254780416

254780416

putative ferredoxin protein

GeneID in NCBI database:8209402Locus tag:CLIBASIA_01505
Protein GI in NCBI database:254780416Protein Accession:YP_003064829.1
Gene range:+(320681, 321022)Protein Length:113aa
Gene description:putative ferredoxin protein
COG prediction:[C] Ferredoxin
KEGG prediction:putative ferredoxin protein; K05524 ferredoxin
SEED prediction:4Fe-4S ferredoxin, iron-sulfur binding
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110---
MTYVVTENCILCKHTDCVEVCPVDCFYEGENFLAIHPDECIDCGVCEPECPVDAIKPDTEPGLELWLKINSEYATQWPNITTKKESLPSAAKMDGVKQKYEKYFSPNPGGKNT
ccEEEcHHcccccccHHHHHcccccEEEcccEEEEcHHHcccccccHHHcccccccccccHHHHHHHHHHHHHHHHcccccccccccccHHHHcccHHHHHHHHccccccccc
ccEEEcHHHccccccHHHHHcccccEEEccccEEEcccccccccccccccccccEEEHHHccHHHHHHHHHHHHHHcccccccccccccHHHccccccHHHHHcccccccccc
mtyvvtencilckhtdcvevcpvdcfyegenflaihpdecidcgvcepecpvdaikpdtepgLELWLKINSEYatqwpnittkkeslpsaakmdgVKQKYEKyfspnpggknt
mtyvvtencilckhtdcVEVCPVDCFYEGENFLAIHPDECIDCGVCEPECPVDAIKPDTEPGLELWLKINSEYatqwpnittkkeslpsaakmdgvkqkyekyfspnpggknt
MTYVVTENCILCKHTDCVEVCPVDCFYEGENFLAIHPDECIDCGVCEPECPVDAIKPDTEPGLELWLKINSEYATQWPNITTKKESLPSAAKMDGVKQKYEKYFSPNPGGKNT
MTYVVTENCILCKHTDCVEVCPVDCFYEGENFLAIHPDECIDCGVCEPECPVDAIKPDTEPGLELWLKINSEYATQWPNIT***********MDGVKQKYEKYF**NP*****
MTYVVTENCILCKHTDCVEVCPVDCFYEGENFLAIHPDECIDCGVCEPECPVDAIKPDTEPGLELWLKINSEYATQWPNITTKKESLPSAAKMDGVKQKYEKYFS********
MTYVVTENCILCKHTDCVEVCPVDCFYEGENFLAIHPDECIDCGVCEPECPVDAIKPDTEPGLELWLKINSEYATQWPNITTKKESLPSAAKMDGVKQKYEKYFS********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTYVVTENCILCKHTDCVEVCPVDCFYEGENFLAIHPDECIDCGVCEPECPVDAIKPDTEPGLELWLKINSEYATQWPNITTKKESLPSAAKMDGVKQKYEKYFSPNPGGKNT
MTYVVTENCILCKHTDCVEVCPVDCFYEGENFLAIHPDECIDCGVCEPECPVDAIKPDTEPGLELWLKINSEYATQWPNITTKKESLPSAAKMDGVKQKYEKYFSPNPGGKNT
MTYVVTENCILCKHTDCVEVCPVDCFYEGENFLAIHPDECIDCGVCEPECPVDAIKPDTEPGLELWLKINSEYATQWPNITTKKESLPSAAKMDGVKQKYEKYFSPNPGGKNT

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target113 putative ferredoxin protein [Candidatus Liberibacter as
254780861163 NADH dehydrogenase subunit I [Candidatus Liberibac 0.017
254780861163 NADH dehydrogenase subunit I [Candidatus Liberibac 0.017
>gi|254780861|ref|YP_003065274.1| NADH dehydrogenase subunit I [Candidatus Liberibacter asiaticus str. psy62] Length = 163 Back     alignment
 Score = 29.6 bits (65), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 27/60 (45%), Gaps = 13/60 (21%)

Query: 7   ENCILCKHTDCVEVCPVDCF--------YEGENFLA---IHPDECIDCGVCEPECPVDAI 55
           E CI CK   C  +CP            ++G        I   +CI CG+C+  CPVDAI
Sbjct: 61  ERCIACKL--CEAICPAQAITIESGPRCHDGTRRTVRYDIDMIKCIYCGLCQEACPVDAI 118

>gi|254780861|ref|YP_003065274.1| NADH dehydrogenase subunit I [Candidatus Liberibacter asiaticus str. psy62] Length = 163 Back     alignment
 Score = 29.6 bits (65), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 3/38 (7%)

Query: 27 YEGENFLAIHPD---ECIDCGVCEPECPVDAIKPDTEP 61
          + GE+ L  +P+    CI C +CE  CP  AI  ++ P
Sbjct: 47 FRGEHALRRYPNGEERCIACKLCEAICPAQAITIESGP 84

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target113 putative ferredoxin protein [Candidatus Liberibacter as
315122140112 putative ferredoxin protein [Candidatus Liberibacter so 1 8e-51
15967011112 putative ferredoxin protein [Sinorhizobium meliloti 102 1 9e-47
150398307112 4Fe-4S ferredoxin iron-sulfur binding domain-containing 1 1e-46
227823779112 putative ferredoxin protein [Sinorhizobium fredii NGR23 1 5e-46
241206828112 4Fe-4S ferredoxin iron-sulfur binding domain protein [R 1 4e-45
222087731116 ferredoxin III protein [Agrobacterium radiobacter K84] 1 6e-45
319409357112 ferredoxin II [Bartonella schoenbuchensis R1] Length = 1 7e-45
209551386112 4Fe-4S ferredoxin iron-sulfur binding domain protein [R 1 7e-45
222150213116 ferredoxin [Agrobacterium vitis S4] Length = 116 1 7e-45
116254342112 ferredoxin II (FdII) [Rhizobium leguminosarum bv. vicia 1 9e-45
>gi|315122140|ref|YP_004062629.1| putative ferredoxin protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 112 Back     alignment and organism information
 Score =  202 bits (515), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 96/113 (84%), Positives = 106/113 (93%), Gaps = 1/113 (0%)

Query: 1   MTYVVTENCILCKHTDCVEVCPVDCFYEGENFLAIHPDECIDCGVCEPECPVDAIKPDTE 60
           MT+VVTENCILCKHTDCVEVCPVDCFYEGENFL IHP+ECIDCGVCEPECPVDAIKPDTE
Sbjct: 1   MTFVVTENCILCKHTDCVEVCPVDCFYEGENFLVIHPEECIDCGVCEPECPVDAIKPDTE 60

Query: 61  PGLELWLKINSEYATQWPNITTKKESLPSAAKMDGVKQKYEKYFSPNPGGKNT 113
           PGLE+WL+INS+Y++QWPNITTKK SLP+AA+MDGV+ KYE YFSP P  KNT
Sbjct: 61  PGLEMWLQINSKYSSQWPNITTKKASLPNAAEMDGVENKYENYFSPKP-AKNT 112


