254780455

254780455

nicotinate phosphoribosyltransferase

GeneID in NCBI database:8209441Locus tag:CLIBASIA_01700
Protein GI in NCBI database:254780455Protein Accession:YP_003064868.1
Gene range:+(371850, 373106)Protein Length:418aa
Gene description:nicotinate phosphoribosyltransferase
COG prediction:none
KEGG prediction:nicotinate phosphoribosyltransferase (EC:2.4.2.11); K00763 nicotinate phosphoribosyltransferase [EC:2.4.2.11]
SEED prediction:Nicotinate phosphoribosyltransferase (EC 2.4.2.11)
Pathway involved in KEGG:Nicotinate and nicotinamide metabolism [PATH:las00760]
Subsystem involved in SEED:NAD and NADP cofactor biosynthesis global
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------42
MKEYFSTSDPIISSLLDTDFYKILMLQLIWKFYPDIKVTFSLFNRQTQLHLSDKIDESELRTQLDHVRSLRITEKERKWLVENSFYGKKQLFEPKFLSWLSDFQLPEYDLSHKKGQYVLNFHGLWKDVTLWEIPSLIIISTLYSRITVRSMNPFSVDLLYAQAKKKLWSKIIKLKNFSGLKIVDFGTRRRHSLTWQKWCIEALQEGIKDSFLGTSNALLAMNYKINAIGTSAHELPMVAAAITRTDIETQNAPYQMMQQWNRLYDDNLLIVLPDSFGTDFFLEHAPSWMTQWKGFRHDSASPIEGGEKIIAWWKKMNCNPQNKFLVFSDNLDVDSIIYTYKHFENRVQMIFGWGTNLTNDFDGCTPYQNLQTEKLQIVCKVTKANDKHAVKLSDDPAKTTGDISEIKRYLKIFKIKKS
ccccccccccccHHHHccHHHHHHHHHHHHHHccccEEEEEEEEcccccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHcccccccccccHHHHHHHHHccccccEEEEEccEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEcccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHccccccccccHHHHHHHHHHcccHHHHcccHHHHHHHHHHHcccccEEEEEEcccHHHHHHHHHHHHccccEEEEccccHHHHHHHHHHHHHHccccccccEEEEcccccHHHHHHHHHHHcccccEEEEEcccEEcccccccccccccccccEEEEEEEEEccccEEEEEcccccccccHHHHHHHHHHcccccc
cccHHccccHHHHHccccHHHHHHHHHHHHHcccccEEEEEEEEcccccccHHHccHHHHHHHHHHHHHccccHHHHHHHHccccccccccccHHHHHHHHHccccccEEEEcccEEEEEEccccHHHEEHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHcccccEEccccccccccHHHHHHHHHHHHHHcccccccccHHHHHHHccccccccHHHHHHHHHHHHcccHHHHHHcHHHHHHHHHHHccccccEEccccccHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHcccccccEEEEEcccccHHHHHHHHHHHcccEEEEEEcccccccccccccccccccccccEEEEEEEEcccccEEEEcccccccccccHHHHHHHHHcccccc
mkeyfstsdpiisslldtDFYKILMLQLIWKFYPDIKVTFSLFnrqtqlhlsdkideseLRTQLDHVRSLRITEKERKWLVENsfygkkqlfepkflswlsdfqlpeydlshkkgqYVLNFHGLWKDVTLWEIPSLIIISTLYSRITVRSMNPFSVDLLYAQAKKKLWSKIIKLknfsglkivdfgtrrrhslTWQKWCIEALQEGIKDSFLGTSNALLAMNYKInaigtsahelPMVAAAITRtdietqnapYQMMQQWNrlyddnllivlpdsfgtdfflehapswmtqwkgfrhdsaspiegGEKIIAWWKKmncnpqnkflvfsdnldvdSIIYTYKHFENRVQMIFGWgtnltndfdgctpyqnlqTEKLQIVCKVTKandkhavklsddpakttgdISEIKRYLKIFKIKKS
mkeyfstsdpiisslLDTDFYKILMLQLIWKFYPDIKVTFSLFNRQTQLhlsdkideselrtqldhvrslritekerkWLVENSFYGKKQLFEPKFLSWLSDFQLPEYDLSHKKGQYVLNFHGLWKDVTLWEIPSLIIISTLYSRITVRSMNPFSVDLLYAQAKKKLWSKIIKlknfsglkivdfgtrrrhslTWQKWCIEALQEGIKDSFLGTSNALLAMNYKINAIGTSAHELPMVAAAITRTDIETQNAPYQMMQQWNRLYDDNLLIVLPDSFGTDFFLEHAPSWMTQWKGFRHDSASPIEGGEKIIAWWKKMNCNPQNKFLVFSDNLDVDSIIYTYKHFENRVQMIFGWGTNLTNDFDGCTPYQNLQTEKLQIVCKVTKANdkhavklsddpakttgdiseiKRYLKIFKIKKS
MKEYFSTSDPIISSLLDTDFYKILMLQLIWKFYPDIKVTFSLFNRQTQLHLSDKIDESELRTQLDHVRSLRITEKERKWLVENSFYGKKQLFEPKFLSWLSDFQLPEYDLSHKKGQYVLNFHGLWKDVTLWEIPSLIIISTLYSRITVRSMNPFSVDLLYAQAkkklwskiiklkNFSGLKIVDFGTRRRHSLTWQKWCIEALQEGIKDSFLGTSNALLAMNYKINAIGTSAHELPMVAAAITRTDIETQNAPYQMMQQWNRLYDDNLLIVLPDSFGTDFFLEHAPSWMTQWKGFRHDSASPIEGGEKIIAWWKKMNCNPQNKFLVFSDNLDVDSIIYTYKHFENRVQMIFGWGTNLTNDFDGCTPYQNLQTEKLQIVCKVTKANDKHAVKLSDDPAKTTGDISEIKRYLKIFKIKKS
*********PIISSLLDTDFYKILMLQLIWKFYPDIKVTFSLFNRQTQLHLSDKIDESELRTQLDHVRSLRITEKERKWLVENSFYGKKQLFEPKFLSWLSDFQLPEYDLSHKKGQYVLNFHGLWKDVTLWEIPSLIIISTLYSRITVRSMNPFSVDLLYAQAKKKLWSKIIKLKNFSGLKIVDFGTRRRHSLTWQKWCIEALQEGIKDSFLGTSNALLAMNYKINAIGTSAHELPMVAAAITRTDIETQNAPYQMMQQWNRLYDDNLLIVLPDSFGTDFFLEHAPSWMTQWKGFRHDSASPIEGGEKIIAWWKKMNCNPQNKFLVFSDNLDVDSIIYTYKHFENRVQMIFGWGTNLTNDFDGCTPYQNLQTEKLQIVCKVTKANDKHAVKLSDDPAKTTGDISEIKRYLKIFKIK**
********DPIISSLLDTDFYKILMLQLIWKFYPDIKVTFSLFNRQTQLHLSDKIDESELRTQLDHVRSLRITEKERKWLVENSFYGKKQLFEPKFLSWLSDFQLPEYDLSHKKGQYVLNFHGLWKDVTLWEIPSLIIISTLYSRITVRSMNPFSVDLLYAQAKKKLWSKIIKLKNFSGLKIVDFGTRRRHSLTWQKWCIEALQEGIKDSFLGTSNALLAMNYKINAIGTSAHELPMVAAAITRTDIETQNAPYQMMQQWNRLYDDNLLIVLPDSFGTDFFLEHAPSWMTQWKGFRHDSASPIEGGEKIIAWWKKMNCNPQNKFLVFSDNLDVDSIIYTYKHFENRVQMIFGWGTNLTNDFDGCTPYQNLQTEKLQIVCKVTKANDKHAVKLSDDPAKTTGDISEIKRYLKIFKIKKS
*KEYFSTSDPIISSLLDTDFYKILMLQLIWKFYPDIKVTFSLFNRQTQLHLSDKIDESELRTQLDHVRSLRITEKERKWLVENSFYGKKQLFEPKFLSWLSDFQLPEYDLSHKKGQYVLNFHGLWKDVTLWEIPSLIIISTLYSRITVRSMNPFSVDLLYAQAKKKLWSKIIKLKNFSGLKIVDFGTRRRHSLTWQKWCIEALQEGIKDSFLGTSNALLAMNYKINAIGTSAHELPMVAAAITRTDIETQNAPYQMMQQWNRLYDDNLLIVLPDSFGTDFFLEHAPSWMTQWKGFRHDSASPIEGGEKIIAWWKKMNCNPQNKFLVFSDNLDVDSIIYTYKHFENRVQMIFGWGTNLTNDFDGCTPYQNLQTEKLQIVCKVTKANDKHAVKLSDDPAKTTGDISEIKRYLKIFKIKK*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKEYFSTSDPIISSLLDTDFYKILMLQLIWKFYPDIKVTFSLFNRQTQLHLSDKIDESELRTQLDHVRSLRITEKERKWLVENSFYGKKQLFEPKFLSWLSDFQLPEYDLSHKKGQYVLNFHGLWKDVTLWEIPSLIIISTLYSRITVRSMNPFSVDLLYAQAKKKLWSKIIKLKNFSGLKIVDFGTRRRHSLTWQKWCIEALQEGIKDSFLGTSNALLAMNYKINAIGTSAHELPMVAAAITRTDIETQNAPYQMMQQWNRLYDDNLLIVLPDSFGTDFFLEHAPSWMTQWKGFRHDSASPIEGGEKIIAWWKKMNCNPQNKFLVFSDNLDVDSIIYTYKHFENRVQMIFGWGTNLTNDFDGCTPYQNLQTEKLQIVCKVTKANDKHAVKLSDDPAKTTGDISEIKRYLKIFKIKKS
MKEYFSTSDPIISSLLDTDFYKILMLQLIWKFYPDIKVTFSLFNRQTQLHLSDKIDESELRTQLDHVRSLRITEKERKWLVENSFYGKKQLFEPKFLSWLSDFQLPEYDLSHKKGQYVLNFHGLWKDVTLWEIPSLIIISTLYSRITVRSMNPFSVDLLYAQAKKKLWSKIIKLKNFSGLKIVDFGTRRRHSLTWQKWCIEALQEGIKDSFLGTSNALLAMNYKINAIGTSAHELPMVAAAITRTDIETQNAPYQMMQQWNRLYDDNLLIVLPDSFGTDFFLEHAPSWMTQWKGFRHDSASPIEGGEKIIAWWKKMNCNPQNKFLVFSDNLDVDSIIYTYKHFENRVQMIFGWGTNLTNDFDGCTPYQNLQTEKLQIVCKVTKANDKHAVKLSDDPAKTTGDISEIKRYLKIFKIKKS
MKEYFSTSDPIISSLLDTDFYKILMLQLIWKFYPDIKVTFSLFNRQTQLHLSDKIDESELRTQLDHVRSLRITEKERKWLVENSFYGKKQLFEPKFLSWLSDFQLPEYDLSHKKGQYVLNFHGLWKDVTLWEIPSLIIISTLYSRITVRSMNPFSVDLLYAQAKKKLWSKIIKLKNFSGLKIVDFGTRRRHSLTWQKWCIEALQEGIKDSFLGTSNALLAMNYKINAIGTSAHELPMVAAAITRTDIETQNAPYQMMQQWNRLYDDNLLIVLPDSFGTDFFLEHAPSWMTQWKGFRHDSASPIEGGEKIIAWWKKMNCNPQNKFLVFSDNLDVDSIIYTYKHFENRVQMIFGWGTNLTNDFDGCTPYQNLQTEKLQIVCKVTKANDKHAVKLSDDPAKTTGDISEIKRYLKIFKIKKS

