254780468

254780468

sensory box/GGDEF family protein

GeneID in NCBI database:8209456Locus tag:CLIBASIA_01765
Protein GI in NCBI database:254780468Protein Accession:YP_003064881.1
Gene range:-(389058, 391949)Protein Length:963aa
Gene description:sensory box/GGDEF family protein
COG prediction:[T] FOG: PAS/PAC domain
KEGG prediction:sensory box/GGDEF family protein
SEED prediction:Sensory box/GGDEF domain/EAL domain protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM8 TM-Helix
TOPPRED10 TM-Helix
HMMTOP7 TM-Helix
MEMSAT5 TM-Helix
MEMSAT_SVM4 TM-Helix
PHOBIUS8 TM-Helix
SignalP_HMMyes
SignalP_NNyes
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960---
MLLSNSLRSHFEKAFLILVLFLLWMVSPSFAIEPINISSSDRVLDLTSITRIYVNQGEDFQVFTAADIDGISRRIEVSASSIRHRGDWAVFALANTSDSQLERLIVVPHYRLVGSHFFSPDLGSRRIISVTPSEGFSLDRIPNSDSDVFRITINPGAVVTFIMEISTPNLPQIYLWEPNFYKDTVNSFTLYRGIIIGVASLLAIFLTIFYMVNRSSMLIPTFAMAWVVLGYISIDFGFLSKLVNLPSGELLIWRACSEIALSSSLIIFLFMYLHWNRWHAKVGYITFSGIACIAILFCMSFYYPMVTASIARITLASIVLYYTYFIIYHGMKGYERAVLLIPAWILIFIWFIGLWMAITKRLDNDIIQPALVGGLVLIVILIGFTVIQHVLATGYFSQGIFSDGERQSLAVLGSGDIVWDWDIVRDRVTTTPDIATILGLASGSMHGPIRNWLPYIHINDRDNFRTILDSFVGYRRGRLQYEFRVRAADNQFHWMIIRIRPMSNSNGDILRYIGIANDITEQKKSLEGILCNAFQDNLTGIPNRQSFLDRLTTILDLSATDDNLRPTVMVIDIDKYKKINDVLGIAVGDDVLVSLTRRIGELLKFPDILARLSGNRFGIILISENNSLKIADFAIAMRKSIAMPINLLEREITVTASIGFASWTSSKITSSEMLKNAELAMYHAKHRGGNHVESFRVSSFRSDRVMIKEDLCLAVENSELYLVYHPIIRLMDEEIVGLEALIQWDHPKWGNISSSEFMLIAEELCMIKAINLFMLERIARDIISWRDQANMPPIFILINIASKDLLDNELCEGMQALISKTLYSPSRIKLSFSESVVMGNPERSRLLLGRLRKIGISLTLDDFGTKCSLLSYLGYIPFDTVKFNGSLMTGSTEKRIAILRSIIPMAKNIETTIIAKDIYGEIDIKELTRMGCDYIQDSHVASPLGFNSILKLLKERFPLVKNT
cccHHHHHHHHHHHHHHHHHHHHHHccHHHccccEEEccccccccHHHHHHEEEccccEEEEEEccccccEEEEEEEEEccccccccEEEEEEccccHHHHHEEEEcccEEEEccccccccccccEEEEEcccccccccccccccccEEEEEEccccEEEEEEEcccccccEEEEEccHHHHcccccEEEEccHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHcHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEEEEHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEcccHHHHHcccccEEEEEEcccccEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEccccEEEEcHHHHHHccccHHHHcccHHHHHHHcccccHHHHHHHHHHHHHccccEEEEEEEEEcccccEEEEEEEEEEEcccccccccHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEcccHHHHHHHcccHHHHHHHHHHHHHHHHHccccccEEEEEcccEEEEEEcccccHHHHHHHHHHHHHHHcccEEEccEEEEEEEEEEEEEEccccccHHHHHHHHHHHHHHHHccccEEEEEEccHHHHHcccHHHHHHHHHHccccEEEEEEEEEEcccccEEEEEEEEEEEcccccEEcHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEccHHHcccHHHHHHHHHHHHHccccccEEEEEEEHHHHHccHHHHHHHHHHHHHcccEEEEccccccccHHHHHHHccccEEEEcHHHHccccHHHHHHHHHHHHHHHHcccEEEEEEcccHHHHHHHHHccccEEEcccccccccHHHHHHHHHHcccccccc
ccccHHHHHHHHHHHHHHHHHHHHcccccccccEEEEcccHHHHHHHHHHHHHHcccccEEEEEcccccccEEEEEEcHHHHHHccHHHHHHHcccccHHHccccccccHHHccccccccccccccEEEEcccccccccccccccccEEEEEcccccEEEEEEEccccccccEEEccHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccccHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHcccHHHHHHHHHHHHHHHHHHccccHHHHHHHHcccHEEEEEEEcHEHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEcccccEEEEcHHHHHHHcccHHHHHcccHHHHHHccHccHHHHHHHHHHHHHcccccEEEEEEEEcccccEEEEEEEEEEEEcccccEEEEEEEEccHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHcccccEEEEEEEcHcccccccccccHHHHHHHHHHHHHHHHHcccccEEEEccccEEEEEEcccccHHHHHHHHHHHHHHHcccEEEcccEEEEEEEEEEEEcccccccHHHHHHHHHHHHHHHHHcccccEEEccHHHHHHHHHHHHHHHHHHHHcccEEEEEEcEEEcccccEEEEEEEEEccccccccccHHHHHHHHHHcccEEEHHHHHHHHHHHHHHHHHHHccccccEEEEEEcHHHHccccHHHHHHHHHHHccccHccEEEEEEHHHHcccHHHHHHHHHHHHHcccEEEEEcccccHcHHHHHHcccccEEEEccHHHccccccHHHHHHHHHHHHHHcccEEEEEccccHHHHHHHHHcccccEEEEEEcccccHHHHHHHHHHcccccccc
mllsnslrSHFEKAFLILVLFLLWmvspsfaiepinisssdrvldlTSITRIYVnqgedfqvftaadidgISRRIEVSassirhrgdWAVFALANtsdsqlerlivvphyrlvgshffspdlgsrriisvtpsegfsldripnsdsdvfritinpGAVVTFIMEistpnlpqiylwepnfykdtvnSFTLYRGIIIGVASLLAIFLTIFYMVNRSSMLIPTFAMAWVVLGYISIDFGFLsklvnlpsgelLIWRACSEIALSSSLIIFLFMYLHWNRWHAKVGYITFSGIACIAILFCMSFYYPMVTASIARITLASIVLYYTYFIIYHGMKGYERAVLLIPAWILIFIWFIGLWMAITKRldndiiqpaLVGGLVLIVILIGFTVIQHVLATgyfsqgifsdgerqslavlgsgdivwdwdivrdrvtttpDIATILGLasgsmhgpirnwlpyihindrdnfRTILDSFVGYRRGRLQYEFRVRAADNQFHWMIIRirpmsnsngdiLRYIGIANDITEQKKSLEGILCNAfqdnltgipnrQSFLDRLTTILDlsatddnlrptvmvIDIDKYKKINDVLGIAVGDDVLVSLTRRIGELLKFPDILARLSGNRFGIILisennslkIADFAIAMRKSIAMPINLLEREITVTASIGfaswtsskitsSEMLKNAELAMYHAkhrggnhvesfrvssfrsdrvmIKEDLCLAVENSELYLVYHPIIRLMDEEIVGLEALiqwdhpkwgnisssEFMLIAEELCMIKAINLFMLERIARDIISwrdqanmppiFILINIASKDLLDNELCEGMQALISktlyspsriklsfsesvvmgnperSRLLLGRLRKIGISltlddfgtkcsllsylgyipfdtvkfngslmtgstEKRIAILRSIIPMAKNIETTIIAKdiygeidiKELTRMgcdyiqdshvasplgFNSILKLLKErfplvknt