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|15967011|ref|NP_387364.1| putative ferredoxin protein [Sinorhizobium meliloti 1021] Length = 112 Back     alignment and organism information
>gi|150398307|ref|YP_001328774.1| 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein [Sinorhizobium medicae WSM419] Length = 112 Back     alignment and organism information
>gi|227823779|ref|YP_002827752.1| putative ferredoxin protein [Sinorhizobium fredii NGR234] Length = 112 Back     alignment and organism information
>gi|241206828|ref|YP_002977924.1| 4Fe-4S ferredoxin iron-sulfur binding domain protein [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 112 Back     alignment and organism information
>gi|222087731|ref|YP_002546268.1| ferredoxin III protein [Agrobacterium radiobacter K84] Length = 116 Back     alignment and organism information
>gi|319409357|emb|CBI83001.1| ferredoxin II [Bartonella schoenbuchensis R1] Length = 112 Back     alignment and organism information
>gi|209551386|ref|YP_002283303.1| 4Fe-4S ferredoxin iron-sulfur binding domain protein [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 112 Back     alignment and organism information
>gi|222150213|ref|YP_002551170.1| ferredoxin [Agrobacterium vitis S4] Length = 116 Back     alignment and organism information
>gi|116254342|ref|YP_770180.1| ferredoxin II (FdII) [Rhizobium leguminosarum bv. viciae 3841] Length = 112 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target113 putative ferredoxin protein [Candidatus Liberibacter as
pfam1195349 pfam11953, DUF3470, Domain of unknown function (DUF3470 5e-12
COG2768354 COG2768, COG2768, Uncharacterized Fe-S center protein [ 1e-06
COG1142165 COG1142, HycB, Fe-S-cluster-containing hydrogenase comp 5e-06
TIGR01944165 TIGR01944, rnfB, electron transport complex, RnfABCDGE 8e-06
COG0437203 COG0437, HybA, Fe-S-cluster-containing hydrogenase comp 3e-05
COG1149 284 COG1149, COG1149, MinD superfamily P-loop ATPase contai 3e-05
COG4231640 COG4231, COG4231, Indolepyruvate ferredoxin oxidoreduct 4e-05
COG2878198 COG2878, COG2878, Predicted NADH:ubiquinone oxidoreduct 7e-05
TIGR02700234 TIGR02700, flavo_MJ0208, archaeoflavoprotein, MJ0208 fa 1e-04
PRK08764135 PRK08764, PRK08764, ferredoxin; Provisional 2e-04
PRK09898208 PRK09898, PRK09898, hypothetical protein; Provisional 2e-04
PRK00783263 PRK00783, PRK00783, DNA-directed RNA polymerase subunit 2e-04
TIGR01971122 TIGR01971, NuoI, NADH-quinone oxidoreductase, chain I 2e-04
TIGR03287391 TIGR03287, methan_mark_16, putative methanogenesis mark 2e-04
PRK06991270 PRK06991, PRK06991, ferredoxin; Provisional 3e-04
PRK07118280 PRK07118, PRK07118, ferredoxin; Validated 3e-04
PRK14993244 PRK14993, PRK14993, tetrathionate reductase subunit B; 4e-04
PRK05113191 PRK05113, PRK05113, electron transport complex protein 5e-04
TIGR03149225 TIGR03149, cyt_nit_nrfC, cytochrome c nitrite reductase 6e-04
TIGR0217978 TIGR02179, PorD_KorD, 2-oxoacid:acceptor oxidoreductase 6e-04
COG1143172 COG1143, NuoI, Formate hydrogenlyase subunit 6/NADH:ubi 0.001
COG1148 622 COG1148, HdrA, Heterodisulfide reductase, subunit A and 0.001
PRK05888164 PRK05888, PRK05888, NADH dehydrogenase subunit I; Provi 0.001
PRK05035 695 PRK05035, PRK05035, electron transport complex protein 0.001
PRK13409 590 PRK13409, PRK13409, putative ATPase RIL; Provisional 0.001
COG1245 591 COG1245, COG1245, Predicted ATPase, RNase L inhibitor ( 0.002
PRK07118280 PRK07118, PRK07118, ferredoxin; Validated 0.002
TIGR03224 411 TIGR03224, benzo_boxA, benzoyl-CoA oxygenase/reductase, 0.002
COG114491 COG1144, COG1144, Pyruvate:ferredoxin oxidoreductase an 0.003
COG114599 COG1145, NapF, Ferredoxin [Energy production and conver 0.003
TIGR02494 295 TIGR02494, PFLE_PFLC, glycyl-radical enzyme activating 0.004
TIGR03336595 TIGR03336, IOR_alpha, indolepyruvate ferredoxin oxidore 0.004
COG114668 COG1146, COG1146, Ferredoxin [Energy production and con 5e-08
TIGR03287391 TIGR03287, methan_mark_16, putative methanogenesis mark 0.001
TIGR03224 411 TIGR03224, benzo_boxA, benzoyl-CoA oxygenase/reductase, 0.003
>gnl|CDD|152388 pfam11953, DUF3470, Domain of unknown function (DUF3470) Back     alignment and domain information
>gnl|CDD|32630 COG2768, COG2768, Uncharacterized Fe-S center protein [General function prediction only] Back     alignment and domain information
>gnl|CDD|31337 COG1142, HycB, Fe-S-cluster-containing hydrogenase components 2 [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|162616 TIGR01944, rnfB, electron transport complex, RnfABCDGE type, B subunit Back     alignment and domain information
>gnl|CDD|30786 COG0437, HybA, Fe-S-cluster-containing hydrogenase components 1 [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|31343 COG1149, COG1149, MinD superfamily P-loop ATPase containing an inserted ferredoxin domain [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|33956 COG4231, COG4231, Indolepyruvate ferredoxin oxidoreductase, alpha and beta subunits [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|32705 COG2878, COG2878, Predicted NADH:ubiquinone oxidoreductase, subunit RnfB [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|131747 TIGR02700, flavo_MJ0208, archaeoflavoprotein, MJ0208 family Back     alignment and domain information
>gnl|CDD|181550 PRK08764, PRK08764, ferredoxin; Provisional Back     alignment and domain information
>gnl|CDD|182135 PRK09898, PRK09898, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|179124 PRK00783, PRK00783, DNA-directed RNA polymerase subunit D; Provisional Back     alignment and domain information
>gnl|CDD|162631 TIGR01971, NuoI, NADH-quinone oxidoreductase, chain I Back     alignment and domain information
>gnl|CDD|163201 TIGR03287, methan_mark_16, putative methanogenesis marker 16 metalloprotein Back     alignment and domain information
>gnl|CDD|180786 PRK06991, PRK06991, ferredoxin; Provisional Back     alignment and domain information
>gnl|CDD|180852 PRK07118, PRK07118, ferredoxin; Validated Back     alignment and domain information
>gnl|CDD|184955 PRK14993, PRK14993, tetrathionate reductase subunit B; Provisional Back     alignment and domain information
>gnl|CDD|179940 PRK05113, PRK05113, electron transport complex protein RnfB; Provisional Back     alignment and domain information
>gnl|CDD|163157 TIGR03149, cyt_nit_nrfC, cytochrome c nitrite reductase, Fe-S protein Back     alignment and domain information
>gnl|CDD|131234 TIGR02179, PorD_KorD, 2-oxoacid:acceptor oxidoreductase, delta subunit, pyruvate/2-ketoisovalerate family Back     alignment and domain information
>gnl|CDD|31338 COG1143, NuoI, Formate hydrogenlyase subunit 6/NADH:ubiquinone oxidoreductase 23 kD subunit (chain I) [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|31342 COG1148, HdrA, Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|180305 PRK05888, PRK05888, NADH dehydrogenase subunit I; Provisional Back     alignment and domain information
>gnl|CDD|179919 PRK05035, PRK05035, electron transport complex protein RnfC; Provisional Back     alignment and domain information
>gnl|CDD|184037 PRK13409, PRK13409, putative ATPase RIL; Provisional Back     alignment and domain information
>gnl|CDD|31438 COG1245, COG1245, Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>gnl|CDD|180852 PRK07118, PRK07118, ferredoxin; Validated Back     alignment and domain information
>gnl|CDD|132268 TIGR03224, benzo_boxA, benzoyl-CoA oxygenase/reductase, BoxA protein Back     alignment and domain information
>gnl|CDD|31339 COG1144, COG1144, Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, delta subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|31340 COG1145, NapF, Ferredoxin [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|162887 TIGR02494, PFLE_PFLC, glycyl-radical enzyme activating protein family Back     alignment and domain information
>gnl|CDD|163218 TIGR03336, IOR_alpha, indolepyruvate ferredoxin oxidoreductase, alpha subunit Back     alignment and domain information
>gnl|CDD|31341 COG1146, COG1146, Ferredoxin [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|163201 TIGR03287, methan_mark_16, putative methanogenesis marker 16 metalloprotein Back     alignment and domain information
>gnl|CDD|132268 TIGR03224, benzo_boxA, benzoyl-CoA oxygenase/reductase, BoxA protein Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 113 putative ferredoxin protein [Candidatus Liberibacter as
COG2768354 Uncharacterized Fe-S center protein [General function p 99.57
PRK09623105 vorD 2-ketoisovalerate ferredoxin oxidoreductase subuni 99.55
COG0437203 HybA Fe-S-cluster-containing hydrogenase components 1 [ 99.53
PRK10330181 electron transport protein HydN; Provisional 99.52
PRK09624105 porD pyuvate ferredoxin oxidoreductase subunit delta; R 99.52
TIGR01944213 rnfB electron transport complex, RnfABCDGE type, B subu 99.51
TIGR03478321 DMSO_red_II_bet DMSO reductase family type II enzyme, i 99.5
COG1142165 HycB Fe-S-cluster-containing hydrogenase components 2 [ 99.49
PRK09898208 hypothetical protein; Provisional 99.47
TIGR03149225 cyt_nit_nrfC cytochrome c nitrite reductase, Fe-S prote 99.45
PRK05113184 electron transport complex protein RnfB; Provisional 99.45
TIGR02951162 DMSO_dmsB dimethylsulfoxide reductase, chain B; InterPr 99.45
PRK08348111 NADH-plastoquinone oxidoreductase subunit; Provisional 99.43
PRK06991274 ferredoxin; Provisional 99.4
PRK07118276 ferredoxin; Validated 99.39
PRK12769 654 putative oxidoreductase Fe-S binding subunit; Reviewed 99.38
TIGR02700237 flavo_MJ0208 archaeoflavoprotein, MJ0208 family; InterP 99.36
PRK10882 329 hydrogenase 2 protein HybA; Provisional 99.35
PRK12809 639 putative oxidoreductase Fe-S binding subunit; Reviewed 99.35
PRK09626103 oorD 2-oxoglutarate-acceptor oxidoreductase subunit Oor 99.35
PRK12387178 formate hydrogenlyase complex iron-sulfur subunit; Prov 99.35
PRK08764138 ferredoxin; Provisional 99.34
PRK05888172 NADH dehydrogenase subunit I; Provisional 99.31
PRK08222181 hydrogenase 4 subunit H; Validated 99.3
PRK07118276 ferredoxin; Validated 99.3
COG1143172 NuoI Formate hydrogenlyase subunit 6/NADH:ubiquinone ox 99.23
COG114668 Ferredoxin [Energy production and conversion] 99.23
TIGR01971129 NuoI NADH-quinone oxidoreductase, chain I; InterPro: IP 99.18
CHL00014173 ndhI NADH dehydrogenase subunit I 99.18
TIGR03224 411 benzo_boxA benzoyl-CoA oxygenase/reductase, BoxA protei 99.13