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target418 nicotinate phosphoribosyltransferase [Candidatus Liberi
315122097426 nicotinate phosphoribosyltransferase [Candidatus Liberi 1 0.0
190889857434 nicotinate phosphoribosyltransferase [Rhizobium etli CI 1 1e-159
241207133434 nicotinate phosphoribosyltransferase [Rhizobium legumin 1 1e-159
86355841434 nicotinate phosphoribosyltransferase [Rhizobium etli CF 1 1e-159
209551709434 nicotinate phosphoribosyltransferase [Rhizobium legumin 1 1e-159
116249958434 nicotinate phosphoribosyltransferase [Rhizobium legumin 1 1e-158
222147207434 nicotinate phosphoribosyltransferase [Agrobacterium vit 1 1e-156
222084427434 nicotinate phosphoribosyltransferase [Agrobacterium rad 1 1e-156
239830962466 nicotinate phosphoribosyltransferase [Ochrobactrum inte 1 1e-155
159184213434 nicotinate phosphoribosyltransferase [Agrobacterium tum 1 1e-154
>gi|315122097|ref|YP_004062586.1| nicotinate phosphoribosyltransferase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 426 Back     alignment and organism information
 Score =  714 bits (1844), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/415 (80%), Positives = 368/415 (88%)

Query: 3   EYFSTSDPIISSLLDTDFYKILMLQLIWKFYPDIKVTFSLFNRQTQLHLSDKIDESELRT 62
           +YFST DPII+SLLDTDFYK LMLQLIWKFYP+I VTFSLFNRQ +L+ SDKIDESELR 
Sbjct: 12  QYFSTPDPIITSLLDTDFYKFLMLQLIWKFYPNINVTFSLFNRQQKLNFSDKIDESELRA 71

Query: 63  QLDHVRSLRITEKERKWLVENSFYGKKQLFEPKFLSWLSDFQLPEYDLSHKKGQYVLNFH 122
           QLD+ RSLRITEKE++WL  N FYGKK +FEP FL+WLS+FQLPEYDLSHKKGQY+L FH
Sbjct: 72  QLDYARSLRITEKEKEWLNHNIFYGKKHIFEPNFLTWLSNFQLPEYDLSHKKGQYILKFH 131

Query: 123 GLWKDVTLWEIPSLIIISTLYSRITVRSMNPFSVDLLYAQAKKKLWSKIIKLKNFSGLKI 182
           G WKD++LWEIPSLIII+TLYSR  +RSM PF +DLLYAQAK KLWSKI+KLK FSGLKI
Sbjct: 132 GSWKDISLWEIPSLIIINTLYSRTIIRSMKPFYLDLLYAQAKGKLWSKIVKLKEFSGLKI 191

Query: 183 VDFGTRRRHSLTWQKWCIEALQEGIKDSFLGTSNALLAMNYKINAIGTSAHELPMVAAAI 242
           VDFGTRRRHS  WQKWCIEALQEGI DSFLGTSNALLAMN+ IN IGTSAHELPMVAAAI
Sbjct: 192 VDFGTRRRHSFAWQKWCIEALQEGITDSFLGTSNALLAMNHAINVIGTSAHELPMVAAAI 251

Query: 243 TRTDIETQNAPYQMMQQWNRLYDDNLLIVLPDSFGTDFFLEHAPSWMTQWKGFRHDSASP 302
            +TDIETQN+PYQMMQ+WN LYDDNLLI LPDSFGTDFFLEHAPSW+ +WKGFRHDSASP
Sbjct: 252 AQTDIETQNSPYQMMQKWNSLYDDNLLIALPDSFGTDFFLEHAPSWVAKWKGFRHDSASP 311

Query: 303 IEGGEKIIAWWKKMNCNPQNKFLVFSDNLDVDSIIYTYKHFENRVQMIFGWGTNLTNDFD 362
           IEGGEKI+AWW+KMNC   NK L+FSDNLDVDSII TYKHFENRV MIFGWGTNLTNDF 
Sbjct: 312 IEGGEKILAWWEKMNCETHNKILIFSDNLDVDSIINTYKHFENRVPMIFGWGTNLTNDFG 371

Query: 363 GCTPYQNLQTEKLQIVCKVTKANDKHAVKLSDDPAKTTGDISEIKRYLKIFKIKK 417
           GC P  N Q EKLQIVCKV KAN++H VKLSDDP KTTG+  +IKRYLK+FK +K
Sbjct: 372 GCMPCNNTQIEKLQIVCKVIKANNQHVVKLSDDPVKTTGNTLKIKRYLKLFKTQK 426