mllsnslrSHFEKAFLILVLFLLWMVSPSFAIEpinisssdrvLDLTSITRIyvnqgedfqvftaadidgisRRIEVSASSIRHRGDWAVFALANTSDSQLERLIVVPHYRLVGShffspdlgsrrIISVTpsegfsldripnsdsdvfRITINPGAVVTFIMEISTPNLPQIYLWEPNFYKDTVNSFTLYRGIIIGVASLLAIFLTIFYMVNRSSMLIPTFAMAWVVLGYISIDFGFLSKLVNLPSGELLIWRACSEIALSSSLIIFLFMYLHWNRWHAKVGYITFSGIACIAILFCMSFYYPMVTASIARITLASIVLYYTYFIIYHGMKGYERAVLLIPAWILIFIWFIGLWMAITKRLDNDIIQPALVGGLVLIVILIGFTVIQHVLATGYFSQGIFSDGERQSLAVLGSGDIVWDWDIVRDRVTTTPDIATILGlasgsmhgpIRNWLPYIHINDRDNFRTILDSFVGYRRGRLQYEFRVRAADNQFHWMIIRirpmsnsngDILRYIGIANDITEQKKSLEGILCNAFQDNLTGIPNRQSFLDRLTTILDlsatddnlrptvMVIDidkykkindvlgiavGDDVLVSLTRRIGELLKFPDILARLSGNRFGIILISENNSLKIADFAIAMRKSIAMPINLLEREITVTASIGFASWTSSKITSSEMLKNAELAMYHAKhrggnhvesfrvssfrsdRVMIKEDLCLAVENSELYLVYHPIIRLMDEEIVGLEALIQWDHPKWGNISSSEFMLIAEELCMIKAINLFMLERIARDIISWRDQANMPPIFILINIASKDLLDNELCEGMQALIsktlyspsRIKLSfsesvvmgnpeRSRLLLGRLRKIGISLTLDDFGTKCSLLSYLGYIPFDTVKFNGSLMTGSTEKRIAILRSIIPMAKNIETTIIAKDIYGEIDIKELTRMGCDYIQDSHVASPLGFNSILKLlkerfplvknt
MLLSNSLRSHFEKAFLILVLFLLWMVSPSFAIEPINISSSDRVLDLTSITRIYVNQGEDFQVFTAADIDGISRRIEVSASSIRHRGDWAVFALANTSDSQLERLIVVPHYRLVGSHFFSPDLGSRRIISVTPSEGFSLDRIPNSDSDVFRITINPGAVVTFIMEISTPNLPQIYLWEPNFYKDTVNSFTLYRGIIIGVASLLAIFLTIFYMVNRSSMLIPTFAMAWVVLGYISIDFGFLSKLVNLPSGELLIWRACSEIALSSSLIIFLFMYLHWNRWHAKVGYITFSGIACIAILFCMSFYYPMVTASIARITLASIVLYYTYFIIYHGMKGYERAVLLIPAwilifiwfiglwMAITKRLDNDIIQPAlvgglvliviligFTVIQHVLATGYFSQGIFSDGERQSLAVLGSGDIVWDWDIVRDRVTTTPDIATILGLASGSMHGPIRNWLPYIHINDRDNFRTILDSFVGYRRGRLQYEFRVRAADNQFHWMIIRIRPMSNSNGDILRYIGIANDITEQKKSLEGILCNAFQDNLTGIPNRQSFLDRLTTILDLSATDDNLRPTVMVIDIDKYKKINDVLGIAVGDDVLVSLTRRIGELLKFPDILARLSGNRFGIILISENNSLKIADFAIAMRKSIAMPINLLEREITVTASIGFASWTSSKITSSEMLKNAELAMYHAKHRGGNHVEsfrvssfrsdrvMIKEDLCLAVENSELYLVYHPIIRLMDEEIVGLEALIQWDHPKWGNISSSEFMLIAEELCMIKAINLFMLERIARDIISWRDQANMPPIFILINIASKDLLDNELCEGMQALISKTLYSPSRIKLSFSESVVMGNPErsrlllgrlrkigislTLDDFGTKCSLLSYLGYIPFDTVKFNGSLMTGSTEKRIAILRSIIPMAKNIETTIIAKDIYGEIDIKELTRMGCDYIQDSHVASPLGFNSILKLLKERFPLVKNT
*******RSHFEKAFLILVLFLLWMVSPSFAIEPINISSSDRVLDLTSITRIYVNQGEDFQVFTAADIDGISR**************WAVFALANTSDSQLERLIVVPHYRLVGSHFFSPDLGSRRIISVTPSEGFSLDRIPNSDSDVFRITINPGAVVTFIMEISTPNLPQIYLWEPNFYKDTVNSFTLYRGIIIGVASLLAIFLTIFYMVNRSSMLIPTFAMAWVVLGYISIDFGFLSKLVNLPSGELLIWRACSEIALSSSLIIFLFMYLHWNRWHAKVGYITFSGIACIAILFCMSFYYPMVTASIARITLASIVLYYTYFIIYHGMKGYERAVLLIPAWILIFIWFIGLWMAITKRLDNDIIQPALVGGLVLIVILIGFTVIQHVL***************QSLAVLGSGDIVWDWDIVRDRVTTTPDIATILGLASGSMHGPIRNWLPYIHINDRDNFRTILDSFVGYRRGRLQYEFRVRAADNQFHWMIIRIRPMSNSNGDILRYIGIANDITEQKKSLEGILCNAFQDNLTGIPNRQSFLDRLTTILDLSATDDNLRPTVMVIDIDKYKKINDVLGIAVGDDVLVSLTRRIGELLKFPDILARLSGNRFGIILISENNSLKIADFAIAMRKSIAMPINLLEREITVTASIGFASWTSSKITSSEMLKNAELAMYHAKHRGGNHVESFRVSSFRSDRVMIKEDLCLAVENSELYLVYHPIIRLMDEEIVGLEALIQWDHPKWGNISSSEFMLIAEELCMIKAINLFMLERIARDIISWRDQANMPPIFILINIASKDLLDNELCEGMQALISKTLYSPSRIKLSFSESVVMGNPERSRLLLGRLRKIGISLTLDDFGTKCSLLSYLGYIPFDTVKFNGSLMTGSTEKRIAILRSIIPMAKNIETTIIAKDIYGEIDIKELTRMGCDYIQDSHVASPLGFNSILKLLK**F******
MLLSNSLRSHFEKAFLILVLFLLWMVSPSFAIEPINISSSDRVLDLTSITRIYVNQGEDFQVFTAADIDGISRRIEVSASSIRHRGDWAVFALANTSDSQLERLIVVPHYRLVGSHFFSPDLGSRRIISVTPSEGFSLDRIPNSDSDVFRITINPGAVVTFIMEISTPNLPQIYLWEPNFYKDTVNSFTLYRGIIIGVASLLAIFLTIFYMVNRSSMLIPTFAMAWVVLGYISIDFGFLSKLVNLPSGELLIWRACSEIALSSSLIIFLFMYLHWNRWHAKVGYITFSGIACIAILFCMSFYYPMVTASIARITLASIVLYYTYFIIYHGMKGYERAVLLIPAWILIFIWFIGLWMAITKRLDNDIIQPALVGGLVLIVILIGFTVIQHVLATGYFSQGIFSDGERQSLAVLGSGDIVWDWDIVRDRVTTTPDIATILGLASGSMHGPIRNWLPYIHINDRDNFRTILDSFVGYRRGRLQYEFRVRAADNQFHWMIIRIRPMSNSNGDILRYIGIANDITEQKKSLEGILCNAFQDNLTGIPNRQSFLDRLTTILDLSATDDNLRPTVMVIDIDKYKKINDVLGIAVGDDVLVSLTRRIGELLKFPDILARLSGNRFGIILISENNSLKIADFAIAMRKSIAMPINLLEREITVTASIGFASWTSSKITSSEMLKNAELAMYHAKHRGGNHVESFRVSSFRSDRVMIKEDLCLAVENSELYLVYHPIIRLMDEEIVGLEALIQWDHPKWGNISSSEFMLIAEELCMIKAINLFMLERIARDIISWRDQANMPPIFILINIASKDLLDNELCEGMQALISKTLYSPSRIKLSFSESVVMGNPERSRLLLGRLRKIGISLTLDDFGTKCSLLSYLGYIPFDTVKFNGSLMTGSTEKRIAILRSIIPMAKNIETTIIAKDIYGEIDIKELTRMGCDYIQDSHVASPLGFNSILKLLKERFPLVKNT