PRK09625130 porD pyruvate flavodoxin oxidoreductase subunit delta; 99.11
TIGR03294228 FrhG coenzyme F420 hydrogenase, subunit gamma. This mod 99.1
TIGR0217984 PorD_KorD 2-oxoacid:acceptor oxidoreductase, delta subu 99.09
CHL0006581 psaC photosystem I subunit VII 99.08
COG1149 284 MinD superfamily P-loop ATPase containing an inserted f 99.08
PRK12771560 putative glutamate synthase (NADPH) small subunit; Prov 99.07
COG1148 622 HdrA Heterodisulfide reductase, subunit A and related p 99.05
PRK08318413 dihydropyrimidine dehydrogenase; Validated 99.02
COG2221317 DsrA Dissimilatory sulfite reductase (desulfoviridin), 99.01
TIGR02912323 sulfite_red_C sulfite reductase, subunit C; InterPro: I 98.99
PRK13795630 hypothetical protein; Provisional 98.97
PRK10194164 ferredoxin-type protein; Provisional 98.94
TIGR0304880 PS_I_psaC photosystem I iron-sulfur protein PsaC. Membe 98.94
COG114491 Pyruvate:ferredoxin oxidoreductase and related 2-oxoaci 98.94
COG114599 NapF Ferredoxin [Energy production and conversion] 98.93
KOG3256212 consensus 98.91
COG2878198 Predicted NADH:ubiquinone oxidoreductase, subunit RnfB 98.9
COG1148622 HdrA Heterodisulfide reductase, subunit A and related p 98.88
TIGR02176 1194 pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxidoredu 98.87
PRK09898208 hypothetical protein; Provisional 98.85
TIGR03336595 IOR_alpha indolepyruvate ferredoxin oxidoreductase, alp 98.85
PRK0265181 photosystem I subunit VII; Provisional 98.84
COG4231640 Indolepyruvate ferredoxin oxidoreductase, alpha and bet 98.81
PRK09477287 napH quinol dehydrogenase membrane component; Provision 98.79
TIGR0293696 fdxN_nitrog ferredoxin III, nif-specific; InterPro: IPR 98.78
TIGR02494 305 PFLE_PFLC glycyl-radical enzyme activating protein fami 98.72
TIGR01660 495 narH nitrate reductase, beta subunit; InterPro: IPR0065 98.71
PRK13984 604 putative oxidoreductase; Provisional 98.7
PRK10330181 electron transport protein HydN; Provisional 98.7
TIGR01582293 FDH-beta formate dehydrogenase, beta subunit; InterPro: 98.69
PRK12809 639 putative oxidoreductase Fe-S binding subunit; Reviewed 98.67
PRK09326 346 F420H2 dehydrogenase subunit F; Provisional 98.64
PRK10194164 ferredoxin-type protein; Provisional 98.57
COG1140 513 NarY Nitrate reductase beta subunit [Energy production 98.52
COG0437203 HybA Fe-S-cluster-containing hydrogenase components 1 [ 98.5
PRK12769 654 putative oxidoreductase Fe-S binding subunit; Reviewed 98.46
PRK13409 590 putative ATPase RIL; Provisional 98.45
COG1245 591 Predicted ATPase, RNase L inhibitor (RLI) homolog [Gene 98.44
TIGR02163263 napH_ ferredoxin-type protein, NapH/MauN family; InterP 98.42
TIGR01945444 rnfC electron transport complex, RnfABCDGE type, C subu 98.4
PRK07569236 bidirectional hydrogenase complex protein HoxU; Validat 98.39
COG1142165 HycB Fe-S-cluster-containing hydrogenase components 2 [ 98.33
TIGR03287391 methan_mark_16 putative methanogenesis marker 16 metall 98.27
PRK06273163 ferredoxin; Provisional 98.26
PRK10882329 hydrogenase 2 protein HybA; Provisional 98.25
TIGR03149225 cyt_nit_nrfC cytochrome c nitrite reductase, Fe-S prote 98.25
TIGR02060138 aprB adenylylsulfate reductase, beta subunit; InterPro: 98.25
PRK08493 819 NADH dehydrogenase subunit G; Validated 98.24
TIGR02745 474 ccoG_rdxA_fixG cytochrome c oxidase accessory protein C 98.15
TIGR00402161 napF ferredoxin-type protein NapF; InterPro: IPR004496 98.11
PRK05035 725 electron transport complex protein RnfC; Provisional 98.1
PRK09476254 napG quinol dehydrogenase periplasmic component; Provis 98.07
COG3383 978 Uncharacterized anaerobic dehydrogenase [General functi 98.07
PRK09476254 napG quinol dehydrogenase periplasmic component; Provis 97.95
PRK12387178 formate hydrogenlyase complex iron-sulfur subunit; Prov 97.94
COG244099 FixX Ferredoxin-like protein [Energy production and con 97.89
TIGR01582293 FDH-beta formate dehydrogenase, beta subunit; InterPro: 97.76
TIGR03478321 DMSO_red_II_bet DMSO reductase family type II enzyme, i 97.75
PRK08166 858 NADH dehydrogenase subunit G; Validated 97.71
COG1143172 NuoI Formate hydrogenlyase subunit 6/NADH:ubiquinone ox 97.69
TIGR02951162 DMSO_dmsB dimethylsulfoxide reductase, chain B; InterPr 97.67
TIGR00276297 TIGR00276 iron-sulfur cluster binding protein, putative 97.59
PRK11168 400 glpC sn-glycerol-3-phosphate dehydrogenase subunit C; P 97.58
TIGR03379 397 glycerol3P_GlpC glycerol-3-phosphate dehydrogenase, ana 97.53
PRK09129 777 NADH dehydrogenase subunit G; Validated 97.46
PRK09130 680 NADH dehydrogenase subunit G; Validated 97.39
PRK09477287 napH quinol dehydrogenase membrane component; Provision 97.38
COG4656529 RnfC Predicted NADH:ubiquinone oxidoreductase, subunit 97.38
KOG0063 592 consensus 97.37
PRK11274 407 glcF glycolate oxidase iron-sulfur subunit; Provisional 97.33
TIGR00403187 ndhI NADH-plastoquinone oxidoreductase, I subunit; Inte 97.32
TIGR02066366 dsrB sulfite reductase, dissimilatory-type beta subunit 97.25
PRK07860 809 NADH dehydrogenase subunit G; Validated 97.13
cd01916 731 ACS_1 Acetyl-CoA synthase (ACS), also known as acetyl-C 97.12
COG1139459 Uncharacterized conserved protein containing a ferredox 97.12
PRK00941 779 acetyl-CoA decarbonylase/synthase complex subunit alpha 97.11
TIGR00273450 TIGR00273 iron-sulfur cluster binding protein; InterPro 97.1
TIGR00402161 napF ferredoxin-type protein NapF; InterPro: IPR004496 97.08
TIGR03290144 CoB_CoM_SS_C CoB--CoM heterodisulfide reductase, subuni 97.07
COG1600337 Uncharacterized Fe-S protein [Energy production and con 97.04
COG1034 693 NuoG NADH dehydrogenase/NADH:ubiquinone oxidoreductase 96.92
TIGR02163263 napH_ ferredoxin-type protein, NapH/MauN family; InterP 96.9
COG1152 772 CdhA CO dehydrogenase/acetyl-CoA synthase alpha subunit 96.74
TIGR00397213 mauM_napG MauM/NapG family ferredoxin-type protein; Int 96.73
COG0247 388 GlpC Fe-S oxidoreductase [Energy production and convers 96.59
TIGR00397213 mauM_napG MauM/NapG family ferredoxin-type protein; Int 96.57
TIGR00314 795 cdhA CO dehydrogenase/acetyl-CoA synthase complex, epsi 96.52
COG1035 332 FrhB Coenzyme F420-reducing hydrogenase, beta subunit [ 96.34
COG1941247 FrhG Coenzyme F420-reducing hydrogenase, gamma subunit 96.01
PRK08493 819 NADH dehydrogenase subunit G; Validated 95.87
PRK12386250 fumarate reductase iron-sulfur subunit; Provisional 95.78
TIGR02064430 dsrA sulfite reductase, dissimilatory-type alpha subuni 95.52
PRK13552240 frdB fumarate reductase iron-sulfur subunit; Provisiona 95.5
PRK12575235 succinate dehydrogenase iron-sulfur subunit; Provisiona 95.46
COG0348386 NapH Polyferredoxin [Energy production and conversion] 95.18
PRK12385243 fumarate reductase iron-sulfur subunit; Provisional 95.15
COG1150195 HdrC Heterodisulfide reductase, subunit C [Energy produ 95.15
TIGR02912323 sulfite_red_C sulfite reductase, subunit C; InterPro: I 95.08
COG1453391 Predicted oxidoreductases of the aldo/keto reductase fa 95.0
PRK05950235 sdhB succinate dehydrogenase iron-sulfur subunit; Revie 94.98
PRK08640252 sdhB succinate dehydrogenase iron-sulfur subunit; Revie 94.87
PRK07570247 succinate dehydrogenase/fumarate reductase iron-sulfur 94.85
PRK06259 491 succinate dehydrogenase/fumarate reductase iron-sulfur 94.69
TIGR02512 380 Fe_only_hydrog hydrogenases, Fe-only; InterPro: IPR0133 94.68
PRK12577330 succinate dehydrogenase iron-sulfur subunit; Provisiona 94.48
KOG0063 592 consensus 93.65
COG114168 Fer Ferredoxin [Energy production and conversion] 93.4
TIGR02494 305 PFLE_PFLC glycyl-radical enzyme activating protein fami 93.28
COG0479234 FrdB Succinate dehydrogenase/fumarate reductase, Fe-S p 93.0
PRK098531032 putative selenate reductase subunit YgfK; Provisional 92.7
TIGR033151012 Se_ygfK putative selenate reductase, YgfK subunit. Memb 92.7
pfam1195349 DUF3470 Domain of unknown function (DUF3470). This pres 99.23
TIGR01944213 rnfB electron transport complex, RnfABCDGE type, B subu 98.12
PRK08348111 NADH-plastoquinone oxidoreductase subunit; Provisional 98.03
PRK08222181 hydrogenase 4 subunit H; Validated 97.87
PRK06991 274 ferredoxin; Provisional 97.84
PRK09623105 vorD 2-ketoisovalerate ferredoxin oxidoreductase subuni 97.76
PRK09624105 porD pyuvate ferredoxin oxidoreductase subunit delta; R 97.64
TIGR03294228 FrhG coenzyme F420 hydrogenase, subunit gamma. This mod 97.6
PRK05113184 electron transport complex protein RnfB; Provisional 97.55
CHL00014173 ndhI NADH dehydrogenase subunit I 97.55
pfam0003726 Fer4 4Fe-4S binding domain. Superfamily includes protei 97.54
PRK09626103 oorD 2-oxoglutarate-acceptor oxidoreductase subunit Oor 97.47
PRK09326 346 F420H2 dehydrogenase subunit F; Provisional 97.47
PRK08764138 ferredoxin; Provisional 97.3
PRK05888172 NADH dehydrogenase subunit I; Provisional 97.26
TIGR0304880 PS_I_psaC photosystem I iron-sulfur protein PsaC. Membe 97.2
TIGR01971129 NuoI NADH-quinone oxidoreductase, chain I; InterPro: IP 97.05
PRK06273163 ferredoxin; Provisional 97.04
TIGR03224 411 benzo_boxA benzoyl-CoA oxygenase/reductase, BoxA protei 97.03
PRK0265181 photosystem I subunit VII; Provisional 96.98
PRK13984 604 putative oxidoreductase; Provisional 96.89
COG114599 NapF Ferredoxin [Energy production and conversion] 96.84
CHL0006581 psaC photosystem I subunit VII 96.84
COG1149 284 MinD superfamily P-loop ATPase containing an inserted f 96.75
PRK09625130 porD pyruvate flavodoxin oxidoreductase subunit delta; 96.58
COG2878198 Predicted NADH:ubiquinone oxidoreductase, subunit RnfB 96.57
PRK08318413 dihydropyrimidine dehydrogenase; Validated 96.54
TIGR0293696 fdxN_nitrog ferredoxin III, nif-specific; InterPro: IPR 96.52
COG2221317 DsrA Dissimilatory sulfite reductase (desulfoviridin), 96.13
PRK13795630 hypothetical protein; Provisional 95.68
PRK07569236 bidirectional hydrogenase complex protein HoxU; Validat 95.62
TIGR02176 1194 pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxidoredu 95.53
KOG3256212 consensus 95.27
COG1035 332 FrhB Coenzyme F420-reducing hydrogenase, beta subunit [ 95.0
COG2768354 Uncharacterized Fe-S center protein [General function p 94.99
COG114668 Ferredoxin [Energy production and conversion] 94.95
COG114168 Fer Ferredoxin [Energy production and conversion] 94.83
TIGR0217984 PorD_KorD 2-oxoacid:acceptor oxidoreductase, delta subu 94.77
TIGR02745 474 ccoG_rdxA_fixG cytochrome c oxidase accessory protein C 94.67
TIGR01945444 rnfC electron transport complex, RnfABCDGE type, C subu 93.86
TIGR00276297 TIGR00276 iron-sulfur cluster binding protein, putative 93.69