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|190889857|ref|YP_001976399.1| nicotinate phosphoribosyltransferase [Rhizobium etli CIAT 652] Length = 434 Back     alignment and organism information
>gi|241207133|ref|YP_002978229.1| nicotinate phosphoribosyltransferase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 434 Back     alignment and organism information
>gi|86355841|ref|YP_467733.1| nicotinate phosphoribosyltransferase [Rhizobium etli CFN 42] Length = 434 Back     alignment and organism information
>gi|209551709|ref|YP_002283626.1| nicotinate phosphoribosyltransferase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 434 Back     alignment and organism information
>gi|116249958|ref|YP_765796.1| nicotinate phosphoribosyltransferase [Rhizobium leguminosarum bv. viciae 3841] Length = 434 Back     alignment and organism information
>gi|222147207|ref|YP_002548164.1| nicotinate phosphoribosyltransferase [Agrobacterium vitis S4] Length = 434 Back     alignment and organism information
>gi|222084427|ref|YP_002542956.1| nicotinate phosphoribosyltransferase [Agrobacterium radiobacter K84] Length = 434 Back     alignment and organism information
>gi|239830962|ref|ZP_04679291.1| nicotinate phosphoribosyltransferase [Ochrobactrum intermedium LMG 3301] Length = 466 Back     alignment and organism information
>gi|159184213|ref|NP_353246.2| nicotinate phosphoribosyltransferase [Agrobacterium tumefaciens str. C58] Length = 434 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target418 nicotinate phosphoribosyltransferase [Candidatus Liberi
PRK05321400 PRK05321, PRK05321, nicotinate phosphoribosyltransferas 1e-152
TIGR01514394 TIGR01514, NAPRTase, nicotinate phosphoribosyltransfera 2e-77
COG1488405 COG1488, PncB, Nicotinic acid phosphoribosyltransferase 7e-71
KOG2511420 KOG2511, KOG2511, KOG2511, Nicotinic acid phosphoribosy 1e-37
TIGR01513443 TIGR01513, NAPRTase_put, putative nicotinate phosphorib 2e-08
cd01401377 cd01401, PncB_like, Nicotinate phosphoribosyltransferas 1e-101
pfam04095243 pfam04095, NAPRTase, Nicotinate phosphoribosyltransfera 4e-52
cd01567343 cd01567, NAPRTase_PncB, Nicotinate phosphoribosyltransf 9e-50
cd00516281 cd00516, PRTase_typeII, Phosphoribosyltransferase (PRTa 7e-19
cd01570327 cd01570, NAPRTase_A, Nicotinate phosphoribosyltransfera 1e-08
PRK12484443 PRK12484, PRK12484, nicotinate phosphoribosyltransferas 5e-06
>gnl|CDD|180013 PRK05321, PRK05321, nicotinate phosphoribosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|130578 TIGR01514, NAPRTase, nicotinate phosphoribosyltransferase Back     alignment and domain information
>gnl|CDD|31677 COG1488, PncB, Nicotinic acid phosphoribosyltransferase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|37722 KOG2511, KOG2511, KOG2511, Nicotinic acid phosphoribosyltransferase [Coenzyme transport and metabolism] Back     alignment and domain information
>gnl|CDD|162398 TIGR01513, NAPRTase_put, putative nicotinate phosphoribosyltransferase Back     alignment and domain information
>gnl|CDD|29613 cd01401, PncB_like, Nicotinate phosphoribosyltransferase (NAPRTase), related to PncB Back     alignment and domain information
>gnl|CDD|146628 pfam04095, NAPRTase, Nicotinate phosphoribosyltransferase (NAPRTase) family Back     alignment and domain information
>gnl|CDD|29614 cd01567, NAPRTase_PncB, Nicotinate phosphoribosyltransferase (NAPRTase) family Back     alignment and domain information
>gnl|CDD|29612 cd00516, PRTase_typeII, Phosphoribosyltransferase (PRTase) type II; This family contains two enzymes that play an important role in NAD production by either allowing quinolinic acid (QA) , quinolinate phosphoribosyl transferase (QAPRTase), or nicotinic acid (NA), nicotinate phosphoribosyltransferase (NAPRTase), to be used in the synthesis of NAD Back     alignment and domain information
>gnl|CDD|29617 cd01570, NAPRTase_A, Nicotinate phosphoribosyltransferase (NAPRTase), subgroup A Back     alignment and domain information
>gnl|CDD|183551 PRK12484, PRK12484, nicotinate phosphoribosyltransferase; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 418 nicotinate phosphoribosyltransferase [Candidatus Liberi
PRK05321400 nicotinate phosphoribosyltransferase; Provisional 100.0
cd01401377 PncB_like Nicotinate phosphoribosyltransferase (NAPRTas 100.0
TIGR01514430 NAPRTase nicotinate phosphoribosyltransferase; InterPro 100.0
TIGR01513523 NAPRTase_put putative nicotinate phosphoribosyltransfer 100.0
PRK09243466 nicotinate phosphoribosyltransferase; Validated 100.0
PRK12484443 nicotinate phosphoribosyltransferase; Provisional 100.0
COG1488405 PncB Nicotinic acid phosphoribosyltransferase [Coenzyme 100.0
KOG2511420 consensus 100.0
PRK08662343 nicotinate phosphoribosyltransferase; Reviewed 100.0
cd01571302 NAPRTase_B Nicotinate phosphoribosyltransferase (NAPRTa 100.0
PRK07188355 nicotinate phosphoribosyltransferase; Provisional 100.0
PRK09198462 putative nicotinate phosphoribosyltransferase; Provisio 100.0
cd01570327 NAPRTase_A Nicotinate phosphoribosyltransferase (NAPRTa 100.0
cd01567343 NAPRTase_PncB Nicotinate phosphoribosyltransferase (NAP 100.0
cd01569407 PBEF_like pre-B-cell colony-enhancing factor (PBEF)-lik 100.0
cd00516281 PRTase_typeII Phosphoribosyltransferase (PRTase) type I 100.0
PRK08385279 nicotinate-nucleotide pyrophosphorylase; Provisional 98.48
PRK05848272 nicotinate-nucleotide pyrophosphorylase; Provisional 98.34
cd01573272 modD_like ModD; Quinolinate phosphoribosyl transferase 97.59
PRK06978288 nicotinate-nucleotide pyrophosphorylase; Provisional 93.73
PRK05742277 nicotinate-nucleotide pyrophosphorylase; Provisional 90.1
pfam04095243 NAPRTase Nicotinate phosphoribosyltransferase (NAPRTase 100.0
cd01568269 QPRTase_NadC Quinolinate phosphoribosyl transferase (QA 97.88
cd01572268 QPRTase Quinolinate phosphoribosyl transferase (QAPRTas 94.66
pfam01729169 QRPTase_C Quinolinate phosphoribosyl transferase, C-ter 95.28
PRK07428285 nicotinate-nucleotide pyrophosphorylase; Provisional 92.39
>PRK05321 nicotinate phosphoribosyltransferase; Provisional Back     alignment and domain information
>cd01401 PncB_like Nicotinate phosphoribosyltransferase (NAPRTase), related to PncB Back     alignment and domain information
>TIGR01514 NAPRTase nicotinate phosphoribosyltransferase; InterPro: IPR006406 This family represents nicotinate phosphoribosyltransferase, the first enzyme in the salvage pathway of NAD biosynthesis from nicontinate (niacin) Back     alignment and domain information
>TIGR01513 NAPRTase_put putative nicotinate phosphoribosyltransferase; InterPro: IPR006405 A deep split separates two related families of proteins, one of which includes experimentally characterised examples of nicotinate phosphoribosyltransferase, the first enzyme of NAD salvage biosynthesis Back     alignment and domain information
>PRK09243 nicotinate phosphoribosyltransferase; Validated Back     alignment and domain information
>PRK12484 nicotinate phosphoribosyltransferase; Provisional Back     alignment and domain information
>COG1488 PncB Nicotinic acid phosphoribosyltransferase [Coenzyme metabolism] Back     alignment and domain information
>KOG2511 consensus Back     alignment and domain information
>PRK08662 nicotinate phosphoribosyltransferase; Reviewed Back     alignment and domain information
>cd01571 NAPRTase_B Nicotinate phosphoribosyltransferase (NAPRTase), subgroup B Back     alignment and domain information
>PRK07188 nicotinate phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK09198 putative nicotinate phosphoribosyltransferase; Provisional Back     alignment and domain information
>cd01570 NAPRTase_A Nicotinate phosphoribosyltransferase (NAPRTase), subgroup A Back     alignment and domain information
>cd01567 NAPRTase_PncB Nicotinate phosphoribosyltransferase (NAPRTase) family Back     alignment and domain information
>cd01569 PBEF_like pre-B-cell colony-enhancing factor (PBEF)-like Back     alignment and domain information
>cd00516 PRTase_typeII Phosphoribosyltransferase (PRTase) type II; This family contains two enzymes that play an important role in NAD production by either allowing quinolinic acid (QA) , quinolinate phosphoribosyl transferase (QAPRTase), or nicotinic acid (NA), nicotinate phosphoribosyltransferase (NAPRTase), to be used in the synthesis of NAD Back     alignment and domain information
>PRK08385 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>PRK05848 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>cd01573 modD_like ModD; Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase) present in some modABC operons in bacteria, which are involved in molybdate transport Back     alignment and domain information
>PRK06978 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>PRK05742 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>pfam04095 NAPRTase Nicotinate phosphoribosyltransferase (NAPRTase) family Back     alignment and domain information
>cd01568 QPRTase_NadC Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase), also called nicotinate-nucleotide pyrophosphorylase, is involved in the de novo synthesis of NAD in both prokaryotes and eukaryotes Back     alignment and domain information
>cd01572 QPRTase Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase), also called nicotinate-nucleotide pyrophosphorylase, is involved in the de novo synthesis of NAD in both prokaryotes and eukaryotes Back     alignment and domain information
>pfam01729 QRPTase_C Quinolinate phosphoribosyl transferase, C-terminal domain Back     alignment and domain information
>PRK07428 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target418 nicotinate phosphoribosyltransferase [Candidatus Liberi
1ybe_A449 Crystal Structure Of A Nicotinate Phosphoribosyltra 1e-134
1yir_A408 Crystal Structure Of A Nicotinate Phosphoribosyltra 1e-117
3os4_A407 The Crystal Structure Of Nicotinate Phosphoribosylt 1e-107
1vlp_A441 Crystal Structure Of A Putative Nicotinate Phosphor 4e-94
2im5_A394 Crystal Structure Of Nicotinate Phosphoribosyltrans 5e-94
2f7f_A 494 Crystal Structure Of Enterococcus Faecalis Putative 4e-83
1ytd_A398 Crystal Structure Of A Nicotinate Phosphoribosyltra 1e-30
2i14_A395 Crystal Structure Of Nicotinate-Nucleotide Pyrophos 1e-34
2h3d_A494 Crystal Structure Of Mouse Nicotinamide Phosphoribo 1e-19
2gvl_A491 Crystal Structure Of Murine Nmprtase Length = 491 1e-19
2g95_A491 Crystal Structure Of VisfatinPRE-B Cell Colony Enha 2e-19
3dgr_A484 Crystal Structure Of Human Nampt Complexed With Adp 3e-19
2e5b_A499 Crystal Structure Of Human Nmprtase As Free-Form Le 3e-19
2gvj_A491 Crystal Structure Of Human Nmprtase In Complex With 4e-19
2gvg_A491 Crystal Structure Of Human Nmprtase And Its Complex 4e-19
2h3b_A494 Crystal Structure Of Mouse Nicotinamide Phosphoribo 9e-19
>gi|60594204|pdb|1YBE|A Chain A, Crystal Structure Of A Nicotinate Phosphoribosyltransferase Length = 449 Back     alignment and structure
 Score =  483 bits (1244), Expect = e-134,   Method: Composition-based stats.
 Identities = 246/409 (60%), Positives = 314/409 (76%)

Query: 9   DPIISSLLDTDFYKILMLQLIWKFYPDIKVTFSLFNRQTQLHLSDKIDESELRTQLDHVR 68
           DPI+ SL+DTDFYK+LMLQ+IWK YP++  TFSL NR   + L+++IDE ELR QLDH R
Sbjct: 25  DPIVRSLIDTDFYKLLMLQMIWKLYPEVDATFSLINRTKTVRLAEEIDEMELREQLDHAR 84

Query: 69  SLRITEKERKWLVENSFYGKKQLFEPKFLSWLSDFQLPEYDLSHKKGQYVLNFHGLWKDV 128
           +LR+++KE  WL  N+FYG+ Q+FEP+FLSWLS +QLPEY+L  + GQY LNFHG W D 
Sbjct: 85  TLRLSKKENIWLAGNTFYGRSQIFEPEFLSWLSSYQLPEYELFKRDGQYELNFHGRWMDT 144

Query: 129 TLWEIPSLIIISTLYSRITVRSMNPFSVDLLYAQAKKKLWSKIIKLKNFSGLKIVDFGTR 188
           TLWEIP+L II+ L SR  +RS+  F++D+LYA+AK K+W K+ +L+   GL+I DFGTR
Sbjct: 145 TLWEIPALSIINELRSRSAMRSLGYFTLDVLYARAKAKMWEKVERLRELPGLRISDFGTR 204

Query: 189 RRHSLTWQKWCIEALQEGIKDSFLGTSNALLAMNYKINAIGTSAHELPMVAAAITRTDIE 248
           RRHS  WQ+WC+EAL+EGI  +F GTSN LLAM+  + A+GT+AHELPMV AA+ +T+ E
Sbjct: 205 RRHSFLWQRWCVEALKEGIGPAFTGTSNVLLAMDSDLEAVGTNAHELPMVVAALAQTNEE 264

Query: 249 TQNAPYQMMQQWNRLYDDNLLIVLPDSFGTDFFLEHAPSWMTQWKGFRHDSASPIEGGEK 308
              APYQ+++ WNRLY  NLLIVLPD+FGT  FL +AP W+  W GFR DSA PIEGGEK
Sbjct: 265 LAAAPYQVLKDWNRLYGGNLLIVLPDAFGTAAFLRNAPEWVADWTGFRPDSAPPIEGGEK 324

Query: 309 IIAWWKKMNCNPQNKFLVFSDNLDVDSIIYTYKHFENRVQMIFGWGTNLTNDFDGCTPYQ 368
           II WW+KM  +P+ K L+FSD LDVD+I+ TY+HFE RV+M FGWGTNLTNDF GC P  
Sbjct: 325 IIEWWRKMGRDPRTKMLIFSDGLDVDAIVDTYRHFEGRVRMSFGWGTNLTNDFAGCAPKT 384

