase; alpha/beta sandwich, ferredoxin fold, transferase; HET: PGE; 2.50A {Pyrobaculum aerophilum} Back     alignment and structure
Probab=100.00  E-value=0  Score=344.41  Aligned_cols=138  Identities=37%  Similarity=0.578  Sum_probs=130.2

Q ss_pred             CCCEEEEEECCHHHHCCCHHHHHHHHHHCCCEEEEHHHCCCCHHHHHHH-------------------------------
Q ss_conf             6310230455237718987999999972555892100112699999999-------------------------------
Q gi|254780390|r    2 VIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDF-------------------------------   50 (140)
Q Consensus         2 ~~e~Tl~iIKPDav~~~~~g~Ii~~i~~~Gf~I~~~k~~~ls~e~a~~f-------------------------------   50 (140)
                      ++|+||+||||||++++++|+|+++|+++||+|+++|++++++++|++|                               
T Consensus        14 ~~e~Tl~iIKPDav~~~~~g~Ii~~i~~~Gf~I~~~k~~~~~~~~a~~fy~~~~~v~~~~~~~~~~~~~~~~~lt~~~a~   93 (195)
T 1xqi_A           14 PVEKTLLILKPDAVARGLVDEIISRFKKAGLKIVALKXVKASPEEIERFYPSSEEWLQSAGQKLLKAYQELGIDPRAKIG   93 (195)
T ss_dssp             CCCEEEEEECHHHHHTTCHHHHHHHHHHHTCEEEEEEEECCCHHHHHHHSCCCHHHHHHHHHHHHHHHHHHTCCHHHHHS
T ss_pred             HHHHEEEEECCHHHCCCCHHHHHHHHHHCCCEEEEEEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCC
T ss_conf             77631889894143247899999999987998999860128999999999999887754001234556653023100012


Q ss_pred             --HHHHCCCCCCCHHHHHCCCCCEEEEECCCCCHHHHHHHHCCCCCHHHCCCCCCCHHCCCC----------HHHEEEEE
Q ss_conf             --888514742100122100111577111164017899966188997776899700010115----------22100440
Q gi|254780390|r   51 --YLIHKDRPFFPELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGIS----------IGENSIHG  118 (140)
Q Consensus        51 --Y~~~~~k~ff~~lv~~m~sGpv~alvl~g~naV~~~R~l~Gptdp~~a~p~tiR~~fg~~----------~~~N~vH~  118 (140)
                        |++|+|||||++|++|||||||++|+|+|+|||++||+|+|||||++|+|+|||++||.+          .++|++||
T Consensus        94 ~~Y~~~~gk~ff~~Lv~~mtSgpvvalvl~g~naV~~~R~l~Gptdp~~A~p~tiR~~fg~~~~~ra~~g~~~~~N~vH~  173 (195)
T 1xqi_A           94 TDDPVEVGRIIKRNLVKYXTSGPNVVXVLKGNRAVEIVRKLVGPTSPHSAPPGTIRGDYSIDSPDLAAEEGRVVFNLVHA  173 (195)
T ss_dssp             CCCHHHHHHHHHHHHHHHHTSSCEEEEEEESTTHHHHHHHHHCCSCGGGSCTTSHHHHHCCCCHHHHHHTTSCCCCSEEE
T ss_pred             CCCCCCCCCCCHHHHHHHHHCCCEEEEEEECCCHHHHHHHHHCCCCCCCCCCCCCHHHHCCCCCCCCCCCCCCCCCCEEC
T ss_conf             34421048863488999993687468987468889999999589984658999717874777201012236666420688


Q ss_pred             CCCHHHHHHHHHHHCCHHHCC
Q ss_conf             699899999998726856506
Q gi|254780390|r  119 SDSLKTALEEISYWFARNEII  139 (140)
Q Consensus       119 Sds~e~a~rEi~~fF~~~ei~  139 (140)
                      |||+++|+||+++|||++|++
T Consensus       174 SDs~e~A~rEi~~fF~~~e~~  194 (195)
T 1xqi_A          174 SDSPSEAEREIRFWFREEEVL  194 (195)
T ss_dssp             CSSHHHHHHHHHHHCCGGGSC
T ss_pred             CCCHHHHHHHHHHCCCHHHCC
T ss_conf             999999999999658955326



>2az3_A (A:) Nucleoside diphosphate kinase; halophilic, transferase; HET: CDP; 2.20A {Halobacterium salinarum} Back     alignment and structure
>2hur_A (A:) NDK, nucleoside diphosphate kinase, NDP kinase; type II tetramer, signaling protein,transferase; 1.62A {Escherichia coli} Back     alignment and structure
>1wkj_A (A:) Nucleoside diphosphate kinase; thermus thermophilus HB8, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.00A {Thermus thermophilus} Back     alignment and structure
>2vu5_A (A:) Nucleoside diphosphate kinase; nucleotide-binding, ATP-binding, metal-binding, phosphoprotein, nucleotide metabolism, cytoplasm, magnesium; 2.0A {Bacillus anthracis} Back     alignment and structure
>3js9_A (A:) Nucleoside diphosphate kinase family protein; niaid, ssgcid, seattle structural genomics center for infectious disease, babesiosis; 2.50A {Babesia bovis T2BO} Back     alignment and structure
>3b54_A (A:) NDK, NDP kinase, nucleoside diphosphate kinase; alpha/beta sandwich, ATP-binding, cytoplasm, magnesium, metal-binding, mitochondrion; 3.10A {Saccharomyces cerevisiae} Back     alignment and structure
>1s57_A (A:) Nucleoside diphosphate kinase II; transferase; HET: EPE; 1.80A {Arabidopsis thaliana} Back     alignment and structure