PRK12814652 putative NADPH-dependent glutamate synthase small subun 93.44
COG114491 Pyruvate:ferredoxin oxidoreductase and related 2-oxoaci 93.3
COG4231640 Indolepyruvate ferredoxin oxidoreductase, alpha and bet 93.19
PRK12771560 putative glutamate synthase (NADPH) small subunit; Prov 93.02
PRK11274 407 glcF glycolate oxidase iron-sulfur subunit; Provisional 91.85
TIGR02486338 RDH reductive dehalogenase; InterPro: IPR012832 This en 91.42
PRK05035 725 electron transport complex protein RnfC; Provisional 91.1
PRK05950235 sdhB succinate dehydrogenase iron-sulfur subunit; Revie 90.6
TIGR00403187 ndhI NADH-plastoquinone oxidoreductase, I subunit; Inte 90.1
pfam0003726 Fer4 4Fe-4S binding domain. Superfamily includes protei 96.32
TIGR02700237 flavo_MJ0208 archaeoflavoprotein, MJ0208 family; InterP 96.24
TIGR02910346 sulfite_red_A sulfite reductase, subunit A; InterPro: I 95.52
PRK13409 590 putative ATPase RIL; Provisional 95.39
COG1245 591 Predicted ATPase, RNase L inhibitor (RLI) homolog [Gene 95.02
TIGR02486338 RDH reductive dehalogenase; InterPro: IPR012832 This en 94.52
COG3383 978 Uncharacterized anaerobic dehydrogenase [General functi 92.71
TIGR03379 397 glycerol3P_GlpC glycerol-3-phosphate dehydrogenase, ana 91.71
PRK11168 400 glpC sn-glycerol-3-phosphate dehydrogenase subunit C; P 90.55
>COG2768 Uncharacterized Fe-S center protein [General function prediction only] Back     alignment and domain information
>PRK09623 vorD 2-ketoisovalerate ferredoxin oxidoreductase subunit delta; Reviewed Back     alignment and domain information
>COG0437 HybA Fe-S-cluster-containing hydrogenase components 1 [Energy production and conversion] Back     alignment and domain information
>PRK10330 electron transport protein HydN; Provisional Back     alignment and domain information
>PRK09624 porD pyuvate ferredoxin oxidoreductase subunit delta; Reviewed Back     alignment and domain information
>TIGR01944 rnfB electron transport complex, RnfABCDGE type, B subunit; InterPro: IPR010207 The six subunit complex RnfABCDGE in Rhodobacter capsulatus encodes an apparent NADH oxidoreductase responsible for electron transport to nitrogenase, necessary for nitrogen fixation Back     alignment and domain information
>TIGR03478 DMSO_red_II_bet DMSO reductase family type II enzyme, iron-sulfur subunit Back     alignment and domain information
>COG1142 HycB Fe-S-cluster-containing hydrogenase components 2 [Energy production and conversion] Back     alignment and domain information
>PRK09898 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03149 cyt_nit_nrfC cytochrome c nitrite reductase, Fe-S protein Back     alignment and domain information
>PRK05113 electron transport complex protein RnfB; Provisional Back     alignment and domain information
>TIGR02951 DMSO_dmsB dimethylsulfoxide reductase, chain B; InterPro: IPR014297 This family consists of the iron-sulphur subunit, or chain B, of the anaerobic dimethyl sulphoxide reductase enzyme Back     alignment and domain information
>PRK08348 NADH-plastoquinone oxidoreductase subunit; Provisional Back     alignment and domain information
>PRK06991 ferredoxin; Provisional Back     alignment and domain information
>PRK07118 ferredoxin; Validated Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>TIGR02700 flavo_MJ0208 archaeoflavoprotein, MJ0208 family; InterPro: IPR014073 This entry describes one of two paralogous families of archaeal flavoprotein Back     alignment and domain information
>PRK10882 hydrogenase 2 protein HybA; Provisional Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK09626 oorD 2-oxoglutarate-acceptor oxidoreductase subunit OorD; Reviewed Back     alignment and domain information
>PRK12387 formate hydrogenlyase complex iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK08764 ferredoxin; Provisional Back     alignment and domain information
>PRK05888 NADH dehydrogenase subunit I; Provisional Back     alignment and domain information
>PRK08222 hydrogenase 4 subunit H; Validated Back     alignment and domain information
>PRK07118 ferredoxin; Validated Back     alignment and domain information
>COG1143 NuoI Formate hydrogenlyase subunit 6/NADH:ubiquinone oxidoreductase 23 kD subunit (chain I) [Energy production and conversion] Back     alignment and domain information
>COG1146 Ferredoxin [Energy production and conversion] Back     alignment and domain information
>TIGR01971 NuoI NADH-quinone oxidoreductase, chain I; InterPro: IPR010226 This entry represents the I subunit (one of 14 subunits, A to N) of the NADH-quinone oxidoreductase complex I which generally couples NADH and ubiquinone oxidation/reduction in bacteria and mammalian mitochondria, but may act on NADPH and/or plastoquinone in cyanobacteria and plant chloroplasts Back     alignment and domain information
>CHL00014 ndhI NADH dehydrogenase subunit I Back     alignment and domain information
>TIGR03224 benzo_boxA benzoyl-CoA oxygenase/reductase, BoxA protein Back     alignment and domain information
>PRK09625 porD pyruvate flavodoxin oxidoreductase subunit delta; Reviewed Back     alignment and domain information
>TIGR03294 FrhG coenzyme F420 hydrogenase, subunit gamma Back     alignment and domain information
>TIGR02179 PorD_KorD 2-oxoacid:acceptor oxidoreductase, delta subunit, pyruvate/2-ketoisovalerate family; InterPro: IPR011898 A number of anaerobic and microaerophilic species lack pyruvate dehydrogenase and have instead a four subunit, oxygen-sensitive pyruvate oxidoreductase, with either ferredoxins or flavodoxins used as the acceptor Back     alignment and domain information
>CHL00065 psaC photosystem I subunit VII Back     alignment and domain information
>COG1149 MinD superfamily P-loop ATPase containing an inserted ferredoxin domain [Energy production and conversion] Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>PRK08318 dihydropyrimidine dehydrogenase; Validated Back     alignment and domain information
>COG2221 DsrA Dissimilatory sulfite reductase (desulfoviridin), alpha and beta subunits [Energy production and conversion] Back     alignment and domain information
>TIGR02912 sulfite_red_C sulfite reductase, subunit C; InterPro: IPR014261 This entry represents subunit C, one of the three subunits of the anaerobic sulphite reductase of Salmonella, and close homologues from various Clostridium species, where the three-gene neighbourhood is preserved Back     alignment and domain information
>PRK13795 hypothetical protein; Provisional Back     alignment and domain information
>PRK10194 ferredoxin-type protein; Provisional Back     alignment and domain information
>TIGR03048 PS_I_psaC photosystem I iron-sulfur protein PsaC Back     alignment and domain information
>COG1144 Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, delta subunit [Energy production and conversion] Back     alignment and domain information
>COG1145 NapF Ferredoxin [Energy production and conversion] Back     alignment and domain information
>KOG3256 consensus Back     alignment and domain information
>COG2878 Predicted NADH:ubiquinone oxidoreductase, subunit RnfB [Energy production and conversion] Back     alignment and domain information
>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>TIGR02176 pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxidoreductase; InterPro: IPR011895 The oxidative decarboxylation of pyruvate to acetyl-CoA, a central step in energy metabolism, can occur by two different mechanisms Back     alignment and domain information
>PRK09898 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03336 IOR_alpha indolepyruvate ferredoxin oxidoreductase, alpha subunit Back     alignment and domain information
>PRK02651 photosystem I subunit VII; Provisional Back     alignment and domain information
>COG4231 Indolepyruvate ferredoxin oxidoreductase, alpha and beta subunits [Energy production and conversion] Back     alignment and domain information
>PRK09477 napH quinol dehydrogenase membrane component; Provisional Back     alignment and domain information
>TIGR02936 fdxN_nitrog ferredoxin III, nif-specific; InterPro: IPR014283 This entry consists of ferredoxins which are encoded in the nitrogen fixation regions of many nitrogen-fixing bacteria Back     alignment and domain information
>TIGR02494 PFLE_PFLC glycyl-radical enzyme activating protein family; InterPro: IPR012839 This subset of the radical-SAM domain includes a number of probable activating proteins acting on different enzymes all requiring an amino-acid-centred radical Back     alignment and domain information
>TIGR01660 narH nitrate reductase, beta subunit; InterPro: IPR006547 The nitrate reductase enzyme complex allows bacteria to use nitrate as an electron acceptor during anaerobic growth Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK10330 electron transport protein HydN; Provisional Back     alignment and domain information
>TIGR01582 FDH-beta formate dehydrogenase, beta subunit; InterPro: IPR006470 The sequences in this group represent the beta subunit of the gamma-proteobacterial formate dehydrogenase Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK09326 F420H2 dehydrogenase subunit F; Provisional Back     alignment and domain information
>PRK10194 ferredoxin-type protein; Provisional Back     alignment and domain information
>COG1140 NarY Nitrate reductase beta subunit [Energy production and conversion] Back     alignment and domain information
>COG0437 HybA Fe-S-cluster-containing hydrogenase components 1 [Energy production and conversion] Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>TIGR02163 napH_ ferredoxin-type protein, NapH/MauN family; InterPro: IPR011886 Most members of this family are the NapH protein, found next to NapG,in operons that encode the periplasmic nitrate reductase Back     alignment and domain information
>TIGR01945 rnfC electron transport complex, RnfABCDGE type, C subunit; InterPro: IPR010208 The six subunit complex RnfABCDGE in Rhodobacter capsulatus encodes an apparent NADH oxidoreductase responsible for electron transport to nitrogenase, necessary for nitrogen fixation Back     alignment and domain information
>PRK07569 bidirectional hydrogenase complex protein HoxU; Validated Back     alignment and domain information
>COG1142 HycB Fe-S-cluster-containing hydrogenase components 2 [Energy production and conversion] Back     alignment and domain information