Query: 369 NLQTEKLQIVCKVTKANDKHAVKLSDDPAKTTGDISEIKRYLKIFKIKK 417
               + + IVCKV+ AN + AVKLSD+P K TGD +E++RYLK F  + 
Sbjct: 385 IASLKPISIVCKVSDANGRPAVKLSDNPQKATGDPAEVERYLKFFGEED 433


>gi|60594388|pdb|1YIR|A Chain A, Crystal Structure Of A Nicotinate Phosphoribosyltransferase Length = 408 Back     alignment and structure
>gi|307568473|pdb|3OS4|A Chain A, The Crystal Structure Of Nicotinate Phosphoribosyltransferase From Yersinia Pestis Length = 407 Back     alignment and structure
>gi|52696213|pdb|1VLP|A Chain A, Crystal Structure Of A Putative Nicotinate Phosphoribosyltransferase (Yor209c, Npt1) From Saccharomyces Cerevisiae At 1.75 A Resolution Length = 441 Back     alignment and structure
gi|118138461|pdb|2IM5|A Chain A, Crystal Structure Of Nicotinate Phosphoribosyltransferase From Porphyromonas Gingivalis Length = 394 Back     alignment and structure
>gi|85544633|pdb|2F7F|A Chain A, Crystal Structure Of Enterococcus Faecalis Putative Nicotinate Phosphoribosyltransferase, New York Structural Genomics Consortium Length = 494 Back     alignment and structure
>gi|62738756|pdb|1YTD|A Chain A, Crystal Structure Of A Nicotinate Phosphoribosyltransferase From Thermoplasma Acidophilum, Native Structure Length = 398 Back     alignment and structure
>gi|118138027|pdb|2I14|A Chain A, Crystal Structure Of Nicotinate-Nucleotide Pyrophosphorylase From Pyrococcus Furiosus Length = 395 Back     alignment and structure
>gi|110590526|pdb|2H3D|A Chain A, Crystal Structure Of Mouse Nicotinamide PhosphoribosyltransferaseVISFATINPRE-B Cell Colony Enhancing Factor In Complex With Nicotinamide Mononuleotide Length = 494 Back     alignment and structure
>gi|112490979|pdb|2GVL|A Chain A, Crystal Structure Of Murine Nmprtase Length = 491 Back     alignment and structure
gi|112490693|pdb|2G95|A Chain A, Crystal Structure Of VisfatinPRE-B Cell Colony Enhancing Factor 1NICOTINAMIDE PHOSPHORIBOSYLTRANSFERASE Length = 491 Back     alignment and structure
>gi|256032335|pdb|3DGR|A Chain A, Crystal Structure Of Human Nampt Complexed With Adp Analogue Length = 484 Back     alignment and structure
>gi|163930869|pdb|2E5B|A Chain A, Crystal Structure Of Human Nmprtase As Free-Form Length = 499 Back     alignment and structure
>gi|110590439|pdb|2GVJ|A Chain A, Crystal Structure Of Human Nmprtase In Complex With Fk866 Length = 491 Back     alignment and structure
gi|110590432|pdb|2GVG|A Chain A, Crystal Structure Of Human Nmprtase And Its Complex With Nmn Length = 491 Back     alignment and structure
>gi|110590524|pdb|2H3B|A Chain A, Crystal Structure Of Mouse Nicotinamide PhosphoribosyltransferaseVISFATINPRE-B Cell Colony Enhancing Factor 1 Length = 494 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target418 nicotinate phosphoribosyltransferase [Candidatus Liberi
1ybe_A449 Naprtase, nicotinate phosphoribosyltransferase; structu 1e-125
2im5_A394 Nicotinate phosphoribosyltransferase; structural genomi 1e-93
1vlp_A441 Naprtase, nicotinate phosphoribosyltransferase; YOR209C 2e-89
3os4_A407 Naprtase, nicotinate phosphoribosyltransferase; structu 7e-89
1yir_A408 Naprtase 2, nicotinate phosphoribosyltransferase 2; str 8e-89
2f7f_A 494 Nicotinate phosphoribosyltransferase, putative; structu 8e-47
2i1o_A398 Nicotinate phosphoribosyltransferase; ZIN ION, zinc fin 1e-25
2i14_A395 Nicotinate-nucleotide pyrophosphorylase; ligand binding 1e-22
3dhf_A484 Nicotinamide phosphoribosyltransferase; NMPRTASE, NAMPR 1e-20
>1ybe_A Naprtase, nicotinate phosphoribosyltransferase; structural genomics, protein structure initiative, NYSGXRC, PSI; 2.50A {Agrobacterium tumefaciens} SCOP: c.1.17.2 d.41.2.2 Length = 449 Back     alignment and structure
 Score =  443 bits (1141), Expect = e-125
 Identities = 246/405 (60%), Positives = 313/405 (77%)

Query: 9   DPIISSLLDTDFYKILMLQLIWKFYPDIKVTFSLFNRQTQLHLSDKIDESELRTQLDHVR 68
           DPI+ SL+DTDFYK+LMLQ+IWK YP++  TFSL NR   + L+++IDE ELR QLDH R
Sbjct: 25  DPIVRSLIDTDFYKLLMLQMIWKLYPEVDATFSLINRTKTVRLAEEIDEMELREQLDHAR 84

Query: 69  SLRITEKERKWLVENSFYGKKQLFEPKFLSWLSDFQLPEYDLSHKKGQYVLNFHGLWKDV 128
           +LR+++KE  WL  N+FYG+ Q+FEP+FLSWLS +QLPEY+L  + GQY LNFHG W D 
Sbjct: 85  TLRLSKKENIWLAGNTFYGRSQIFEPEFLSWLSSYQLPEYELFKRDGQYELNFHGRWMDT 144

Query: 129 TLWEIPSLIIISTLYSRITVRSMNPFSVDLLYAQAKKKLWSKIIKLKNFSGLKIVDFGTR 188
           TLWEIP+L II+ L SR  +RS+  F++D+LYA+AK K+W K+ +L+   GL+I DFGTR
Sbjct: 145 TLWEIPALSIINELRSRSAMRSLGYFTLDVLYARAKAKMWEKVERLRELPGLRISDFGTR 204

Query: 189 RRHSLTWQKWCIEALQEGIKDSFLGTSNALLAMNYKINAIGTSAHELPMVAAAITRTDIE 248
           RRHS  WQ+WC+EAL+EGI  +F GTSN LLAM+  + A+GT+AHELPMV AA+ +T+ E
Sbjct: 205 RRHSFLWQRWCVEALKEGIGPAFTGTSNVLLAMDSDLEAVGTNAHELPMVVAALAQTNEE 264

Query: 249 TQNAPYQMMQQWNRLYDDNLLIVLPDSFGTDFFLEHAPSWMTQWKGFRHDSASPIEGGEK 308
              APYQ+++ WNRLY  NLLIVLPD+FGT  FL +AP W+  W GFR DSA PIEGGEK
Sbjct: 265 LAAAPYQVLKDWNRLYGGNLLIVLPDAFGTAAFLRNAPEWVADWTGFRPDSAPPIEGGEK 324

Query: 309 IIAWWKKMNCNPQNKFLVFSDNLDVDSIIYTYKHFENRVQMIFGWGTNLTNDFDGCTPYQ 368
           II WW+KM  +P+ K L+FSD LDVD+I+ TY+HFE RV+M FGWGTNLTNDF GC P  
Sbjct: 325 IIEWWRKMGRDPRTKMLIFSDGLDVDAIVDTYRHFEGRVRMSFGWGTNLTNDFAGCAPKT 384

Query: 369 NLQTEKLQIVCKVTKANDKHAVKLSDDPAKTTGDISEIKRYLKIF 413
               + + IVCKV+ AN + AVKLSD+P K TGD +E++RYLK F
Sbjct: 385 IASLKPISIVCKVSDANGRPAVKLSDNPQKATGDPAEVERYLKFF 429