MLLSNSLRSHFEKAFLILVLFLLWMVSPSFAIEPINISSSDRVLDLTSITRIYVNQGEDFQVFTAADIDGISRRIEVSASSIRHRGDWAVFALANTSDSQLERLIVVPHYRLVGSHFFSPDLGSRRIISVTPSEGFSLDRIPNSDSDVFRITINPGAVVTFIMEISTPNLPQIYLWEPNFYKDTVNSFTLYRGIIIGVASLLAIFLTIFYMVNRSSMLIPTFAMAWVVLGYISIDFGFLSKLVNLPSGELLIWRACSEIALSSSLIIFLFMYLHWNRWHAKVGYITFSGIACIAILFCMSFYYPMVTASIARITLASIVLYYTYFIIYHGMKGYERAVLLIPAWILIFIWFIGLWMAITKRLDNDIIQPALVGGLVLIVILIGFTVIQHVLATGYFSQGIFSDGERQSLAVLGSGDIVWDWDIVRDRVTTTPDIATILGLASGSMHGPIRNWLPYIHINDRDNFRTILDSFVGYRRGRLQYEFRVRAADNQFHWMIIRIRPMSNSNGDILRYIGIANDITEQKKSLEGILCNAFQDNLTGIPNRQSFLDRLTTILDLSATDDNLRPTVMVIDIDKYKKINDVLGIAVGDDVLVSLTRRIGELLKFPDILARLSGNRFGIILISENNSLKIADFAIAMRKSIAMPINLLEREITVTASIGFASWTSSKITSSEMLKNAELAMYHAKHRGGNHVESFRVSSFRSDRVMIKEDLCLAVENSELYLVYHPIIRLMDEEIVGLEALIQWDHPKWGNISSSEFMLIAEELCMIKAINLFMLERIARDIISWRDQANMPPIFILINIASKDLLDNELCEGMQALISKTLYSPSRIKLSFSESVVMGNPERSRLLLGRLRKIGISLTLDDFGTKCSLLSYLGYIPFDTVKFNGSLMTGSTEKRIAILRSIIPMAKNIETTIIAKDIYGEIDIKELTRMGCDYIQDSHVASPLGFNSILKLLKERFPL****
ooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooHHHHHHHHHHHHHHHHHHiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
MLLSNSLRSHFEKAFLILVLFLLWMVSPSFAIEPINISSSDRVLDLTSITRIYVNQGEDFQVFTAADIDGISRRIEVSASSIRHRGDWAVFALANTSDSQLERLIVVPHYRLVGSHFFSPDLGSRRIISVTPSEGFSLDRIPNSDSDVFRITINPGAVVTFIMEISTPNLPQIYLWEPNFYKDTVNSFTLYRGIIIGVASLLAIFLTIFYMVNRSSMLIPTFAMAWVVLGYISIDFGFLSKLVNLPSGELLIWRACSEIALSSSLIIFLFMYLHWNRWHAKVGYITFSGIACIAILFCMSFYYPMVTASIARITLASIVLYYTYFIIYHGMKGYERAVLLIPAWILIFIWFIGLWMAITKRLDNDIIQPALVGGLVLIVILIGFTVIQHVLATGYFSQGIFSDGERQSLAVLGSGDIVWDWDIVRDRVTTTPDIATILGLASGSMHGPIRNWLPYIHINDRDNFRTILDSFVGYRRGRLQYEFRVRAADNQFHWMIIRIRPMSNSNGDILRYIGIANDITEQKKSLEGILCNAFQDNLTGIPNRQSFLDRLTTILDLSATDDNLRPTVMVIDIDKYKKINDVLGIAVGDDVLVSLTRRIGELLKFPDILARLSGNRFGIILISENNSLKIADFAIAMRKSIAMPINLLEREITVTASIGFASWTSSKITSSEMLKNAELAMYHAKHRGGNHVESFRVSSFRSDRVMIKEDLCLAVENSELYLVYHPIIRLMDEEIVGLEALIQWDHPKWGNISSSEFMLIAEELCMIKAINLFMLERIARDIISWRDQANMPPIFILINIASKDLLDNELCEGMQALISKTLYSPSRIKLSFSESVVMGNPERSRLLLGRLRKIGISLTLDDFGTKCSLLSYLGYIPFDTVKFNGSLMTGSTEKRIAILRSIIPMAKNIETTIIAKDIYGEIDIKELTRMGCDYIQDSHVASPLGFNSILKLLKERFPLVKNT
MLLSNSLRSHFEKAFLILVLFLLWMVSPSFAIEPINISSSDRVLDLTSITRIYVNQGEDFQVFTAADIDGISRRIEVSASSIRHRGDWAVFALANTSDSQLERLIVVPHYRLVGSHFFSPDLGSRRIISVTPSEGFSLDRIPNSDSDVFRITINPGAVVTFIMEISTPNLPQIYLWEPNFYKDTVNSFTLYRGIIIGVASLLAIFLTIFYMVNRSSMLIPTFAMAWVVLGYISIDFGFLSKLVNLPSGELLIWRACSEIALSSSLIIFLFMYLHWNRWHAKVGYITFSGIACIAILFCMSFYYPMVTASIARITLASIVLYYTYFIIYHGMKGYERAVLLIPAWILIFIWFIGLWMAITKRLDNDIIQPALVGGLVLIVILIGFTVIQHVLATGYFSQGIFSDGERQSLAVLGSGDIVWDWDIVRDRVTTTPDIATILGLASGSMHGPIRNWLPYIHINDRDNFRTILDSFVGYRRGRLQYEFRVRAADNQFHWMIIRIRPMSNSNGDILRYIGIANDITEQKKSLEGILCNAFQDNLTGIPNRQSFLDRLTTILDLSATDDNLRPTVMVIDIDKYKKINDVLGIAVGDDVLVSLTRRIGELLKFPDILARLSGNRFGIILISENNSLKIADFAIAMRKSIAMPINLLEREITVTASIGFASWTSSKITSSEMLKNAELAMYHAKHRGGNHVESFRVSSFRSDRVMIKEDLCLAVENSELYLVYHPIIRLMDEEIVGLEALIQWDHPKWGNISSSEFMLIAEELCMIKAINLFMLERIARDIISWRDQANMPPIFILINIASKDLLDNELCEGMQALISKTLYSPSRIKLSFSESVVMGNPERSRLLLGRLRKIGISLTLDDFGTKCSLLSYLGYIPFDTVKFNGSLMTGSTEKRIAILRSIIPMAKNIETTIIAKDIYGEIDIKELTRMGCDYIQDSHVASPLGFNSILKLLKERFPLVKNT
MLLSNSLRSHFEKAFLILVLFLLWMVSPSFAIEPINISSSDRVLDLTSITRIYVNQGEDFQVFTAADIDGISRRIEVSASSIRHRGDWAVFALANTSDSQLERLIVVPHYRLVGSHFFSPDLGSRRIISVTPSEGFSLDRIPNSDSDVFRITINPGAVVTFIMEISTPNLPQIYLWEPNFYKDTVNSFTLYRGIIIGVASLLAIFLTIFYMVNRSSMLIPTFAMAWVVLGYISIDFGFLSKLVNLPSGELLIWRACSEIALSSSLIIFLFMYLHWNRWHAKVGYITFSGIACIAILFCMSFYYPMVTASIARITLASIVLYYTYFIIYHGMKGYERAVLLIPAWILIFIWFIGLWMAITKRLDNDIIQPALVGGLVLIVILIGFTVIQHVLATGYFSQGIFSDGERQSLAVLGSGDIVWDWDIVRDRVTTTPDIATILGLASGSMHGPIRNWLPYIHINDRDNFRTILDSFVGYRRGRLQYEFRVRAADNQFHWMIIRIRPMSNSNGDILRYIGIANDITEQKKSLEGILCNAFQDNLTGIPNRQSFLDRLTTILDLSATDDNLRPTVMVIDIDKYKKINDVLGIAVGDDVLVSLTRRIGELLKFPDILARLSGNRFGIILISENNSLKIADFAIAMRKSIAMPINLLEREITVTASIGFASWTSSKITSSEMLKNAELAMYHAKHRGGNHVESFRVSSFRSDRVMIKEDLCLAVENSELYLVYHPIIRLMDEEIVGLEALIQWDHPKWGNISSSEFMLIAEELCMIKAINLFMLERIARDIISWRDQANMPPIFILINIASKDLLDNELCEGMQALISKTLYSPSRIKLSFSESVVMGNPERSRLLLGRLRKIGISLTLDDFGTKCSLLSYLGYIPFDTVKFNGSLMTGSTEKRIAILRSIIPMAKNIETTIIAKDIYGEIDIKELTRMGCDYIQDSHVASPLGFNSILKLLKERFPLVKNT