>TIGR03287 methan_mark_16 putative methanogenesis marker 16 metalloprotein Back     alignment and domain information
>PRK06273 ferredoxin; Provisional Back     alignment and domain information
>PRK10882 hydrogenase 2 protein HybA; Provisional Back     alignment and domain information
>TIGR03149 cyt_nit_nrfC cytochrome c nitrite reductase, Fe-S protein Back     alignment and domain information
>TIGR02060 aprB adenylylsulfate reductase, beta subunit; InterPro: IPR011802 During dissimilatory sulphate reduction and sulphur oxidation, adenylylsulphate (APS) reductase catalyzes reversibly the two-electron reduction of APS to sulphite and AMP Back     alignment and domain information
>PRK08493 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>TIGR02745 ccoG_rdxA_fixG cytochrome c oxidase accessory protein CcoG; InterPro: IPR014116 Member of this ferredoxin-like protein family, include FixG, CcoG and RdxA, Back     alignment and domain information
>TIGR00402 napF ferredoxin-type protein NapF; InterPro: IPR004496 Members of this family are the ferredoxin-type protein subunits of nitrate reductase Back     alignment and domain information
>PRK05035 electron transport complex protein RnfC; Provisional Back     alignment and domain information
>PRK09476 napG quinol dehydrogenase periplasmic component; Provisional Back     alignment and domain information
>COG3383 Uncharacterized anaerobic dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK09476 napG quinol dehydrogenase periplasmic component; Provisional Back     alignment and domain information
>PRK12387 formate hydrogenlyase complex iron-sulfur subunit; Provisional Back     alignment and domain information
>COG2440 FixX Ferredoxin-like protein [Energy production and conversion] Back     alignment and domain information
>TIGR01582 FDH-beta formate dehydrogenase, beta subunit; InterPro: IPR006470 The sequences in this group represent the beta subunit of the gamma-proteobacterial formate dehydrogenase Back     alignment and domain information
>TIGR03478 DMSO_red_II_bet DMSO reductase family type II enzyme, iron-sulfur subunit Back     alignment and domain information
>PRK08166 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>COG1143 NuoI Formate hydrogenlyase subunit 6/NADH:ubiquinone oxidoreductase 23 kD subunit (chain I) [Energy production and conversion] Back     alignment and domain information
>TIGR02951 DMSO_dmsB dimethylsulfoxide reductase, chain B; InterPro: IPR014297 This family consists of the iron-sulphur subunit, or chain B, of the anaerobic dimethyl sulphoxide reductase enzyme Back     alignment and domain information
>TIGR00276 TIGR00276 iron-sulfur cluster binding protein, putative; InterPro: IPR004453 This is a family of putative iron-sulphur cluster binding proteins Back     alignment and domain information
>PRK11168 glpC sn-glycerol-3-phosphate dehydrogenase subunit C; Provisional Back     alignment and domain information
>TIGR03379 glycerol3P_GlpC glycerol-3-phosphate dehydrogenase, anaerobic, C subunit Back     alignment and domain information
>PRK09129 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>PRK09130 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>PRK09477 napH quinol dehydrogenase membrane component; Provisional Back     alignment and domain information
>COG4656 RnfC Predicted NADH:ubiquinone oxidoreductase, subunit RnfC [Energy production and conversion] Back     alignment and domain information
>KOG0063 consensus Back     alignment and domain information
>PRK11274 glcF glycolate oxidase iron-sulfur subunit; Provisional Back     alignment and domain information
>TIGR00403 ndhI NADH-plastoquinone oxidoreductase, I subunit; InterPro: IPR004497 NADH-plastoquinone oxidoreductase subunit I (1 Back     alignment and domain information
>TIGR02066 dsrB sulfite reductase, dissimilatory-type beta subunit; InterPro: IPR011808 Dissimilatory sulphite reductase catalyzes the six-electron reduction of sulphite to sulphide, as the terminal reaction in dissimilatory sulphate reduction Back     alignment and domain information
>PRK07860 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>cd01916 ACS_1 Acetyl-CoA synthase (ACS), also known as acetyl-CoA decarbonylase, is found in acetogenic and methanogenic organisms and is responsible for the synthesis and breakdown of acetyl-CoA Back     alignment and domain information
>COG1139 Uncharacterized conserved protein containing a ferredoxin-like domain [Energy production and conversion] Back     alignment and domain information
>PRK00941 acetyl-CoA decarbonylase/synthase complex subunit alpha; Validated Back     alignment and domain information
>TIGR00273 TIGR00273 iron-sulfur cluster binding protein; InterPro: IPR004452 Members of this family have a perfect 4Fe-4S binding motif C-x(2)-C-x(2)-C-x(3)-CP followed by either a perfect or imperfect (the first Cys replaced by Ser) second copy Back     alignment and domain information
>TIGR00402 napF ferredoxin-type protein NapF; InterPro: IPR004496 Members of this family are the ferredoxin-type protein subunits of nitrate reductase Back     alignment and domain information
>TIGR03290 CoB_CoM_SS_C CoB--CoM heterodisulfide reductase, subunit C Back     alignment and domain information
>COG1600 Uncharacterized Fe-S protein [Energy production and conversion] Back     alignment and domain information
>COG1034 NuoG NADH dehydrogenase/NADH:ubiquinone oxidoreductase 75 kD subunit (chain G) [Energy production and conversion] Back     alignment and domain information
>TIGR02163 napH_ ferredoxin-type protein, NapH/MauN family; InterPro: IPR011886 Most members of this family are the NapH protein, found next to NapG,in operons that encode the periplasmic nitrate reductase Back     alignment and domain information
>COG1152 CdhA CO dehydrogenase/acetyl-CoA synthase alpha subunit [Energy production and conversion] Back     alignment and domain information
>TIGR00397 mauM_napG MauM/NapG family ferredoxin-type protein; InterPro: IPR004494 MauM ferredoxin-type protein is involved in methylamine utilization Back     alignment and domain information
>COG0247 GlpC Fe-S oxidoreductase [Energy production and conversion] Back     alignment and domain information
>TIGR00397 mauM_napG MauM/NapG family ferredoxin-type protein; InterPro: IPR004494 MauM ferredoxin-type protein is involved in methylamine utilization Back     alignment and domain information
>TIGR00314 cdhA CO dehydrogenase/acetyl-CoA synthase complex, epsilon subunit; InterPro: IPR004460 Acetyl-CoA decarbonylase/synthase (ACDS) is a multienzyme complex (carbon monoxide dehydrogenase is a synonym) Back     alignment and domain information
>COG1035 FrhB Coenzyme F420-reducing hydrogenase, beta subunit [Energy production and conversion] Back     alignment and domain information
>COG1941 FrhG Coenzyme F420-reducing hydrogenase, gamma subunit [Energy production and conversion] Back     alignment and domain information
>PRK08493 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>PRK12386 fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>TIGR02064 dsrA sulfite reductase, dissimilatory-type alpha subunit; InterPro: IPR011806 Dissimilatory sulphite reductase catalyzes the six-electron reduction of sulphite to sulphide, as the terminal reaction in dissimilatory sulphate reduction Back     alignment and domain information
>PRK13552 frdB fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK12575 succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>COG0348 NapH Polyferredoxin [Energy production and conversion] Back     alignment and domain information
>PRK12385 fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>COG1150 HdrC Heterodisulfide reductase, subunit C [Energy production and conversion] Back     alignment and domain information
>TIGR02912 sulfite_red_C sulfite reductase, subunit C; InterPro: IPR014261 This entry represents subunit C, one of the three subunits of the anaerobic sulphite reductase of Salmonella, and close homologues from various Clostridium species, where the three-gene neighbourhood is preserved Back     alignment and domain information
>COG1453 Predicted oxidoreductases of the aldo/keto reductase family [General function prediction only] Back     alignment and domain information
>PRK05950 sdhB succinate dehydrogenase iron-sulfur subunit; Reviewed Back     alignment and domain information
>PRK08640 sdhB succinate dehydrogenase iron-sulfur subunit; Reviewed Back     alignment and domain information
>PRK07570 succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Validated Back     alignment and domain information
>PRK06259 succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>TIGR02512 Fe_only_hydrog hydrogenases, Fe-only; InterPro: IPR013352 This model describes iron-only hydrogenases of anaerobic and microaerophilic bacteria and protozoa Back     alignment and domain information
>PRK12577 succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>KOG0063 consensus Back     alignment and domain information
>COG1141 Fer Ferredoxin [Energy production and conversion] Back     alignment and domain information
>TIGR02494 PFLE_PFLC glycyl-radical enzyme activating protein family; InterPro: IPR012839 This subset of the radical-SAM domain includes a number of probable activating proteins acting on different enzymes all requiring an amino-acid-centred radical Back     alignment and domain information
>COG0479 FrdB Succinate dehydrogenase/fumarate reductase, Fe-S protein subunit [Energy production and conversion] Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>pfam11953 DUF3470 Domain of unknown function (DUF3470) Back     alignment and domain information
>TIGR01944 rnfB electron transport complex, RnfABCDGE type, B subunit; InterPro: IPR010207 The six subunit complex RnfABCDGE in Rhodobacter capsulatus encodes an apparent NADH oxidoreductase responsible for electron transport to nitrogenase, necessary for nitrogen fixation Back     alignment and domain information
>PRK08348 NADH-plastoquinone oxidoreductase subunit; Provisional Back     alignment and domain information
>PRK08222 hydrogenase 4 subunit H; Validated Back     alignment and domain information
>PRK06991 ferredoxin; Provisional Back     alignment and domain information
>PRK09623 vorD 2-ketoisovalerate ferredoxin oxidoreductase subunit delta; Reviewed Back     alignment and domain information