>2im5_A Nicotinate phosphoribosyltransferase; structural genomics, NYSGXRC, PSI, protein structure initiative; 2.20A {Porphyromonas gingivalis} Length = 394 Back     alignment and structure
>1vlp_A Naprtase, nicotinate phosphoribosyltransferase; YOR209C, structural genomics, JCSG, protein structure initiative, PSI; HET: MSE MES; 1.75A {Saccharomyces cerevisiae} SCOP: c.1.17.2 d.41.2.2 Length = 441 Back     alignment and structure
>3os4_A Naprtase, nicotinate phosphoribosyltransferase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel; HET: MSE; 1.60A {Yersinia pestis} Length = 407 Back     alignment and structure
>1yir_A Naprtase 2, nicotinate phosphoribosyltransferase 2; structural genomics, protein structure initiative, hypothetical protein, NYSGXRC, PSI; 2.10A {Pseudomonas aeruginosa} SCOP: c.1.17.2 d.41.2.2 Length = 408 Back     alignment and structure
>2f7f_A Nicotinate phosphoribosyltransferase, putative; structural genomics, PSI, protein structure initiative; 2.00A {Enterococcus faecalis V583} SCOP: c.1.17.1 d.41.2.1 Length = 494 Back     alignment and structure
>2i1o_A Nicotinate phosphoribosyltransferase; ZIN ION, zinc finger motif, structural genomics, PSI, protein structure initiative; 2.40A {Thermoplasma acidophilum} PDB: 1ytd_A* 1yte_A* 1ytk_A Length = 398 Back     alignment and structure
>2i14_A Nicotinate-nucleotide pyrophosphorylase; ligand binding, phosphoribosylpyrophosphate, Zn metal ION, structural genomics, PSI; HET: PCP; 2.90A {Pyrococcus furiosus} SCOP: c.1.17.1 d.41.2.1 Length = 395 Back     alignment and structure
>3dhf_A Nicotinamide phosphoribosyltransferase; NMPRTASE, NAMPRTASE, visfatin, beryllium fluoride, nicotinamide D-ribonucleotide, pyrophosphate; HET: NMN; 1.80A {Homo sapiens} PDB: 3dgr_A* 3dhd_A* 3dkj_A* 3dkl_A* 2gvj_A* 2gvg_A* 2e5b_A 2e5c_A* 2e5d_A 2h3d_A* 2gvl_A 2h3b_A 2g95_A 2g96_A* 2g97_A* 3g8e_A* Length = 484 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target418 nicotinate phosphoribosyltransferase [Candidatus Liberi
1ybe_A449 Naprtase, nicotinate phosphoribosyltransferase; structu 100.0
2im5_A394 Nicotinate phosphoribosyltransferase; structural genomi 100.0
1yir_A408 Naprtase 2, nicotinate phosphoribosyltransferase 2; str 100.0
1vlp_A441 Naprtase, nicotinate phosphoribosyltransferase; YOR209C 100.0
3os4_A407 Naprtase, nicotinate phosphoribosyltransferase; structu 100.0
2f7f_A 494 Nicotinate phosphoribosyltransferase, putative; structu 100.0
3dhf_A484 Nicotinamide phosphoribosyltransferase; NMPRTASE, NAMPR 100.0
2i1o_A398 Nicotinate phosphoribosyltransferase; ZIN ION, zinc fin 100.0
2i14_A395 Nicotinate-nucleotide pyrophosphorylase; ligand binding 100.0
2jbm_A299 Nicotinate-nucleotide pyrophosphorylase; NAD, enzyme, m 99.41
2b7n_A273 Probable nicotinate-nucleotide pyrophosphorylase; quino 99.25
1qpo_A284 Quinolinate acid phosphoribosyl transferase; type II pr 98.71
3gnn_A298 Nicotinate-nucleotide pyrophosphorylase; decode biostru 98.56
3paj_A320 Nicotinate-nucleotide pyrophosphorylase, carboxyl; TIM 98.39
1qap_A296 Quinolinic acid phosphoribosyltransferase; glycosyltran 98.35
3l0g_A300 Nicotinate-nucleotide pyrophosphorylase; ssgcid, NIH, n 98.33
3c2e_A294 Nicotinate-nucleotide pyrophosphorylase; qprtase, prtas 98.11
1x1o_A286 Nicotinate-nucleotide pyrophosphorylase; transferase, s 98.1
1o4u_A285 Type II quinolic acid phosphoribosyltransferase; TM1645 98.65
3os4_A407 Naprtase, nicotinate phosphoribosyltransferase; structu 90.41
>1ybe_A Naprtase, nicotinate phosphoribosyltransferase; structural genomics, protein structure initiative, NYSGXRC, PSI; 2.50A {Agrobacterium tumefaciens} SCOP: c.1.17.2 d.41.2.2 Back     alignment and structure
Probab=100.00  E-value=0  Score=950.89  Aligned_cols=414  Identities=59%  Similarity=1.100  Sum_probs=403.4

Q ss_pred             CCCCCCCCCHHHHCCHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCCCCCCEEHHHHHHHHHHHHCCCCCHHHHHHHHHC
Q ss_conf             25656710012440117899999999984899659999996588755440000236999999997169998999999837
Q gi|254780455|r    4 YFSTSDPIISSLLDTDFYKILMLQLIWKFYPDIKVTFSLFNRQTQLHLSDKIDESELRTQLDHVRSLRITEKERKWLVEN   83 (418)
Q Consensus         4 ~~~~~~piI~SlLdTD~YkltM~~a~~~~~~~~~v~f~~~~R~~~~~~~~~~v~~gL~~~i~~l~~~rft~eei~yL~~~   83 (418)
                      +-+.-+|||+||||||+|||||+||||+++|+++|+|+||||++++++++|++++||+++|++|++||||+|||+||+++
T Consensus        20 ~~~~~~pii~SLLdTDlYklTM~qa~~~~~~~~~a~f~~f~R~~~~~~~~~~v~~gL~~~i~~l~~l~ft~eei~yL~~~   99 (449)
T 1ybe_A           20 HTWKLDPIVRSLIDTDFYKLLMLQMIWKLYPEVDATFSLINRTKTVRLAEEIDEMELREQLDHARTLRLSKKENIWLAGN   99 (449)
T ss_dssp             --CCCCCSCCCTTCSBHHHHHHHHHHHHHCTTCBEEEEEEESCCSSCSTTTSCHHHHHHHHHHHTTCCCCHHHHHHHHHS
T ss_pred             CCCCCCCHHCCCCCCHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHC
T ss_conf             44688402114503278999999999986899759999997889877516889989999999997089799999999846


Q ss_pred             CCCCCCCCCCHHHHHHHHHCCCCCCEEEECCCCEEEEEECCHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHH
Q ss_conf             77555557898899997508998416873399269998548778677888999999888887753134866799999999
Q gi|254780455|r   84 SFYGKKQLFEPKFLSWLSDFQLPEYDLSHKKGQYVLNFHGLWKDVTLWEIPSLIIISTLYSRITVRSMNPFSVDLLYAQA  163 (418)
Q Consensus        84 ~~~~~~~~~~~~fl~~L~~~~f~~~~~~~~eg~~~i~ieGp~~~~~l~EtplL~iine~~~~~~~~~~~~~~~~~~~~~~  163 (418)
                      +++.+.+.|+++|++||++++|++.+++++||+++|+|+|||.+|||||||||+||||+|++++.+.+.....+..++.+
T Consensus       100 ~~~~~~~~f~~~fl~~L~~~~f~~~~~~~~eg~l~l~ieGp~~~~~L~EtplL~iine~~~~~~~~~~~~~~~~~~~~~~  179 (449)
T 1ybe_A          100 TFYGRSQIFEPEFLSWLSSYQLPEYELFKRDGQYELNFHGRWMDTTLWEIPALSIINELRSRSAMRSLGYFTLDVLYARA  179 (449)
T ss_dssp             CSSSCSCCSCHHHHHHHHTCCCCCCEEEECSSCEEEEECSBHHHHGGGHHHHHHHHHHHHHHHHHTSCCHHHHHHHHHHH
T ss_pred             CCCCCCCCCCHHHHHHHHHCCCCCCEEEECCCEEEEEEECCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             87545566898999998617899847996088189999655435428878999999999999887410022578999999


Q ss_pred             HHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHCCCCEEHHHHHHHHHHCCCCCCCCCCHHHHHHHHCCC
Q ss_conf             99999877767426997599842443479788999999998421212012478899997289876752048987640012
Q gi|254780455|r  164 KKKLWSKIIKLKNFSGLKIVDFGTRRRHSLTWQKWCIEALQEGIKDSFLGTSNALLAMNYKINAIGTSAHELPMVAAAIT  243 (418)
Q Consensus       164 ~~~~~~k~~~~~~~~~~~l~eFG~RR~~s~~~q~~~v~~~raa~~~gf~GTSNv~aa~~~gi~~~GTmaHs~v~a~~~~~  243 (418)
                      ..++.++++++++++|++++|||+|||||+++|++++.++|+++++||+|||||+||++|||||+|||||||||+|+++.
T Consensus       180 ~~~~~~~a~~l~~~~g~~l~EFGtRRa~s~q~~d~~l~a~r~a~~ggf~GTSNV~aa~~~gip~~GTmAHs~v~~~~~~~  259 (449)
T 1ybe_A          180 KAKMWEKVERLRELPGLRISDFGTRRRHSFLWQRWCVEALKEGIGPAFTGTSNVLLAMDSDLEAVGTNAHELPMVVAALA  259 (449)
T ss_dssp             HHHHHHHHHHHTTCTTCCEEECCTTTCSCHHHHHHHHHHHHHHHGGGEEEESBHHHHHHHTCCBCCCCCTHHHHHHHHHC
T ss_pred             HHHHHHHHHHHHHCCCCCHHHCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHCCCCCEEEHHHHHHHHHHHHH
T ss_conf             99999999998745898230213322346378999999999982488821066999987699961441769999875131


Q ss_pred             CCHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHHHHCCCCEEECCCCCHHHHHHHHHHHHHHCCCCCCCE
Q ss_conf             20367865499999999996398865986346898999998997310024341288887899999999999779881130
Q gi|254780455|r  244 RTDIETQNAPYQMMQQWNRLYDDNLLIVLPDSFGTDFFLEHAPSWMTQWKGFRHDSASPIEGGEKIIAWWKKMNCNPQNK  323 (418)
Q Consensus       244 ~~~~~~~~~~~~a~~~~~~~yp~~~~i~L~DTy~~~~~l~~~~~~~~~~~GVR~DSGD~~~~~~k~~~~l~~~Gidp~~k  323 (418)
                      +.+.++++++..||++|+++||++++|+|+|||++++|++++.++..++.|||+|||||++|++|+|++||++|++|.+|
T Consensus       260 ~~~~~~~~~~~~a~~~w~~~y~~~l~i~L~DT~g~~~fl~~~~~~~~~~~GVRlDSGDl~~~s~k~r~~~d~~G~~p~~K  339 (449)
T 1ybe_A          260 QTNEELAAAPYQVLKDWNRLYGGNLLIVLPDAFGTAAFLRNAPEWVADWTGFRPDSAPPIEGGEKIIEWWRKMGRDPRTK  339 (449)
T ss_dssp             CSHHHHHHHHHHHHHHHHHHCCGGGCEECCCTTCHHHHHHTCCGGGGGSSEECCCSSCHHHHHHHHHHHHHHTTCCGGGS
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHHHCCCCCEEECCCCCHHHHHHHHHHHHHHCCCCCCCC
T ss_conf             10689998899999999986699635753064458999987787448788890799898999999999999869997875


Q ss_pred             EEEECCCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCEEEEEEEECCCCEEEEECCCCCCCCCH
Q ss_conf             89973898999999999972489737863346431465666666556777321689857576811167326887524888
Q gi|254780455|r  324 FLVFSDNLDVDSIIYTYKHFENRVQMIFGWGTNLTNDFDGCTPYQNLQTEKLQIVCKVTKANDKHAVKLSDDPAKTTGDI  403 (418)
Q Consensus       324 ~iv~Sd~Ld~e~i~~l~~~~~~~~~~~fGIGT~Lt~d~~~~~~~~~~~~~~l~~VyKlve~~g~P~~KlSd~~~K~tg~~  403 (418)
                      .|||||||||++|.+|+++++++++++|||||+|||||+|..+.++.++|+|||||||||+||+|||||||+|||+|||+
T Consensus       340 ~iv~Sd~LD~~~i~~l~~~~~g~~~d~FGIGT~Lt~d~~g~~~~~~~~~p~l~~VyKLve~~G~P~~KlSd~~gK~tg~~  419 (449)
T 1ybe_A          340 MLIFSDGLDVDAIVDTYRHFEGRVRMSFGWGTNLTNDFAGCAPKTIASLKPISIVCKVSDANGRPAVKLSDNPQKATGDP  419 (449)
T ss_dssp             EEEECTTCCHHHHHHHHHHHTTTSEEEEEECHHHHCCCTTCCC-----CCCCCEEEEEEEETTEECCBCCSSGGGCBSCH
T ss_pred             EEEEECCCCHHHHHHHHHHHCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCEEEEEEEECCEEEEEECCCCCCCCCCH
T ss_conf             79992899999999999985698532896486306588666755446798653699988468932467248988766998