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target963 sensory box/GGDEF family protein [Candidatus Liberibact
254781079266 diguanylate cyclase [Candidatus Liberibacter asiat 1e-08
>gi|254781079|ref|YP_003065492.1| diguanylate cyclase [Candidatus Liberibacter asiaticus str. psy62] Length = 266 Back     alignment
 Score = 53.9 bits (128), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 47/162 (29%), Positives = 76/162 (46%), Gaps = 12/162 (7%)

Query: 536 DNLTGIPNRQSFLDRLTTILDLSATDDNLRPTVMVIDIDKYKKINDVLGIAVGDDVLVSL 595
           D L+G+ N  +F+  L +         N + +++  DID +K+IND  G  VGD V+  L
Sbjct: 107 DCLSGLLNHSAFISSLGSY--------NEKLSIVFFDIDYFKQINDNFGHPVGDKVIAFL 158

Query: 596 TRRIGELLKFPDILARLSGNRFGIILISENNSLKIADFAIAMRKSIA-MPINLLER-EIT 653
           + ++  +   P  + RL G  F    +  +   + A  A  +RK I    IN+     I 
Sbjct: 159 SDQLVVVFGTPMFVGRLGGEEFAAAALGSSEQ-EAAILANDLRKIIENSQINISSGPSIH 217

Query: 654 VTASIGFASWTSSKITSSEMLKNAELAMYHAKHRGGNHVESF 695
           +T S G A     +  S+ ++  A+ A+Y AK  G N V  F
Sbjct: 218 ITISAGIAERCHKEPIST-IIYRADQALYVAKKSGRNRVVCF 258

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target963 sensory box/GGDEF family protein [Candidatus Liberibact
315122076965 sensory box/GGDEF family protein [Candidatus Liberibact 1 0.0
222085144970 sensory box/GGDEF family protein [Agrobacterium radioba 1 0.0
86356622965 putative sensory box/GGDEF family protein [Rhizobium et 1 0.0
190890692970 sensory box/GGDEF family protein [Rhizobium etli CIAT 6 1 0.0
241203436965 diguanylate cyclase/phosphodiesterase with PAS/PAC and 1 0.0
209548238965 diguanylate cyclase/phosphodiesterase with PAS/PAC sens 1 0.0
116250832970 GGDEF/EAL domain-containing protein [Rhizobium legumino 1 0.0
15888127971 hypothetical protein Atu0784 [Agrobacterium tumefaciens 1 0.0
222147812985 hypothetical protein Avi_1072 [Agrobacterium vitis S4] 1 0.0
325292168971 sensory box/GGDEF family protein [Agrobacterium sp. H13 1 0.0
>gi|315122076|ref|YP_004062565.1| sensory box/GGDEF family protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 965 Back     alignment and organism information
 Score = 1452 bits (3760), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 719/955 (75%), Positives = 828/955 (86%), Gaps = 3/955 (0%)

Query: 11  FEKAFLILVLFLLWMVSPSFAIEPINISSSDRVLDLTSITRIYVNQGEDFQVFTAADIDG 70
            +  F ILV+F LWM  PSFAIEPI ISSSD  LDLT++T IYVN+GE+FQVFTAADIDG
Sbjct: 12  LKNNFSILVMFFLWMALPSFAIEPIKISSSDSALDLTAVTEIYVNRGENFQVFTAADIDG 71

Query: 71  ISRRIEVSASSIRHRGDWAVFALANTSDSQLERLIVVPHYRLVGSHFFSPDLGSRRIISV 130
           ISRRIEVSASSI+H+GDWAVFALANTSDSQLERLIVVPH+RLVGS FF PDLGSRRIISV
Sbjct: 72  ISRRIEVSASSIKHQGDWAVFALANTSDSQLERLIVVPHFRLVGSRFFLPDLGSRRIISV 131