>PRK09624 porD pyuvate ferredoxin oxidoreductase subunit delta; Reviewed Back     alignment and domain information
>TIGR03294 FrhG coenzyme F420 hydrogenase, subunit gamma Back     alignment and domain information
>PRK05113 electron transport complex protein RnfB; Provisional Back     alignment and domain information
>CHL00014 ndhI NADH dehydrogenase subunit I Back     alignment and domain information
>pfam00037 Fer4 4Fe-4S binding domain Back     alignment and domain information
>PRK09626 oorD 2-oxoglutarate-acceptor oxidoreductase subunit OorD; Reviewed Back     alignment and domain information
>PRK09326 F420H2 dehydrogenase subunit F; Provisional Back     alignment and domain information
>PRK08764 ferredoxin; Provisional Back     alignment and domain information
>PRK05888 NADH dehydrogenase subunit I; Provisional Back     alignment and domain information
>TIGR03048 PS_I_psaC photosystem I iron-sulfur protein PsaC Back     alignment and domain information
>TIGR01971 NuoI NADH-quinone oxidoreductase, chain I; InterPro: IPR010226 This entry represents the I subunit (one of 14 subunits, A to N) of the NADH-quinone oxidoreductase complex I which generally couples NADH and ubiquinone oxidation/reduction in bacteria and mammalian mitochondria, but may act on NADPH and/or plastoquinone in cyanobacteria and plant chloroplasts Back     alignment and domain information
>PRK06273 ferredoxin; Provisional Back     alignment and domain information
>TIGR03224 benzo_boxA benzoyl-CoA oxygenase/reductase, BoxA protein Back     alignment and domain information
>PRK02651 photosystem I subunit VII; Provisional Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>COG1145 NapF Ferredoxin [Energy production and conversion] Back     alignment and domain information
>CHL00065 psaC photosystem I subunit VII Back     alignment and domain information
>COG1149 MinD superfamily P-loop ATPase containing an inserted ferredoxin domain [Energy production and conversion] Back     alignment and domain information
>PRK09625 porD pyruvate flavodoxin oxidoreductase subunit delta; Reviewed Back     alignment and domain information
>COG2878 Predicted NADH:ubiquinone oxidoreductase, subunit RnfB [Energy production and conversion] Back     alignment and domain information
>PRK08318 dihydropyrimidine dehydrogenase; Validated Back     alignment and domain information
>TIGR02936 fdxN_nitrog ferredoxin III, nif-specific; InterPro: IPR014283 This entry consists of ferredoxins which are encoded in the nitrogen fixation regions of many nitrogen-fixing bacteria Back     alignment and domain information
>COG2221 DsrA Dissimilatory sulfite reductase (desulfoviridin), alpha and beta subunits [Energy production and conversion] Back     alignment and domain information
>PRK13795 hypothetical protein; Provisional Back     alignment and domain information
>PRK07569 bidirectional hydrogenase complex protein HoxU; Validated Back     alignment and domain information
>TIGR02176 pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxidoreductase; InterPro: IPR011895 The oxidative decarboxylation of pyruvate to acetyl-CoA, a central step in energy metabolism, can occur by two different mechanisms Back     alignment and domain information
>KOG3256 consensus Back     alignment and domain information
>COG1035 FrhB Coenzyme F420-reducing hydrogenase, beta subunit [Energy production and conversion] Back     alignment and domain information
>COG2768 Uncharacterized Fe-S center protein [General function prediction only] Back     alignment and domain information
>COG1146 Ferredoxin [Energy production and conversion] Back     alignment and domain information
>COG1141 Fer Ferredoxin [Energy production and conversion] Back     alignment and domain information
>TIGR02179 PorD_KorD 2-oxoacid:acceptor oxidoreductase, delta subunit, pyruvate/2-ketoisovalerate family; InterPro: IPR011898 A number of anaerobic and microaerophilic species lack pyruvate dehydrogenase and have instead a four subunit, oxygen-sensitive pyruvate oxidoreductase, with either ferredoxins or flavodoxins used as the acceptor Back     alignment and domain information
>TIGR02745 ccoG_rdxA_fixG cytochrome c oxidase accessory protein CcoG; InterPro: IPR014116 Member of this ferredoxin-like protein family, include FixG, CcoG and RdxA, Back     alignment and domain information
>TIGR01945 rnfC electron transport complex, RnfABCDGE type, C subunit; InterPro: IPR010208 The six subunit complex RnfABCDGE in Rhodobacter capsulatus encodes an apparent NADH oxidoreductase responsible for electron transport to nitrogenase, necessary for nitrogen fixation Back     alignment and domain information
>TIGR00276 TIGR00276 iron-sulfur cluster binding protein, putative; InterPro: IPR004453 This is a family of putative iron-sulphur cluster binding proteins Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>COG1144 Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, delta subunit [Energy production and conversion] Back     alignment and domain information
>COG4231 Indolepyruvate ferredoxin oxidoreductase, alpha and beta subunits [Energy production and conversion] Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>PRK11274 glcF glycolate oxidase iron-sulfur subunit; Provisional Back     alignment and domain information
>TIGR02486 RDH reductive dehalogenase; InterPro: IPR012832 This entry represents a family of corrin and 8-iron Fe-S cluster-containing reductive dehalogenases found primarily in halorespiring microorganisms such as Dehalococcoides ethenogenes which contains as many as 17 enzymes of this type with varying substrate ranges Back     alignment and domain information
>PRK05035 electron transport complex protein RnfC; Provisional Back     alignment and domain information
>PRK05950 sdhB succinate dehydrogenase iron-sulfur subunit; Reviewed Back     alignment and domain information
>TIGR00403 ndhI NADH-plastoquinone oxidoreductase, I subunit; InterPro: IPR004497 NADH-plastoquinone oxidoreductase subunit I (1 Back     alignment and domain information
>pfam00037 Fer4 4Fe-4S binding domain Back     alignment and domain information
>TIGR02700 flavo_MJ0208 archaeoflavoprotein, MJ0208 family; InterPro: IPR014073 This entry describes one of two paralogous families of archaeal flavoprotein Back     alignment and domain information
>TIGR02910 sulfite_red_A sulfite reductase, subunit A; InterPro: IPR014259 This entry represents subunit A, one of the three subunits of the anaerobic sulphite reductase of Salmonella, and close homologues from various Clostridium species, where the three-gene neighbourhood is preserved Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>TIGR02486 RDH reductive dehalogenase; InterPro: IPR012832 This entry represents a family of corrin and 8-iron Fe-S cluster-containing reductive dehalogenases found primarily in halorespiring microorganisms such as Dehalococcoides ethenogenes which contains as many as 17 enzymes of this type with varying substrate ranges Back     alignment and domain information
>COG3383 Uncharacterized anaerobic dehydrogenase [General function prediction only] Back     alignment and domain information
>TIGR03379 glycerol3P_GlpC glycerol-3-phosphate dehydrogenase, anaerobic, C subunit Back     alignment and domain information
>PRK11168 glpC sn-glycerol-3-phosphate dehydrogenase subunit C; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target113 putative ferredoxin protein [Candidatus Liberibacter as
1pc5_A107 Crystal Structure Of The P50g Mutant Of Ferredoxin 5e-26
1pc4_A107 Crystal Structure Of The P50a Mutant Of Ferredoxin 7e-26
2fd2_A106 Crystallographic Analysis Of Two Site-Directed Muta 2e-25
1frk_A106 Azotobacter Vinelandii Ferredoxin I: Alteration Of 3e-25
1frh_A106 Azotobacter Vinelandii Ferredoxin I: Alteration Of 4e-25
1ff2_A106 Crystal Structure Of The C42d Mutant Of Azotobacter 5e-25
1g6b_A106 Crystal Structure Of P47s Mutant Of Ferredoxin I Le 5e-25
1axq_A106 Ferricyanide Oxidized Fdi Length = 106 7e-25
1frm_A106 Azotobacter Vinelandii Ferredoxin I: Alteration Of 7e-25
1fri_A106 Azotobacter Vinelandii Ferredoxin I: Alteration Of 8e-25
1frl_A106 Azotobacter Vinelandii Ferredoxin I: Alteration Of 9e-25
1fdd_A106 Azotobacter Vinelandii Ferredoxin I: Aspartate 15 F 9e-25
6fdr_A106 7-Fe Ferredoxin From Azotobacter Vinelandii At 100k 1e-24
1frj_A106 Azotobacter Vinelandii Ferredoxin I: Alteration Of 1e-24
1gao_A106 Crystal Structure Of The L44s Mutant Of Ferredoxin 1e-24
1f5b_A106 Crystal Structure Of F2h Ferredoxin 1 Mutant From A 1e-24
1a6l_A106 T14c Mutant Of Azotobacter Vinelandii Fdi Length = 1e-24
1ftc_A106 Y13c Mutant Of Azotobacter Vinelandii Fdi Length = 1e-24
1f5c_A106 Crystal Structure Of F25h Ferredoxin 1 Mutant From 2e-24
1d3w_A106 Crystal Structure Of Ferredoxin 1 D15e Mutant From 2e-24
1b0v_A106 I40n Mutant Of Azotobacter Vinelandii Fdi Length = 3e-24
1g3o_A106 Crystal Structure Of V19e Mutant Of Ferredoxin I Le 3e-24
1b0t_A106 D15kK84D MUTANT OF AZOTOBACTER VINELANDII FDI Lengt 5e-24
1frx_A106 Structure And Properties Of C20s Fdi Mutant Length 8e-24
1fd2_A106 Site-Directed Mutagenesis Of Azotobacter Vinelandii 1e-23
1bc6_A77 7-Fe Ferredoxin From Bacillus Schlegelii, Nmr, 20 S 1e-11
1bd6_A77 7-Fe Ferredoxin From Bacillus Schlegelii, Nmr, Mini 3e-11
1bqx_A77 Artificial Fe8s8 Ferredoxin: The D13c Variant Of Ba 5e-11
2v2k_A105 The Crystal Structure Of Fdxa, A 7fe Ferredoxin Fro 5e-10
1h98_A78 New Insights Into Thermostability Of Bacterial Ferr 1e-09
2ivf_B352 Ethylbenzene Dehydrogenase From Aromatoleum Aromati 8e-06
2vpw_B195 Polysulfide Reductase With Bound Menaquinone Length 2e-05
3egw_B 509 The Crystal Structure Of The Narghi Mutant Narh - C 2e-05
1y4z_B 512 The Crystal Structure Of Nitrate Reductase A, Nargh 2e-05
1q16_B 512 Crystal Structure Of Nitrate Reductase A, Narghi, F 2e-05
1fca_A55 Structure Of The Ferredoxin From Clostridium Acidur 9e-05
1fdn_A55 Refined Crystal Structure Of The 2[4fe-4s] Ferredox 2e-04
3bk7_A 607 Structure Of The Complete Abce1RNAASE-L Inhibitor P 6e-04
1clf_A55 Clostridium Pasteurianum Ferredoxin Length = 55 0.001
>gi|37927462|pdb|1PC5|A Chain A, Crystal Structure Of The P50g Mutant Of Ferredoxin I At 1.8 A Resolution Length = 107 Back     alignment and structure
 Score =  120 bits (302), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 62/105 (59%), Positives = 76/105 (72%), Gaps = 2/105 (1%)