Q ss_pred             HHHHHHHHHCCCCC
Q ss_conf             99999999809666
Q gi|254780455|r  404 SEIKRYLKIFKIKK  417 (418)
Q Consensus       404 ~~~~~~~~~~~~~~  417 (418)
                      +.|++|+|+|++.+
T Consensus       420 ~~~~~~~r~~g~~~  433 (449)
T 1ybe_A          420 AEVERYLKFFGEED  433 (449)
T ss_dssp             HHHHHHHHHHCCCC
T ss_pred             HHHHHHHHHHCCCC
T ss_conf             99999999837676



>2im5_A Nicotinate phosphoribosyltransferase; structural genomics, NYSGXRC, PSI, protein structure initiative; 2.20A {Porphyromonas gingivalis} Back     alignment and structure
>1yir_A Naprtase 2, nicotinate phosphoribosyltransferase 2; structural genomics, protein structure initiative, hypothetical protein, NYSGXRC, PSI; 2.10A {Pseudomonas aeruginosa} SCOP: c.1.17.2 d.41.2.2 Back     alignment and structure
>1vlp_A Naprtase, nicotinate phosphoribosyltransferase; YOR209C, structural genomics, JCSG, protein structure initiative, PSI; HET: MSE MES; 1.75A {Saccharomyces cerevisiae} SCOP: c.1.17.2 d.41.2.2 Back     alignment and structure
>3os4_A Naprtase, nicotinate phosphoribosyltransferase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel; HET: MSE; 1.60A {Yersinia pestis} Back     alignment and structure
>2f7f_A Nicotinate phosphoribosyltransferase, putative; structural genomics, PSI, protein structure initiative; 2.00A {Enterococcus faecalis V583} SCOP: c.1.17.1 d.41.2.1 Back     alignment and structure
>3dhf_A Nicotinamide phosphoribosyltransferase; NMPRTASE, NAMPRTASE, visfatin, beryllium fluoride, nicotinamide D-ribonucleotide, pyrophosphate; HET: NMN; 1.80A {Homo sapiens} PDB: 3dgr_A* 3dhd_A* 3dkj_A* 3dkl_A* 2gvj_A* 2gvg_A* 2e5b_A 2e5c_A* 2e5d_A 2h3d_A* 2gvl_A 2h3b_A 2g95_A 2g96_A* 2g97_A* 3g8e_A* Back     alignment and structure
>2i1o_A Nicotinate phosphoribosyltransferase; ZIN ION, zinc finger motif, structural genomics, PSI, protein structure initiative; 2.40A {Thermoplasma acidophilum} PDB: 1ytd_A* 1yte_A* 1ytk_A Back     alignment and structure
>2i14_A Nicotinate-nucleotide pyrophosphorylase; ligand binding, phosphoribosylpyrophosphate, Zn metal ION, structural genomics, PSI; HET: PCP; 2.90A {Pyrococcus furiosus} SCOP: c.1.17.1 d.41.2.1 Back     alignment and structure
>2jbm_A Nicotinate-nucleotide pyrophosphorylase; NAD, enzyme, metabolism, transferase, polymorphism, glycosyltransferase, pyridine nucleotide biosynthesis; HET: SRT; 2.0A {Homo sapiens} Back     alignment and structure
>2b7n_A Probable nicotinate-nucleotide pyrophosphorylase; quinolinate phosphoribosyltransferase, quinolinic acid; HET: NTM; 2.30A {Helicobacter pylori} PDB: 2b7p_A* 2b7q_A* Back     alignment and structure
>1qpo_A Quinolinate acid phosphoribosyl transferase; type II prtase, de novo NAD biosynthesis, PRPP, quinolinic acid; 2.40A {Mycobacterium tuberculosis H37RV} SCOP: c.1.17.1 d.41.2.1 PDB: 1qpn_A 1qpq_A* 1qpr_A* Back     alignment and structure
>3gnn_A Nicotinate-nucleotide pyrophosphorylase; decode biostructures, ssgcid, niaid, SBRI, UWPPG, glycosyltransferase, transferase, structural genomics; 2.25A {Burkholderia pseudomallei} Back     alignment and structure
>3paj_A Nicotinate-nucleotide pyrophosphorylase, carboxyl; TIM barrel, pyridin dicarboxylate, 5-phospho-alpha-D-ribose 1-diphosphate; 2.00A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>1qap_A Quinolinic acid phosphoribosyltransferase; glycosyltransferase, NAD biosynthesis; HET: NTM; 2.80A {Salmonella typhimurium} SCOP: c.1.17.1 d.41.2.1 Back     alignment and structure
>3l0g_A Nicotinate-nucleotide pyrophosphorylase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography; 2.05A {Ehrlichia chaffeensis} Back     alignment and structure
>3c2e_A Nicotinate-nucleotide pyrophosphorylase; qprtase, prtase, BNA6, mechanism, cytoplasm, glycosyltransferase, nucleus; 1.90A {Saccharomyces cerevisiae} PDB: 3c2f_A* 3c2o_A* 3c2v_A* 3c2r_A* Back     alignment and structure
>1x1o_A Nicotinate-nucleotide pyrophosphorylase; transferase, structural genomics, NPPSFA; 1.90A {Thermus thermophilus HB8} Back     alignment and structure
>1o4u_A Type II quinolic acid phosphoribosyltransferase; TM1645, structural genomics, JCSG, PSI, protein structure initiative; 2.50A {Thermotoga maritima} SCOP: c.1.17.1 d.41.2.1 Back     alignment and structure
>3os4_A Naprtase, nicotinate phosphoribosyltransferase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel; HET: MSE; 1.60A {Yersinia pestis} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 418 nicotinate phosphoribosyltransferase [Candidatus Liberi
d1ybea1266 c.1.17.2 (A:168-433) Nicotinate phosphoribosyltransfera 2e-82
d1yira1255 c.1.17.2 (A:145-399) Nicotinate phosphoribosyltransfera 7e-65
d1vlpa2266 c.1.17.2 (A:150-415) Nicotinate phosphoribosyltransfera 4e-60
d1ytda1270 c.1.17.1 (A:120-389) Nicotinate phosphoribosyltransfera 6e-27
d2f7fa1 345 c.1.17.1 (A:141-485) Putative nicotinate phosphoribosyl 2e-25
d2i14a1279 c.1.17.1 (A:111-389) Nicotinate-nucleotide pyrophosphor 5e-19
d1ybea2160 d.41.2.2 (A:8-167) Nicotinate phosphoribosyltransferase 3e-42
d1vlpa1149 d.41.2.2 (A:1-149) Nicotinate phosphoribosyltransferase 4e-33
d1yira2141 d.41.2.2 (A:4-144) Nicotinate phosphoribosyltransferase 1e-31
d2f7fa2137 d.41.2.1 (A:4-140) Putative nicotinate phosphoribosyltr 1e-18
d1ytda2119 d.41.2.1 (A:1-119) Nicotinate phosphoribosyltransferase 5e-05
d2i14a2110 d.41.2.1 (A:1-110) Nicotinate-nucleotide pyrophosphoryl 0.001
>d1ybea1 c.1.17.2 (A:168-433) Nicotinate phosphoribosyltransferase, C-terminal domain {Agrobacterium tumefaciens [TaxId: 358]} Length = 266 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Nicotinate/Quinolinate PRTase C-terminal domain-like
family: Monomeric nicotinate phosphoribosyltransferase C-terminal domain
domain: Nicotinate phosphoribosyltransferase, C-terminal domain
species: Agrobacterium tumefaciens [TaxId: 358]
 Score =  300 bits (769), Expect = 2e-82
 Identities = 158/260 (60%), Positives = 200/260 (76%)

Query: 154 FSVDLLYAQAKKKLWSKIIKLKNFSGLKIVDFGTRRRHSLTWQKWCIEALQEGIKDSFLG 213
           F++D+LYA+AK K+W K+ +L+   GL+I DFGTRRRHS  WQ+WC+EAL+EGI  +F G
Sbjct: 3   FTLDVLYARAKAKMWEKVERLRELPGLRISDFGTRRRHSFLWQRWCVEALKEGIGPAFTG 62

Query: 214 TSNALLAMNYKINAIGTSAHELPMVAAAITRTDIETQNAPYQMMQQWNRLYDDNLLIVLP 273
           TSN LLAM+  + A+GT+AHELPMV AA+ +T+ E   APYQ+++ WNRLY  NLLIVLP
Sbjct: 63  TSNVLLAMDSDLEAVGTNAHELPMVVAALAQTNEELAAAPYQVLKDWNRLYGGNLLIVLP 122

Query: 274 DSFGTDFFLEHAPSWMTQWKGFRHDSASPIEGGEKIIAWWKKMNCNPQNKFLVFSDNLDV 333
           D+FGT  FL +AP W+  W GFR DSA PIEGGEKII WW+KM  +P+ K L+FSD LDV
Sbjct: 123 DAFGTAAFLRNAPEWVADWTGFRPDSAPPIEGGEKIIEWWRKMGRDPRTKMLIFSDGLDV 182

Query: 334 DSIIYTYKHFENRVQMIFGWGTNLTNDFDGCTPYQNLQTEKLQIVCKVTKANDKHAVKLS 393
           D+I+ TY+HFE RV+M FGWGTNLTNDF GC P      + + IVCKV+ AN + AVKLS
Sbjct: 183 DAIVDTYRHFEGRVRMSFGWGTNLTNDFAGCAPKTIASLKPISIVCKVSDANGRPAVKLS 242