Query: 131 TPSEGFSLDRIPNSDSDVFRITINPGAVVTFIMEISTPNLPQIYLWEPNFYKDTVNSFTL 190
           TPSEGFSLDR+PN D+DVFRITINPGA+VTF+MEI++ NLPQIYLWEP+FYKDTVNSFTL
Sbjct: 132 TPSEGFSLDRVPNPDADVFRITINPGAIVTFVMEITSSNLPQIYLWEPDFYKDTVNSFTL 191

Query: 191 YRGIIIGVASLLAIFLTIFYMVNRSSMLIPTFAMAWVVLGYISIDFGFLSKLVNLPSGEL 250
           Y+GIIIG+ASLLA+FLT+ YMVN+SSML+  F MAWVVLGYI IDFGF+SKL+N PSGEL
Sbjct: 192 YQGIIIGIASLLAVFLTVLYMVNKSSMLVSAFTMAWVVLGYICIDFGFISKLINSPSGEL 251

Query: 251 LIWRACSEIALSSSLIIFLFMYLHWNRWHAKVGYITFSGIACIAILFCMSFYYPMVTASI 310
            IWRACSE+ALS SL+IFLF Y + NRW  K+G+ITF+ I C+AILFC+SFYYP +TA I
Sbjct: 252 PIWRACSEMALSLSLLIFLFTYFNLNRWRTKLGHITFAWITCLAILFCISFYYPSLTAGI 311

Query: 311 ARITLASIVLYYTYFIIYHGMKGYERAVLLIPAWILIFIWFIGLWMAITKRLDNDIIQPA 370
           AR++   IVL  T  I Y G KGYER++LLIPAW+LI IW IG WMAITKRLDNDIIQ A
Sbjct: 312 ARLSFGGIVLLGTCCIFYLGKKGYERSILLIPAWMLIVIWSIGSWMAITKRLDNDIIQSA 371

Query: 371 LVGGLVLIVILIGFTVIQHVLATGYFSQGIFSDGERQSLAVLGSGDIVWDWDIVRDRVTT 430
           L GGLVLI++LIGFTVIQHVL +G  SQGIF D E QSLAVLGSGDI+W+WD+V D+VTT
Sbjct: 372 LDGGLVLIILLIGFTVIQHVLTSGNISQGIFPDVECQSLAVLGSGDIIWNWDVVHDKVTT 431

Query: 431 TPDIATILGLASGSMHGPIRNWLPYIHINDRDNFRTILDSFVGYRRGRLQYEFRVRAADN 490
           TPDIAT LGLA+GSMHG IRNWLP+IH++D+D+FRTILDSF+ YRRGRL++EFR+ A D 
Sbjct: 432 TPDIATTLGLAAGSMHGAIRNWLPHIHLDDQDSFRTILDSFLEYRRGRLKHEFRIFAKDG 491

Query: 491 QFHWMIIRIRPMSNSNGDILRYIGIANDITEQKKSLEGILCNAFQDNLTGIPNRQSFLDR 550
           QFHW+++RIRP+ N NG+ILR IGIANDIT QKKS++GIL NA QDNLTGIPN QSFLDR
Sbjct: 492 QFHWIMLRIRPVLNVNGEILRCIGIANDITVQKKSIDGILYNALQDNLTGIPNLQSFLDR 551

Query: 551 LTTILDLSATDDNLRPTVMVIDIDKYKKINDVLGIAVGDDVLVSLTRRIGELLKFPDILA 610
           LTTI+ LS  D+NL P VMV+DIDKYK+IN  LGIA+GDDVLV LTRRI  LL+  D LA
Sbjct: 552 LTTIISLSV-DNNLHPAVMVLDIDKYKQINRTLGIAIGDDVLVVLTRRIRSLLRSQDTLA 610

Query: 611 RLSGNRFGIILISENNSLKIADFAIAMRKSIAMPINLLEREITVTASIGFASWTSSKITS 670
           RLSG+RFGIIL SE +  KIADFA+ + K++ MPI+LL REI VTASIGF SWTSSKITS
Sbjct: 611 RLSGDRFGIILTSEKDRTKIADFAMTVSKAVVMPIHLLNREIIVTASIGFVSWTSSKITS 670

Query: 671 SEMLKNAELAMYHAKHRGGNHVESFRVS--SFRSDRVMIKEDLCLAVENSELYLVYHPII 728
           +EMLKNAELAMYHAK+RGGN +ESFR S  SFRSD++ IKEDL  A+ NSELYLVY+PII
Sbjct: 671 TEMLKNAELAMYHAKNRGGNCIESFRPSLISFRSDKLRIKEDLSRAIINSELYLVYNPII 730

Query: 729 RLMDEEIVGLEALIQWDHPKWGNISSSEFMLIAEELCMIKAINLFMLERIARDIISWRDQ 788
           RL DEEIVGLEAL+QW+HPK+GNI SS+FM IAEEL +IK+INLFMLERIA DII+WRDQ
Sbjct: 731 RLADEEIVGLEALLQWNHPKFGNIPSSKFMSIAEELSIIKSINLFMLERIAADIINWRDQ 790

Query: 789 ANMPPIFILINIASKDLLDNELCEGMQALISKTLYSPSRIKLSFSESVVMGNPERSRLLL 848
           ANMPPIF+ INI S  LLD+ LCE +QA+ISKTL SPS IKL+FSES+VM NPE+S LLL
Sbjct: 791 ANMPPIFVSINIGSTVLLDDSLCEYIQAIISKTLCSPSGIKLAFSESIVMENPEKSCLLL 850

Query: 849 GRLRKIGISLTLDDFGTKCSLLSYLGYIPFDTVKFNGSLMTGSTEKRIAILRSIIPMAKN 908
            +LRK+GI LTLDDFGTKCSLLSYLGY+PFD +KFNGSLMTGST KRI++LRS++ +AK 
Sbjct: 851 DKLRKMGIGLTLDDFGTKCSLLSYLGYMPFDAIKFNGSLMTGSTTKRISMLRSLVSIAKK 910

Query: 909 IETTIIAKDIYGEIDIKELTRMGCDYIQDSHVASPLGFNSILKLLKERFPLVKNT 963
           +E  IIAKDIYGEID KEL RMGCDYIQ SH+ SPL  +SILKLLK+RFPLVKNT
Sbjct: 911 LEVMIIAKDIYGEIDTKELARMGCDYIQGSHITSPLRSSSILKLLKDRFPLVKNT 965