Query: 1   MTYVVTENCILCKHTDCVEVCPVDCFYEGENFLAIHPDECIDCGVCEPECPVDAIKPDTE 60
           M +VVT+NCI CK+TDCVEVCPVDCFYEG NFL IHPDECIDC +CEPEC   AI  + E
Sbjct: 1   MAFVVTDNCIKCKYTDCVEVCPVDCFYEGPNFLVIHPDECIDCALCEPECGAQAIFSEDE 60

Query: 61  --PGLELWLKINSEYATQWPNITTKKESLPSAAKMDGVKQKYEKY 103
               ++ ++++N+E A  WPNIT KK+ LP A   DGVK K +  
Sbjct: 61  VPEDMQEFIQLNAELAEVWPNITEKKDPLPDAEDWDGVKGKLQHL 105


>gi|37927460|pdb|1PC4|A Chain A, Crystal Structure Of The P50a Mutant Of Ferredoxin I At 1.65 A Resolution Length = 107 Back     alignment and structure
>gi|157834956|pdb|2FD2|A Chain A, Crystallographic Analysis Of Two Site-Directed Mutants Of Azotobacter Vinelandii Ferredoxin Length = 106 Back     alignment and structure
>gi|157831124|pdb|1FRK|A Chain A, Azotobacter Vinelandii Ferredoxin I: Alteration Of Individual Surface Charges And The [4fe-4s] Cluster Reduction Potential Length = 106 Back     alignment and structure
>gi|157831121|pdb|1FRH|A Chain A, Azotobacter Vinelandii Ferredoxin I: Alteration Of Individual Surface Charges And The [4fe-4s] Cluster Reduction Potential Length = 106 Back     alignment and structure
>gi|10120847|pdb|1FF2|A Chain A, Crystal Structure Of The C42d Mutant Of Azotobacter Vinelandii 7fe Ferredoxin (Fdi) Length = 106 Back     alignment and structure
>gi|11513606|pdb|1G6B|A Chain A, Crystal Structure Of P47s Mutant Of Ferredoxin I Length = 106 Back     alignment and structure
>gi|157830133|pdb|1AXQ|A Chain A, Ferricyanide Oxidized Fdi Length = 106 Back     alignment and structure
>gi|157831126|pdb|1FRM|A Chain A, Azotobacter Vinelandii Ferredoxin I: Alteration Of Individual Surface Charges And The [4fe-4s] Cluster Reduction Potential Length = 106 Back     alignment and structure
>gi|157831122|pdb|1FRI|A Chain A, Azotobacter Vinelandii Ferredoxin I: Alteration Of Individual Surface Charges And The [4fe-4s] Cluster Reduction Potential Length = 106 Back     alignment and structure
>gi|157831125|pdb|1FRL|A Chain A, Azotobacter Vinelandii Ferredoxin I: Alteration Of Individual Surface Charges And The [4fe-4s] Cluster Reduction Potential Length = 106 Back     alignment and structure
>gi|157831046|pdb|1FDD|A Chain A, Azotobacter Vinelandii Ferredoxin I: Aspartate 15 Facilitates Proton Transfer To The Reduced [3fe-4s] Cluster Length = 106 Back     alignment and structure
>gi|157884757|pdb|6FDR|A Chain A, 7-Fe Ferredoxin From Azotobacter Vinelandii At 100k, Na Dithionite Reduced At Ph 8.5, Resolution 1.4 A Length = 106 Back     alignment and structure
>gi|157831123|pdb|1FRJ|A Chain A, Azotobacter Vinelandii Ferredoxin I: Alteration Of Individual Surface Charges And The [4fe-4s] Cluster Reduction Potential Length = 106 Back     alignment and structure
>gi|12084520|pdb|1GAO|A Chain A, Crystal Structure Of The L44s Mutant Of Ferredoxin I Length = 106 Back     alignment and structure
>gi|9256973|pdb|1F5B|A Chain A, Crystal Structure Of F2h Ferredoxin 1 Mutant From Azotobacter Vinelandii At 1.75 Angstrom Resolution Length = 106 Back     alignment and structure
>gi|157829710|pdb|1A6L|A Chain A, T14c Mutant Of Azotobacter Vinelandii Fdi Length = 106 Back     alignment and structure
>gi|2098504|pdb|1FTC|A Chain A, Y13c Mutant Of Azotobacter Vinelandii Fdi Length = 106 Back     alignment and structure
>gi|9256974|pdb|1F5C|A Chain A, Crystal Structure Of F25h Ferredoxin 1 Mutant From Azotobacter Vinelandii At 1.75 Angstrom Resolution Length = 106 Back     alignment and structure
>gi|157872416|pdb|1D3W|A Chain A, Crystal Structure Of Ferredoxin 1 D15e Mutant From Azotobacter Vinelandii At 1.7 Angstrom Resolution Length = 106 Back     alignment and structure
>gi|6980482|pdb|1B0V|A Chain A, I40n Mutant Of Azotobacter Vinelandii Fdi Length = 106 Back     alignment and structure
>gi|11514021|pdb|1G3O|A Chain A, Crystal Structure Of V19e Mutant Of Ferredoxin I Length = 106 Back     alignment and structure
>gi|6729695|pdb|1B0T|A Chain A, D15kK84D MUTANT OF AZOTOBACTER VINELANDII FDI Length = 106 Back     alignment and structure
>gi|157831128|pdb|1FRX|A Chain A, Structure And Properties Of C20s Fdi Mutant Length = 106 Back     alignment and structure
>gi|157831043|pdb|1FD2|A Chain A, Site-Directed Mutagenesis Of Azotobacter Vinelandii Ferredoxin I. (Fe-S) Cluster-Driven Protein Rearrangement Length = 106 Back     alignment and structure
>gi|157830220|pdb|1BC6|A Chain A, 7-Fe Ferredoxin From Bacillus Schlegelii, Nmr, 20 Structures Length = 77 Back     alignment and structure
>gi|157830233|pdb|1BD6|A Chain A, 7-Fe Ferredoxin From Bacillus Schlegelii, Nmr, Minimized Average Structure Length = 77 Back     alignment and structure
>gi|6729719|pdb|1BQX|A Chain A, Artificial Fe8s8 Ferredoxin: The D13c Variant Of Bacillus Schlegelii Fe7s8 Ferredoxin Length = 77 Back     alignment and structure
>gi|151568126|pdb|2V2K|A Chain A, The Crystal Structure Of Fdxa, A 7fe Ferredoxin From Mycobacterium Smegmatis Length = 105 Back     alignment and structure
>gi|17942775|pdb|1H98|A Chain A, New Insights Into Thermostability Of Bacterial Ferredoxins: High Resolution Crystal Structure Of The Seven-Iron Ferredoxin From Thermus Thermophilus Length = 78 Back     alignment and structure
gi|116668165|pdb|2IVF|B Chain B, Ethylbenzene Dehydrogenase From Aromatoleum Aromaticum Length = 352 Back     alignment and structure
gi|190016225|pdb|2VPW|B Chain B, Polysulfide Reductase With Bound Menaquinone Length = 195 Back     alignment and structure
>gi|290560092|pdb|3EGW|B Chain B, The Crystal Structure Of The Narghi Mutant Narh - C16a Length = 509 Back     alignment and structure
>gi|62738590|pdb|1Y4Z|B Chain B, The Crystal Structure Of Nitrate Reductase A, Narghi, In Complex With The Q-Site Inhibitor Pentachlorophenol Length = 512 Back     alignment and structure
gi|37927741|pdb|1Q16|B Chain B, Crystal Structure Of Nitrate Reductase A, Narghi, From Escherichia Coli Length = 512 Back     alignment and structure
>gi|157831039|pdb|1FCA|A Chain A, Structure Of The Ferredoxin From Clostridium Acidurici: Model At 1.8 Angstroms Resolution Length = 55 Back     alignment and structure
gi|157831050|pdb|1FDN|A Chain A, Refined Crystal Structure Of The 2[4fe-4s] Ferredoxin From Clostridium Acidurici At 1.84 Angstroms Resolution Length = 55 Back     alignment and structure
>gi|163931196|pdb|3BK7|A Chain A, Structure Of The Complete Abce1RNAASE-L Inhibitor Protein From Pyrococcus Abysii Length = 607 Back     alignment and structure
>gi|157830634|pdb|1CLF|A Chain A, Clostridium Pasteurianum Ferredoxin Length = 55 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target113 putative ferredoxin protein [Candidatus Liberibacter as
7fd1_A106 FD1, protein (7-Fe ferredoxin I); electron transport, i 2e-20
2v2k_A105 Ferredoxin; iron, 3Fe-4S, 4Fe-4S, transport, iron-sulfu 5e-17
1h98_A78 Ferredoxin; electron transport, thermophilic, iron-sulf 8e-15
1bc6_A77 7-Fe ferredoxin; electron transport, iron-sulfur; NMR { 3e-14
1jb0_C80 Photosystem I iron-sulfur center; membrane protein, mul 3e-07
2zvs_A85 Uncharacterized ferredoxin-like protein YFHL; electron 3e-06
2c42_A 1231 Pyruvate-ferredoxin oxidoreductase; 4Fe-4S, iron, iron- 0.001
2fdn_A55 Ferredoxin; electron transport, iron-sulfur, 4Fe-4S; 0. 6e-10
3gyx_B166 Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3. 9e-09
1q16_B 512 Respiratory nitrate reductase 1 beta chain; membrane pr 1e-06
3or1_B386 Sulfite reductase beta; dissimilatory sulfite reductase 6e-06
2ivf_B352 Ethylbenzene dehydrogenase beta-subunit; anaerobic hydr 2e-05
1rgv_A80 Ferredoxin; electron transport; 2.90A {Thauera aromatic 3e-05
1jnr_B150 Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1. 4e-05
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, iron-s 4e-05
3mm5_B366 Sulfite reductase, dissimilatory-type subunit BET; alph 6e-05
3eun_A82 Ferredoxin; electron transport, [4Fe-4S] cluster, 4Fe-4 6e-05
2fgo_A82 Ferredoxin; allochromatium vinosum, [4Fe-4S] cluster, r 6e-05
1kqf_B294 FDH-N beta, formate dehydrogenase, nitrate-inducible, i 1e-04
2v4j_B381 Sulfite reductase, dissimilatory-type subunit beta; dis 3e-04
3c7b_B366 Sulfite reductase, dissimilatory-type subunit beta; alp 5e-04
3mm5_A418 Sulfite reductase, dissimilatory-type subunit ALP; alph 5e-04
2v4j_A437 Sulfite reductase, dissimilatory-type subunit alpha; di 0.001
3i9v_9182 NADH-quinone oxidoreductase subunit 9; electron transpo 0.001
3c7b_A417 Sulfite reductase, dissimilatory-type subunit alpha; al 0.001
1xer_A103 Ferredoxin; electron transport, iron-sulfur, duplicatio 0.003
>7fd1_A FD1, protein (7-Fe ferredoxin I); electron transport, iron-sulfur; 1.30A {Azotobacter vinelandii} SCOP: d.58.1.2 PDB: 1fda_A 1fdb_A 1fer_A 1axq_A 5fd1_A 6fdr_A 6fd1_A 7fdr_A 1frh_A 1fri_A 1fdd_A 1frl_A 1d3w_A 1frm_A 1frx_A 1g6b_A 1pc4_A 1frj_A 2fd2_A 1fd2_A ... Length = 106 Back     alignment and structure
 Score = 92.5 bits (229), Expect = 2e-20
 Identities = 61/101 (60%), Positives = 75/101 (74%), Gaps = 2/101 (1%)