Query: 394 DDPAKTTGDISEIKRYLKIF 413
           D+P K TGD +E++RYLK F
Sbjct: 243 DNPQKATGDPAEVERYLKFF 262


>d1yira1 c.1.17.2 (A:145-399) Nicotinate phosphoribosyltransferase, C-terminal domain {Pseudomonas aeruginosa [TaxId: 287]} Length = 255 Back     information, alignment and structure
>d1vlpa2 c.1.17.2 (A:150-415) Nicotinate phosphoribosyltransferase, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 266 Back     information, alignment and structure
>d1ytda1 c.1.17.1 (A:120-389) Nicotinate phosphoribosyltransferase Ta1145 {Thermoplasma acidophilum [TaxId: 2303]} Length = 270 Back     information, alignment and structure
>d2f7fa1 c.1.17.1 (A:141-485) Putative nicotinate phosphoribosyltransferase EF2626 {Enterococcus faecalis [TaxId: 1351]} Length = 345 Back     information, alignment and structure
>d2i14a1 c.1.17.1 (A:111-389) Nicotinate-nucleotide pyrophosphorylase PF1904 {Pyrococcus furiosus [TaxId: 2261]} Length = 279 Back     information, alignment and structure
>d1ybea2 d.41.2.2 (A:8-167) Nicotinate phosphoribosyltransferase, N-terminal domain {Agrobacterium tumefaciens [TaxId: 358]} Length = 160 Back     information, alignment and structure
>d1vlpa1 d.41.2.2 (A:1-149) Nicotinate phosphoribosyltransferase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 149 Back     information, alignment and structure
>d1yira2 d.41.2.2 (A:4-144) Nicotinate phosphoribosyltransferase, N-terminal domain {Pseudomonas aeruginosa [TaxId: 287]} Length = 141 Back     information, alignment and structure
>d2f7fa2 d.41.2.1 (A:4-140) Putative nicotinate phosphoribosyltransferase EF2626 {Enterococcus faecalis [TaxId: 1351]} Length = 137 Back     information, alignment and structure
>d1ytda2 d.41.2.1 (A:1-119) Nicotinate phosphoribosyltransferase Ta1145 {Thermoplasma acidophilum [TaxId: 2303]} Length = 119 Back     information, alignment and structure
>d2i14a2 d.41.2.1 (A:1-110) Nicotinate-nucleotide pyrophosphorylase PF1904 {Pyrococcus furiosus [TaxId: 2261]} Length = 110 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target418 nicotinate phosphoribosyltransferase [Candidatus Liberi
d1ybea1266 Nicotinate phosphoribosyltransferase, C-terminal domain 100.0
d1yira1255 Nicotinate phosphoribosyltransferase, C-terminal domain 100.0
d1vlpa2266 Nicotinate phosphoribosyltransferase, C-terminal domain 100.0
d2f7fa1 345 Putative nicotinate phosphoribosyltransferase EF2626 {E 100.0
d1ytda1270 Nicotinate phosphoribosyltransferase Ta1145 {Thermoplas 100.0
d2i14a1279 Nicotinate-nucleotide pyrophosphorylase PF1904 {Pyrococ 100.0
d1ybea2160 Nicotinate phosphoribosyltransferase, N-terminal domain 100.0
d1vlpa1149 Nicotinate phosphoribosyltransferase, N-terminal domain 100.0
d1yira2141 Nicotinate phosphoribosyltransferase, N-terminal domain 100.0
d2f7fa2137 Putative nicotinate phosphoribosyltransferase EF2626 {E 100.0
d1ytda2119 Nicotinate phosphoribosyltransferase Ta1145 {Thermoplas 99.86
d2i14a2110 Nicotinate-nucleotide pyrophosphorylase PF1904 {Pyrococ 99.77
>d1ybea1 c.1.17.2 (A:168-433) Nicotinate phosphoribosyltransferase, C-terminal domain {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Nicotinate/Quinolinate PRTase C-terminal domain-like
family: Monomeric nicotinate phosphoribosyltransferase C-terminal domain
domain: Nicotinate phosphoribosyltransferase, C-terminal domain
species: Agrobacterium tumefaciens [TaxId: 358]
Probab=100.00  E-value=0  Score=598.96  Aligned_cols=265  Identities=60%  Similarity=1.106  Sum_probs=257.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHCCCCEEHHHHHHHHHHCCCCCCCCCC
Q ss_conf             66799999999999998777674269975998424434797889999999984212120124788999972898767520
Q gi|254780455|r  153 PFSVDLLYAQAKKKLWSKIIKLKNFSGLKIVDFGTRRRHSLTWQKWCIEALQEGIKDSFLGTSNALLAMNYKINAIGTSA  232 (418)
Q Consensus       153 ~~~~~~~~~~~~~~~~~k~~~~~~~~~~~l~eFG~RR~~s~~~q~~~v~~~raa~~~gf~GTSNv~aa~~~gi~~~GTma  232 (418)
                      ++.++.+++.+..++++|++++++++|++++|||+|||||++||++++.++|+++++||+|||||++|++|||||+||||
T Consensus         2 ~~~~~~~~~~~~~~~~~K~~rlr~~~g~~~~eFG~RRa~~~~~~~~~~~a~raa~~ggf~gTSNV~aa~~~gip~~GTmA   81 (266)
T d1ybea1           2 YFTLDVLYARAKAKMWEKVERLRELPGLRISDFGTRRRHSFLWQRWCVEALKEGIGPAFTGTSNVLLAMDSDLEAVGTNA   81 (266)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHTTCTTCCEEECCTTTCSCHHHHHHHHHHHHHHHGGGEEEESBHHHHHHHTCCBCCCCC
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCHHHHHHHCCCCCCCCCH
T ss_conf             52189999999999999999997078997986068776885168999999999820787521478999975999776533


Q ss_pred             HHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHHHHCCCCEEECCCCCHHHHHHHHHHH
Q ss_conf             48987640012203678654999999999963988659863468989999989973100243412888878999999999
Q gi|254780455|r  233 HELPMVAAAITRTDIETQNAPYQMMQQWNRLYDDNLLIVLPDSFGTDFFLEHAPSWMTQWKGFRHDSASPIEGGEKIIAW  312 (418)
Q Consensus       233 Hs~v~a~~~~~~~~~~~~~~~~~a~~~~~~~yp~~~~i~L~DTy~~~~~l~~~~~~~~~~~GVR~DSGD~~~~~~k~~~~  312 (418)
                      |||||+|+++.+.+.+++++|..||++|+++||++++|+|+|||++++|++++.++.+++.|||||||||.++++++|++
T Consensus        82 Hs~v~~~~~l~~~~~~~~~~e~~Af~~~~~~yp~~~~i~L~DT~~~~~~~~~~~~~~~~~~GVRlDSGDl~~ls~~~r~~  161 (266)
T d1ybea1          82 HELPMVVAALAQTNEELAAAPYQVLKDWNRLYGGNLLIVLPDAFGTAAFLRNAPEWVADWTGFRPDSAPPIEGGEKIIEW  161 (266)
T ss_dssp             THHHHHHHHHCCSHHHHHHHHHHHHHHHHHHCCGGGCEECCCTTCHHHHHHTCCGGGGGSSEECCCSSCHHHHHHHHHHH
T ss_pred             HHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHCCCCCEEEECCCCCHHHHHHHHHHHHCCCCCEEECCCCHHHHHHHHHHH
T ss_conf             78999877642430889998999999999977997368842756589999988886266654550899828899999999


Q ss_pred             HHHCCCCCCCEEEEECCCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCEEEEEEEECCCCEEEE
Q ss_conf             99779881130899738989999999999724897378633464314656666665567773216898575768111673
Q gi|254780455|r  313 WKKMNCNPQNKFLVFSDNLDVDSIIYTYKHFENRVQMIFGWGTNLTNDFDGCTPYQNLQTEKLQIVCKVTKANDKHAVKL  392 (418)
Q Consensus       313 l~~~Gidp~~k~iv~Sd~Ld~e~i~~l~~~~~~~~~~~fGIGT~Lt~d~~~~~~~~~~~~~~l~~VyKlve~~g~P~~Kl  392 (418)
                      ||++|++|.+|+||+||||||++|..|+++++++++++|||||+||||+.+..+.|+.++|+||+||||||+||+||||+
T Consensus       162 ld~~G~~p~~~~Iv~S~~LDe~~i~~l~~~~~g~~~d~fGVGT~L~~~~~~~~~~t~~~~p~l~~VyKLve~~g~P~~Kl  241 (266)
T d1ybea1         162 WRKMGRDPRTKMLIFSDGLDVDAIVDTYRHFEGRVRMSFGWGTNLTNDFAGCAPKTIASLKPISIVCKVSDANGRPAVKL  241 (266)
T ss_dssp             HHHTTCCGGGSEEEECTTCCHHHHHHHHHHHTTTSEEEEEECHHHHCCCTTCCC-----CCCCCEEEEEEEETTEECCBC
T ss_pred             HHHCCCCCCCCEEEEECCCCHHHHHHHHHHHCCCCCEEEECCCEEECCCCCCCCCCCCCCCCCCEEEEEEEECCEEEEEE
T ss_conf             99829997884799979999999999999854673301210400012567777664456887546987520398644673


Q ss_pred             ECCCCCCCCCHHHHHHHHHHCCCCC
Q ss_conf             2688752488899999999809666
Q gi|254780455|r  393 SDDPAKTTGDISEIKRYLKIFKIKK  417 (418)
Q Consensus       393 Sd~~~K~tg~~~~~~~~~~~~~~~~  417 (418)
                      ||+++|+|||++.|++|+|+|+.++
T Consensus       242 Sd~~~K~tg~~~~~~~~~r~~g~~~  266 (266)
T d1ybea1         242 SDNPQKATGDPAEVERYLKFFGEED  266 (266)
T ss_dssp             CSSGGGCBSCHHHHHHHHHHHCCCC
T ss_pred             CCCCCCCCCCHHHHHHHHHHHCCCC
T ss_conf             4898665699899999999736799