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222085144|ref|YP_002543674.1| sensory box/GGDEF family protein [Agrobacterium radiobacter K84] Length = 970 Back     alignment and organism information
>gi|86356622|ref|YP_468514.1| putative sensory box/GGDEF family protein [Rhizobium etli CFN 42] Length = 965 Back     alignment and organism information
>gi|190890692|ref|YP_001977234.1| sensory box/GGDEF family protein [Rhizobium etli CIAT 652] Length = 970 Back     alignment and organism information
>gi|241203436|ref|YP_002974532.1| diguanylate cyclase/phosphodiesterase with PAS/PAC and periplasmic/7TM domain sensor(s) [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 965 Back     alignment and organism information
>gi|209548238|ref|YP_002280155.1| diguanylate cyclase/phosphodiesterase with PAS/PAC sensor(s) [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 965 Back     alignment and organism information
>gi|116250832|ref|YP_766670.1| GGDEF/EAL domain-containing protein [Rhizobium leguminosarum bv. viciae 3841] Length = 970 Back     alignment and organism information
>gi|15888127|ref|NP_353808.1| hypothetical protein Atu0784 [Agrobacterium tumefaciens str. C58] Length = 971 Back     alignment and organism information
>gi|222147812|ref|YP_002548769.1| hypothetical protein Avi_1072 [Agrobacterium vitis S4] Length = 985 Back     alignment and organism information
>gi|325292168|ref|YP_004278032.1| sensory box/GGDEF family protein [Agrobacterium sp. H13-3] Length = 971 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target963 sensory box/GGDEF family protein [Candidatus Liberibact
PRK11359799 PRK11359, PRK11359, cyclic-di-GMP phosphodiesterase; Pr 9e-49
PRK10060663 PRK10060, PRK10060, RNase II stability modulator; Provi 3e-42
PRK097761092 PRK09776, PRK09776, putative diguanylate cyclase; Provi 5e-33
PRK11829660 PRK11829, PRK11829, biofilm formation regulator HmsP; P 3e-32
PRK13561651 PRK13561, PRK13561, putative diguanylate cyclase; Provi 4e-27
COG5001663 COG5001, COG5001, Predicted signal transduction protein 2e-54
cd01948240 cd01948, EAL, EAL domain 8e-46
COG2200256 COG2200, Rtn, FOG: EAL domain [Signal transduction mech 6e-44
pfam00563233 pfam00563, EAL, EAL domain 2e-38
smart00052241 smart00052, EAL, Putative diguanylate phosphodiesterase 8e-37
COG4943524 COG4943, COG4943, Predicted signal transduction protein 9e-30
PRK10551518 PRK10551, PRK10551, phage resistance protein; Provision 5e-13
cd01949158 cd01949, GGDEF, Diguanylate-cyclase (DGC) or GGDEF doma 1e-35
smart00267163 smart00267, GGDEF, diguanylate cyclase 2e-33
COG2199181 COG2199, COG2199, FOG: GGDEF domain [Signal transductio 6e-32
pfam00990159 pfam00990, GGDEF, GGDEF domain 1e-31
COG3706435 COG3706, PleD, Response regulator containing a CheY-lik 1e-22
TIGR00254165 TIGR00254, GGDEF, diguanylate cyclase (GGDEF) domain 1e-21
PRK09581457 PRK09581, pleD, response regulator PleD; Reviewed 2e-19
PRK10245366 PRK10245, adrA, diguanylate cyclase AdrA; Provisional 2e-15
PRK09894296 PRK09894, PRK09894, diguanylate cyclase; Provisional 3e-14
PRK09966407 PRK09966, PRK09966, putative inner membrane diguanylate 1e-13
PRK15426570 PRK15426, PRK15426, putative diguanylate cyclase YedQ; 3e-11
PRK11059640 PRK11059, PRK11059, regulatory protein CsrD; Provisiona 9e-09
pfam07696141 pfam07696, 7TMR-DISMED2, 7TMR-DISM extracellular 2 3e-14
pfam0844790 pfam08447, PAS_3, PAS fold 4e-10
PRK09776 1092 PRK09776, PRK09776, putative diguanylate cyclase; Provi 3e-06
COG2202232 COG2202, AtoS, FOG: PAS/PAC domain [Signal transduction 2e-04
TIGR00229124 TIGR00229, sensory_box, PAS domain S-box 0.002
pfam07695207 pfam07695, 7TMR-DISM_7TM, 7TM diverse intracellular sig 2e-06
smart0008643 smart00086, PAC, Motif C-terminal to PAS motifs (likely 8e-04
>gnl|CDD|183097 PRK11359, PRK11359, cyclic-di-GMP phosphodiesterase; Provisional Back     alignment and domain information
>gnl|CDD|182215 PRK10060, PRK10060, RNase II stability modulator; Provisional Back     alignment and domain information
>gnl|CDD|182070 PRK09776, PRK09776, putative diguanylate cyclase; Provisional Back     alignment and domain information
>gnl|CDD|183329 PRK11829, PRK11829, biofilm formation regulator HmsP; Provisional Back     alignment and domain information
>gnl|CDD|184143 PRK13561, PRK13561, putative diguanylate cyclase; Provisional Back     alignment and domain information
>gnl|CDD|34606 COG5001, COG5001, Predicted signal transduction protein containing a membrane domain, an EAL and a GGDEF domain [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|30163 cd01948, EAL, EAL domain Back     alignment and domain information
>gnl|CDD|32382 COG2200, Rtn, FOG: EAL domain [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|144230 pfam00563, EAL, EAL domain Back     alignment and domain information
>gnl|CDD|128367 smart00052, EAL, Putative diguanylate phosphodiesterase Back     alignment and domain information
>gnl|CDD|34551 COG4943, COG4943, Predicted signal transduction protein containing sensor and EAL domains [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|182541 PRK10551, PRK10551, phage resistance protein; Provisional Back     alignment and domain information
>gnl|CDD|143635 cd01949, GGDEF, Diguanylate-cyclase (DGC) or GGDEF domain Back     alignment and domain information
>gnl|CDD|128563 smart00267, GGDEF, diguanylate cyclase Back     alignment and domain information
>gnl|CDD|32381 COG2199, COG2199, FOG: GGDEF domain [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|144545 pfam00990, GGDEF, GGDEF domain Back     alignment and domain information
>gnl|CDD|33501 COG3706, PleD, Response regulator containing a CheY-like receiver domain and a GGDEF domain [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|161790 TIGR00254, GGDEF, diguanylate cyclase (GGDEF) domain Back     alignment and domain information
>gnl|CDD|181966 PRK09581, pleD, response regulator PleD; Reviewed Back     alignment and domain information
>gnl|CDD|182329 PRK10245, adrA, diguanylate cyclase AdrA; Provisional Back     alignment and domain information
>gnl|CDD|182133 PRK09894, PRK09894, diguanylate cyclase; Provisional Back     alignment and domain information
>gnl|CDD|182171 PRK09966, PRK09966, putative inner membrane diguanylate cyclase; Provisional Back     alignment and domain information
>gnl|CDD|185324 PRK15426, PRK15426, putative diguanylate cyclase YedQ; Provisional Back     alignment and domain information
>gnl|CDD|182935 PRK11059, PRK11059, regulatory protein CsrD; Provisional Back     alignment and domain information
>gnl|CDD|148995 pfam07696, 7TMR-DISMED2, 7TMR-DISM extracellular 2 Back     alignment and domain information
>gnl|CDD|117024 pfam08447, PAS_3, PAS fold Back     alignment and domain information
>gnl|CDD|182070 PRK09776, PRK09776, putative diguanylate cyclase; Provisional Back     alignment and domain information
>gnl|CDD|32384 COG2202, AtoS, FOG: PAS/PAC domain [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|161776 TIGR00229, sensory_box, PAS domain S-box Back     alignment and domain information
>gnl|CDD|148994 pfam07695, 7TMR-DISM_7TM, 7TM diverse intracellular signalling Back     alignment and domain information