Query: 3   YVVTENCILCKHTDCVEVCPVDCFYEGENFLAIHPDECIDCGVCEPECPVDAIKPDT--E 60
           +VVT+NCI CK+TDCVEVCPVDCFYEG NFL IHPDECIDC +CEPECP  AI  +    
Sbjct: 2   FVVTDNCIKCKYTDCVEVCPVDCFYEGPNFLVIHPDECIDCALCEPECPAQAIFSEDEVP 61

Query: 61  PGLELWLKINSEYATQWPNITTKKESLPSAAKMDGVKQKYE 101
             ++ ++++N+E A  WPNIT KK+ LP A   DGVK K +
Sbjct: 62  EDMQEFIQLNAELAEVWPNITEKKDPLPDAEDWDGVKGKLQ 102


>2v2k_A Ferredoxin; iron, 3Fe-4S, 4Fe-4S, transport, iron-sulfur, mycobacterium tuberculosis, Fe-S cluster, metal-binding, electron transfer; 1.6A {Mycobacterium smegmatis} Length = 105 Back     alignment and structure
>1h98_A Ferredoxin; electron transport, thermophilic, iron-sulfur, azotobacter, hydrogen bonds, stability, high resolution; 1.64A {Thermus aquaticus} SCOP: d.58.1.2 Length = 78 Back     alignment and structure
>1bc6_A 7-Fe ferredoxin; electron transport, iron-sulfur; NMR {Bacillus schlegelii} SCOP: d.58.1.2 PDB: 1bd6_A 1bqx_A 1bwe_A Length = 77 Back     alignment and structure
>1jb0_C Photosystem I iron-sulfur center; membrane protein, multiprotein-pigment complex, photosynthesis; HET: CL1 PQN BCR LHG LMG; 2.50A {Synechococcus elongatus} SCOP: d.58.1.2 PDB: 1k0t_A 2wsc_C* 2wse_C* 2wsf_C* 2o01_C* Length = 80 Back     alignment and structure
>2zvs_A Uncharacterized ferredoxin-like protein YFHL; electron transport, [4Fe-4S] clusters, iron- sulfur clusters, reduction potential; 1.65A {Escherichia coli k-12} Length = 85 Back     alignment and structure
>2c42_A Pyruvate-ferredoxin oxidoreductase; 4Fe-4S, iron, iron-sulfur, iron-sulfur cluster, pyruvate catabolism, TPP-dependent enzyme; HET: TPP; 1.78A {Desulfovibrio africanus} SCOP: c.36.1.8 c.36.1.12 c.48.1.3 c.64.1.1 d.58.1.5 PDB: 1b0p_A* 1kek_A* 2c3o_A* 2c3p_A* 2c3u_A* 2c3y_A* 2c3m_A* 2pda_A* 2uza_A* Length = 1231 Back     alignment and structure
>2fdn_A Ferredoxin; electron transport, iron-sulfur, 4Fe-4S; 0.94A {Clostridium acidurici} SCOP: d.58.1.1 PDB: 1fdn_A 1fca_A 1clf_A 1dur_A Length = 55 Back     alignment and structure
>3gyx_B Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Length = 166 Back     alignment and structure
>1q16_B Respiratory nitrate reductase 1 beta chain; membrane protein, electron-transfer, oxidoreductase; HET: FME MD1 HEM AGA 3PH; 1.90A {Escherichia coli} SCOP: d.58.1.5 PDB: 1r27_B* 1siw_B* 1y5i_B* 1y5l_B* 1y5n_B* 3ir5_B* 3ir6_B* 3ir7_B* 1y4z_B* Length = 512 Back     alignment and structure
>3or1_B Sulfite reductase beta; dissimilatory sulfite reductase, sulfate reduction, oxidored sulfite reduction; HET: SRM; 1.76A {Desulfovibrio gigas} PDB: 3or2_B* 2v4j_B* Length = 386 Back     alignment and structure
>2ivf_B Ethylbenzene dehydrogenase beta-subunit; anaerobic hydrocarbon degradation, MOCO, Fe/S cluster, MO- bismgd enzyme, DMSO reductase family; HET: MES MGD MD1 HEM; 1.88A {Azoarcus SP} Length = 352 Back     alignment and structure
>1rgv_A Ferredoxin; electron transport; 2.90A {Thauera aromatica K172} SCOP: d.58.1.1 Length = 80 Back     alignment and structure
>1jnr_B Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: d.58.1.5 PDB: 1jnz_B* 2fja_B* 2fjb_B* 2fjd_B* 2fje_B* Length = 150 Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} Length = 607 Back     alignment and structure
>3mm5_B Sulfite reductase, dissimilatory-type subunit BET; alpha-beta-protein, oxidoreductase; HET: SRM; 1.80A {Archaeoglobus fulgidus} PDB: 3c7b_B* 3mm6_B* 3mm7_B* 3mm8_B* 3mm9_B* 3mma_B* 3mmb_B* 3mmc_B* Length = 366 Back     alignment and structure
>3eun_A Ferredoxin; electron transport, [4Fe-4S] cluster, 4Fe-4S, iron, iron-sulfur, metal-binding, transport; 1.05A {Allochromatium vinosum} PDB: 1blu_A 3exy_A Length = 82 Back     alignment and structure
>2fgo_A Ferredoxin; allochromatium vinosum, [4Fe-4S] cluster, reduction potential, iron binding protein electron transport; 1.32A {Pseudomonas aeruginosa} Length = 82 Back     alignment and structure
>1kqf_B FDH-N beta, formate dehydrogenase, nitrate-inducible, iron- sulfur subunit; oxidoreductase, selenium, selenocysteine, seCys, molybdenum; HET: MGD HEM CDL; 1.60A {Escherichia coli} SCOP: d.58.1.5 f.23.22.1 PDB: 1kqg_B* Length = 294 Back     alignment and structure
>2v4j_B Sulfite reductase, dissimilatory-type subunit beta; dissimilatory sulfite reductase, complex, siroheme, oxidoreductase; HET: SRM; 2.10A {Desulfovibrio vulgaris} SCOP: d.58.1.5 d.58.36.2 d.134.1.1 Length = 381 Back     alignment and structure
>3mm5_A Sulfite reductase, dissimilatory-type subunit ALP; alpha-beta-protein, oxidoreductase; HET: SRM; 1.80A {Archaeoglobus fulgidus} PDB: 3mm6_A* 3mm7_A* 3mm8_A* 3mm9_A* 3mma_A* 3mmb_A* 3mmc_A* 3c7b_A* Length = 418 Back     alignment and structure
>2v4j_A Sulfite reductase, dissimilatory-type subunit alpha; dissimilatory sulfite reductase, complex, siroheme, oxidoreductase; HET: SRM; 2.10A {Desulfovibrio vulgaris} SCOP: d.58.1.5 d.58.36.2 d.134.1.1 Length = 437 Back     alignment and structure
>3i9v_9 NADH-quinone oxidoreductase subunit 9; electron transport, respiratory chain, 4Fe- 4S, cell membrane, flavoprotein, FMN, iron; HET: FMN; 3.10A {Thermus thermophilus HB8} PDB: 2fug_9* 3iam_9* 3ias_9* Length = 182 Back     alignment and structure
>1xer_A Ferredoxin; electron transport, iron-sulfur, duplication; 2.00A {Sulfolobus tokodaii str} SCOP: d.58.1.3 PDB: 2vkr_A Length = 103 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target113 putative ferredoxin protein [Candidatus Liberibacter as
7fd1_A106 FD1, protein (7-Fe ferredoxin I); electron transport, i 99.97
2v2k_A105 Ferredoxin; iron, 3Fe-4S, 4Fe-4S, transport, iron-sulfu 99.9
1h98_A78 Ferredoxin; electron transport, thermophilic, iron-sulf 99.86
1bc6_A77 7-Fe ferredoxin; electron transport, iron-sulfur; NMR { 99.85
2zvs_A85 Uncharacterized ferredoxin-like protein YFHL; electron 99.65
3eun_A82 Ferredoxin; electron transport, [4Fe-4S] cluster, 4Fe-4 99.65
1rgv_A80 Ferredoxin; electron transport; 2.90A {Thauera aromatic 99.63
2fdn_A