>d1yira1 c.1.17.2 (A:145-399) Nicotinate phosphoribosyltransferase, C-terminal domain {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1vlpa2 c.1.17.2 (A:150-415) Nicotinate phosphoribosyltransferase, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2f7fa1 c.1.17.1 (A:141-485) Putative nicotinate phosphoribosyltransferase EF2626 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1ytda1 c.1.17.1 (A:120-389) Nicotinate phosphoribosyltransferase Ta1145 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2i14a1 c.1.17.1 (A:111-389) Nicotinate-nucleotide pyrophosphorylase PF1904 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ybea2 d.41.2.2 (A:8-167) Nicotinate phosphoribosyltransferase, N-terminal domain {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1vlpa1 d.41.2.2 (A:1-149) Nicotinate phosphoribosyltransferase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yira2 d.41.2.2 (A:4-144) Nicotinate phosphoribosyltransferase, N-terminal domain {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2f7fa2 d.41.2.1 (A:4-140) Putative nicotinate phosphoribosyltransferase EF2626 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1ytda2 d.41.2.1 (A:1-119) Nicotinate phosphoribosyltransferase Ta1145 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2i14a2 d.41.2.1 (A:1-110) Nicotinate-nucleotide pyrophosphorylase PF1904 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 418 nicotinate phosphoribosyltransferase [Candidatus L
1ybe_A_1-50_167-381265 (A:1-50,A:167-381) Naprtase, nicotinate phosphorib 2e-55
1yir_A_1-35_145-352243 (A:1-35,A:145-352) Naprtase 2, nicotinate phosphor 7e-47
3dhf_A_147-389243 (A:147-389) Nicotinamide phosphoribosyltransferase 7e-37
2i1o_A_109-303195 (A:109-303) Nicotinate phosphoribosyltransferase; 1e-25
2f7f_A_126-323198 (A:126-323) Nicotinate phosphoribosyltransferase, 4e-24
2i14_A_105-300196 (A:105-300) Nicotinate-nucleotide pyrophosphorylas 3e-20
1ybe_A_1-50_167-381265 (A:1-50,A:167-381) Naprtase, nicotinate phosphorib 9e-09
1yir_A_1-35_145-352243 (A:1-35,A:145-352) Naprtase 2, nicotinate phosphor 2e-08
2im5_A_243-33896 (A:243-338) Nicotinate phosphoribosyltransferase; 2e-34
1vlp_A_275-376102 (A:275-376) Naprtase, nicotinate phosphoribosyltra 1e-21
1ybe_A_51-166_382-412147 (A:51-166,A:382-412) Naprtase, nicotinate phosphor 1e-26
1vlp_A_27-162_377-407167 (A:27-162,A:377-407) Naprtase, nicotinate phosphor 2e-24
2im5_A_26-138_339-372147 (A:26-138,A:339-372) Nicotinate phosphoribosyltran 2e-20
3dhf_A_1-146_390-484241 (A:1-146,A:390-484) Nicotinamide phosphoribosyltra 2e-20
2f7f_A_1-125_324-354156 (A:1-125,A:324-354) Nicotinate phosphoribosyltrans 5e-20
1yir_A_36-144_353-408165 (A:36-144,A:353-408) Naprtase 2, nicotinate phosph 2e-18
1yir_A_36-144_353-408165 (A:36-144,A:353-408) Naprtase 2, nicotinate phosph 4e-09
1vlp_A_1-26_163-240104 (A:1-26,A:163-240) Naprtase, nicotinate phosphorib 2e-17
2im5_A_1-25_139-20996 (A:1-25,A:139-209) Nicotinate phosphoribosyltransf 1e-15
>1ybe_A (A:1-50,A:167-381) Naprtase, nicotinate phosphoribosyltransferase; structural genomics, protein structure initiative, NYSGXRC, PSI; 2.50A {Agrobacterium tumefaciens}Length = 265 Back     alignment and structure
 Score =  210 bits (536), Expect = 2e-55
 Identities = 133/222 (59%), Positives = 169/222 (76%), Gaps = 3/222 (1%)

Query: 147 TVRSMNPF---SVDLLYAQAKKKLWSKIIKLKNFSGLKIVDFGTRRRHSLTWQKWCIEAL 203
            +  + P    ++D+LYA+AK K+W K+ +L+   GL+I DFGTRRRHS  WQ+WC+EAL
Sbjct: 44  MIWKLYPLGYFTLDVLYARAKAKMWEKVERLRELPGLRISDFGTRRRHSFLWQRWCVEAL 103

Query: 204 QEGIKDSFLGTSNALLAMNYKINAIGTSAHELPMVAAAITRTDIETQNAPYQMMQQWNRL 263
           +EGI  +F GTSN LLAM+  + A+GT+AHELPMV AA+ +T+ E   APYQ+++ WNRL
Sbjct: 104 KEGIGPAFTGTSNVLLAMDSDLEAVGTNAHELPMVVAALAQTNEELAAAPYQVLKDWNRL 163

Query: 264 YDDNLLIVLPDSFGTDFFLEHAPSWMTQWKGFRHDSASPIEGGEKIIAWWKKMNCNPQNK 323
           Y  NLLIVLPD+FGT  FL +AP W+  W GFR DSA PIEGGEKII WW+KM  +P+ K
Sbjct: 164 YGGNLLIVLPDAFGTAAFLRNAPEWVADWTGFRPDSAPPIEGGEKIIEWWRKMGRDPRTK 223

Query: 324 FLVFSDNLDVDSIIYTYKHFENRVQMIFGWGTNLTNDFDGCT 365
            L+FSD LDVD+I+ TY+HFE RV+M FGWGTNLTNDF GC 
Sbjct: 224 MLIFSDGLDVDAIVDTYRHFEGRVRMSFGWGTNLTNDFAGCA 265


>1yir_A (A:1-35,A:145-352) Naprtase 2, nicotinate phosphoribosyltransferase 2; structural genomics, protein structure initiative, hypothetical protein, NYSGXRC, PSI; 2.10A {Pseudomonas aeruginosa}Length = 243 Back     alignment and structure
>3dhf_A (A:147-389) Nicotinamide phosphoribosyltransferase; NMPRTASE, NAMPRTASE, visfatin, beryllium fluoride, nicotinamide D-ribonucleotide, pyrophosphate; HET: NMN; 1.80A {Homo sapiens} PDB: 3dgr_A* 3dhd_A* 3dkj_A* 3dkl_A* 2gvj_A* 2gvg_A* 2e5b_A 2e5c_A* 2e5d_A 2h3d_A* 2gvl_A 2h3b_A 2g95_A 2g96_A* 2g97_A* 3g8e_A*Length = 243 Back     alignment and structure
>2i1o_A (A:109-303) Nicotinate phosphoribosyltransferase; ZIN ION, zinc finger motif, structural genomics, PSI, protein structure initiative; 2.40A {Thermoplasma acidophilum} PDB: 1ytd_A* 1yte_A* 1ytk_ALength = 195 Back     alignment and structure
>2f7f_A (A:126-323) Nicotinate phosphoribosyltransferase, putative; structural genomics, PSI, protein structure initiative; 2.00A {Enterococcus faecalis V583}Length = 198 Back     alignment and structure
>2i14_A (A:105-300) Nicotinate-nucleotide pyrophosphorylase; ligand binding, phosphoribosylpyrophosphate, Zn metal ION, structural genomics, PSI; HET: PCP; 2.90A {Pyrococcus furiosus}Length = 196 Back     alignment and structure
>1ybe_A (A:1-50,A:167-381) Naprtase, nicotinate phosphoribosyltransferase; structural genomics, protein structure initiative, NYSGXRC, PSI; 2.50A {Agrobacterium tumefaciens}Length = 265 Back     alignment and structure
>1yir_A (A:1-35,A:145-352) Naprtase 2, nicotinate phosphoribosyltransferase 2; structural genomics, protein structure initiative, hypothetical protein, NYSGXRC, PSI; 2.10A {Pseudomonas aeruginosa}Length = 243 Back     alignment and structure
>2im5_A (A:243-338) Nicotinate phosphoribosyltransferase; structural genomics, NYSGXRC, PSI, protein structure initiative; 2.20A {Porphyromonas gingivalis}Length = 96 Back     alignment and structure
>1vlp_A (A:275-376) Naprtase, nicotinate phosphoribosyltransferase; YOR209C, structural genomics, JCSG, protein structure initiative, PSI; HET: MSE MES; 1.75A {Saccharomyces cerevisiae}Length = 102 Back     alignment and structure
>1ybe_A (A:51-166,A:382-412) Naprtase, nicotinate phosphoribosyltransferase; structural genomics, protein structure initiative, NYSGXRC, PSI; 2.50A {Agrobacterium tumefaciens}Length = 147 Back     alignment and structure
>1vlp_A (A:27-162,A:377-407) Naprtase, nicotinate phosphoribosyltransferase; YOR209C, structural genomics, JCSG, protein structure initiative, PSI; HET: MSE MES; 1.75A {Saccharomyces cerevisiae}Length = 167 Back     alignment and structure
>2im5_A (A:26-138,A:339-372) Nicotinate phosphoribosyltransferase; structural genomics, NYSGXRC, PSI, protein structure initiative; 2.20A {Porphyromonas gingivalis}Length = 147 Back     alignment and structure
>3dhf_A (A:1-146,A:390-484) Nicotinamide phosphoribosyltransferase; NMPRTASE, NAMPRTASE, visfatin, beryllium fluoride, nicotinamide D-ribonucleotide, pyrophosphate; HET: NMN; 1.80A {Homo sapiens} PDB: 3dgr_A* 3dhd_A* 3dkj_A* 3dkl_A* 2gvj_A* 2gvg_A* 2e5b_A 2e5c_A* 2e5d_A 2h3d_A* 2gvl_A 2h3b_A 2g95_A 2g96_A* 2g97_A* 3g8e_A*Length = 241 Back     alignment and structure
>2f7f_A (A:1-125,A:324-354) Nicotinate phosphoribosyltransferase, putative; structural genomics, PSI, protein structure initiative; 2.00A {Enterococcus faecalis V583}Length = 156 Back     alignment and structure
>1yir_A (A:36-144,A:353-408) Naprtase 2, nicotinate phosphoribosyltransferase 2; structural genomics, protein structure initiative, hypothetical protein, NYSGXRC, PSI; 2.10A {Pseudomonas aeruginosa}Length = 165 Back     alignment and structure
>1yir_A (A:36-144,A:353-408) Naprtase 2, nicotinate phosphoribosyltransferase 2; structural genomics, protein structure initiative, hypothetical protein, NYSGXRC, PSI; 2.10A {Pseudomonas aeruginosa}Length = 165 Back     alignment and structure