>gnl|CDD|128397 smart00086, PAC, Motif C-terminal to PAS motifs (likely to contribute to PAS structural domain) Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 963 sensory box/GGDEF family protein [Candidatus Liberibact
PRK097761116 putative sensor protein; Provisional 100.0
PRK10060663 RNase II stability modulator; Provisional 100.0
PRK11359799 cAMP phosphodiesterase; Provisional 100.0
PRK09959 1197 hybrid sensory histidine kinase in two-component regula 98.72
PRK13561651 putative phosphodiesterase; Provisional 100.0
PRK11829728 biofilm formation regulator HmsP; Provisional 100.0
PRK11059642 regulatory protein CsrD; Provisional 100.0
COG5001663 Predicted signal transduction protein containing a memb 100.0
PRK10551518 hypothetical protein; Provisional 100.0
COG2200256 Rtn c-di-GMP phosphodiesterase class I (EAL domain) [Si 100.0
COG4943524 Predicted signal transduction protein containing sensor 100.0
PRK11596255 EAL domain-containing protein; Provisional 100.0
smart00052241 EAL Putative diguanylate phosphodiesterase. Putative di 100.0
cd01948240 EAL EAL domain. This domain is found in diverse bacteri 100.0
pfam00563233 EAL EAL domain. This domain is found in diverse bacteri 100.0
COG3434 407 Predicted signal transduction protein containing EAL an 99.46
PRK10245371 adrA diguanylate cyclase AdrA; Provisional 100.0
PRK09581457 pleD response regulator PleD; Reviewed 100.0
PRK09966407 hypothetical protein; Provisional 100.0
PRK09894293 hypothetical protein; Provisional 100.0
COG3706435 PleD Response regulator containing a CheY-like receiver 99.96
smart00267163 GGDEF diguanylate cyclase. Diguanylate cyclase, present 99.96
COG2199181 c-di-GMP synthetase (diguanylate cyclase, GGDEF domain) 99.96
pfam00990159 GGDEF GGDEF domain. This domain is found linked to a wi 99.95
cd01949158 GGDEF Diguanylate-cyclase (DGC) or GGDEF domain. Diguan 99.94
TIGR00254171 GGDEF diguanylate cyclase (GGDEF) domain; InterPro: IPR 99.85
pfam07696141 7TMR-DISMED2 7TMR-DISM extracellular 2. This entry repr 99.85
PRK09776 1116 putative sensor protein; Provisional 99.8
PRK13557538 histidine kinase; Provisional 99.77
PRK11091779 aerobic respiration control sensor protein ArcB; Provis 99.67
PRK13560807 hypothetical protein; Provisional 99.61
PRK13560807 hypothetical protein; Provisional 99.43
pfam00989112 PAS PAS fold. The PAS fold corresponds to the structura 99.42
PRK11359 799 cAMP phosphodiesterase; Provisional 99.34
PRK13558674 bacterio-opsin activator; Provisional 99.25
pfam08448110 PAS_4 PAS fold. The PAS fold corresponds to the structu 99.24
PRK13559363 hypothetical protein; Provisional 99.22
TIGR00229130 sensory_box PAS domain S-box; InterPro: IPR000014 PAS d 99.18
PRK11360607 sensory histidine kinase AtoS; Provisional 99.08
TIGR02938496 nifL_nitrog nitrogen fixation negative regulator NifL; 98.79
PRK11006431 phoR phosphate regulon sensor protein; Provisional 98.73
cd00130103 PAS PAS domain; PAS motifs appear in archaea, eubacteri 98.73
PRK11073348 glnL nitrogen regulation protein NR(II); Provisional 98.29
COG2202232 AtoS FOG: PAS/PAC domain [Signal transduction mechanism 98.2
PRK11086541 sensory histidine kinase DcuS; Provisional 98.13
COG5002459 VicK Signal transduction histidine kinase [Signal trans 97.91
COG5000712 NtrY Signal transduction histidine kinase involved in n 97.77
PRK10820513 DNA-binding transcriptional regulator TyrR; Provisional 97.74
TIGR02966339 phoR_proteo phosphate regulon sensor kinase PhoR; Inter 97.69
KOG3558768 consensus 97.63
COG3829560 RocR Transcriptional regulator containing PAS, AAA-type 97.18
COG3852363 NtrB Signal transduction histidine kinase, nitrogen spe 94.55
pfam07310137 PAS_5 PAS domain. This family contains a number of hypo 91.85
pfam07695207 7TMR-DISM_7TM 7TM diverse intracellular signalling. Thi 99.69
pfam0844790 PAS_3 PAS fold. The PAS fold corresponds to the structu 99.42
KOG3560712 consensus 95.34
KOG3753 1114 consensus 90.53
COG3887655 Predicted signaling protein consisting of a modified GG 98.86
smart0009167 PAS PAS domain. PAS motifs appear in archaea, eubacteri 97.85
KOG3561 803 consensus 93.79
KOG3558768 consensus 93.15
COG3290537 CitA Signal transduction histidine kinase regulating ci 97.84
TIGR02938496 nifL_nitrog nitrogen fixation negative regulator NifL; 97.1
TIGR02040453 PpsR-CrtJ transcriptional regulator PpsR; InterPro: IPR 91.36
smart0008643 PAC Motif C-terminal to PAS motifs (likely to contribut 97.64
KOG0501971 consensus 96.61
cd07556133 Nucleotidyl_cyc_III Class III nucleotidyl cyclases. Cla 96.43
cd07302177 CHD cyclase homology domain. Catalytic domains of the m 92.59
pfam05913357 DUF871 Bacterial protein of unknown function (DUF871). 95.92
TIGR01697266 PNPH-PUNA-XAPA inosine guanosine and xanthosine phospho 94.98
pfam00072111 Response_reg Response regulator receiver domain. This d 94.35
PRK05265240 pyridoxine 5'-phosphate synthase; Provisional 93.85
cd00156113 REC Signal receiver domain; originally thought to be un 91.79
PRK10610129 chemotaxis regulatory protein CheY; Provisional 91.08
PRK10841947 hybrid sensory kinase in two-component regulatory syste 94.82
PRK00164334 moaA molybdenum cofactor biosynthesis protein A; Review 93.88
) of Arabidopsis thaliana (Mouse-ear cress), mammalian Gephryin (e.g. Q9NQX3 from SWISSPROT) and Drosophila melanogaster (Fruit fly) Cinnamon (P39205 from SWISSPROT) . This entry represents the bacterial form of MoaA (molybdenum cofactor biosynthesis protein A). The MoaA protein is a member of the wider S-adenosylmethionine(SAM)-dependent enzyme family which catalyze the formation of protein and/or substrate radicals by reductive cleavage of SAM via a [4Fe-4S] cluster. Monomeric and homodimeric forms of MoaA have been observed in vivo, and it is not clear what the physiologically relevant form of the enzyme is . The core of each monomer consists of an incomplete TIM barrel, formed by the N-terminal region of the protein, containing a [4Fe-4S] cluster. The C-terminal region of the protein, which also contains a [4Fe-4S] cluster consists of a beta-sheet covering the lateral opening of the barrel, an extended loop and three alpha helices. The N-terminal [4Fe-4S] cluster is coordinated with 3 cysteines and an exchangeable SAM molecule, while the C-terminal [4Fe-4S], also coordinated with 3 cysteines, is the binding and activation site for GTP .; GO: 0046872 metal ion binding, 0006777 Mo-molybdopterin cofactor biosynthetic process." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR02666">TIGR02666346 moaA molybdenum cofactor biosynthesis protein A; InterP 93.75
PRK13361329 molybdenum cofactor biosynthesis protein A; Provisional 92.91
cd00003234 PNPsynthase Pyridoxine 5'-phosphate (PNP) synthase doma 93.57
TIGR03471472 HpnJ hopanoid biosynthesis associated radical SAM prote 91.04
TIGR02577665 cas_TM1794_Crm2 CRISPR-associated protein, Crm2 family; 92.79
COG0191286 Fba Fructose/tagatose bisphosphate aldolase [Carbohydra 91.97
PRK07709285 fructose-bisphosphate aldolase; Provisional 91.7
pfam01116283 F_bP_aldolase Fructose-bisphosphate aldolase class-II. 91.16
PRK09196347 fructose-1,6-bisphosphate aldolase; Reviewed 90.14
COG4485858 Predicted membrane protein [Function unknown] 90.88
PRK02240254 GTP cyclohydrolase III; Provisional 90.28
>PRK09776 putative sensor protein; Provisional Back     alignment and domain information
>PRK10060 RNase II stability modulator; Provisional Back     alignment and domain information
>PRK11359 cAMP phosphodiesterase; Provisional Back     alignment and domain information
>PRK09959 hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional Back     alignment and domain information
>PRK13561 putative phosphodiesterase; Provisional Back     alignment and domain information
>PRK11829 biofilm formation regulator HmsP; Provisional Back     alignment and domain information
>PRK11059 regulatory protein CsrD; Provisional Back     alignment and domain information
>COG5001 Predicted signal transduction protein containing a membrane domain, an EAL and a GGDEF domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK10551 hypothetical protein; Provisional Back     alignment and domain information
>COG2200 Rtn c-di-GMP phosphodiesterase class I (EAL domain) [Signal transduction mechanisms] Back     alignment and domain information
>COG4943 Predicted signal transduction protein containing sensor and EAL domains [Signal transduction mechanisms] Back     alignment and domain information
>PRK11596 EAL domain-containing protein; Provisional Back     alignment and domain information
>smart00052 EAL Putative diguanylate phosphodiesterase Back     alignment and domain information
>cd01948 EAL EAL domain Back     alignment and domain information
>pfam00563 EAL EAL domain Back     alignment and domain information
>COG3434 Predicted signal transduction protein containing EAL and modified HD-GYP domains [Signal transduction mechanisms] Back     alignment and domain information
>PRK10245 adrA diguanylate cyclase AdrA; Provisional Back     alignment and domain information
>PRK09581 pleD response regulator PleD; Reviewed Back     alignment and domain information
>PRK09966 hypothetical protein; Provisional Back     alignment and domain information
>PRK09894 hypothetical protein; Provisional Back     alignment and domain information
>COG3706 PleD Response regulator containing a CheY-like receiver domain and a GGDEF domain [Signal transduction mechanisms] Back     alignment and domain information
>smart00267 GGDEF diguanylate cyclase Back     alignment and domain information
>COG2199 c-di-GMP synthetase (diguanylate cyclase, GGDEF domain) [Signal transduction mechanisms] Back     alignment and domain information
>pfam00990 GGDEF GGDEF domain Back     alignment and domain information
>cd01949 GGDEF Diguanylate-cyclase (DGC) or GGDEF domain Back     alignment and domain information
>TIGR00254 GGDEF diguanylate cyclase (GGDEF) domain; InterPro: IPR000160 This domain appears to be ubiquitous in bacteria and is often linked to a regulatory domain, such as a phosphorylation receiver or oxygen sensing domain Back     alignment and domain information
>pfam07696 7TMR-DISMED2 7TMR-DISM extracellular 2 Back     alignment and domain information
>PRK09776 putative sensor protein; Provisional Back     alignment and domain information
>PRK13557 histidine kinase; Provisional Back     alignment and domain information
>PRK11091 aerobic respiration control sensor protein ArcB; Provisional Back     alignment and domain information
>PRK13560 hypothetical protein; Provisional Back     alignment and domain information
>PRK13560 hypothetical protein; Provisional Back     alignment and domain information
>pfam00989 PAS PAS fold Back     alignment and domain information
>PRK11359 cAMP phosphodiesterase; Provisional Back     alignment and domain information
>PRK13558 bacterio-opsin activator; Provisional Back     alignment and domain information
>pfam08448 PAS_4 PAS fold Back     alignment and domain information
>PRK13559 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00229 sensory_box PAS domain S-box; InterPro: IPR000014 PAS domains are involved in many signalling proteins where they are used as a signal sensor domain Back     alignment and domain information
>PRK11360 sensory histidine kinase AtoS; Provisional Back     alignment and domain information
>TIGR02938 nifL_nitrog nitrogen fixation negative regulator NifL; InterPro: IPR014285 NifL modulates the activity of the nitrogen fixation positive regulator protein NifA, acting as a negative regulator by binding NifA Back     alignment and domain information
>PRK11006 phoR phosphate regulon sensor protein; Provisional Back     alignment and domain information
>cd00130 PAS PAS domain; PAS motifs appear in archaea, eubacteria and eukarya Back     alignment and domain information
>PRK11073 glnL nitrogen regulation protein NR(II); Provisional Back     alignment and domain information
>COG2202 AtoS FOG: PAS/PAC domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK11086 sensory histidine kinase DcuS; Provisional Back     alignment and domain information
>COG5002 VicK Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>COG5000 NtrY Signal transduction histidine kinase involved in nitrogen fixation and metabolism regulation [Signal transduction mechanisms] Back     alignment and domain information
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional Back     alignment and domain information
>TIGR02966 phoR_proteo phosphate regulon sensor kinase PhoR; InterPro: IPR014310 Members of this protein are the regulatory histidine kinase PhoR associated with the phosphate ABC transporter found in most Proteobacteria, and related proteins from Gram-positive organisms are excluded Back     alignment and domain information
>KOG3558 consensus Back     alignment and domain information
>COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>COG3852 NtrB Signal transduction histidine kinase, nitrogen specific [Signal transduction mechanisms] Back     alignment and domain information
>pfam07310 PAS_5 PAS domain Back     alignment and domain information
>pfam07695 7TMR-DISM_7TM 7TM diverse intracellular signalling Back     alignment and domain information
>pfam08447 PAS_3 PAS fold Back     alignment and domain information
>KOG3560 consensus Back     alignment and domain information
>KOG3753 consensus Back     alignment and domain information
>COG3887 Predicted signaling protein consisting of a modified GGDEF domain and a DHH domain [Signal transduction mechanisms] Back     alignment and domain information
>smart00091 PAS PAS domain Back     alignment and domain information
>KOG3561 consensus Back     alignment and domain information
>KOG3558 consensus Back     alignment and domain information
>COG3290 CitA Signal transduction histidine kinase regulating citrate/malate metabolism [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02938 nifL_nitrog nitrogen fixation negative regulator NifL; InterPro: IPR014285 NifL modulates the activity of the nitrogen fixation positive regulator protein NifA, acting as a negative regulator by binding NifA Back     alignment and domain information
>TIGR02040 PpsR-CrtJ transcriptional regulator PpsR; InterPro: IPR011785 This entry represents the transcriptional regulator PpsR which is strictly associated with photosynthetic proteobacteria and found in photosynthetic operons Back     alignment and domain information
>smart00086 PAC Motif C-terminal to PAS motifs (likely to contribute to PAS structural domain) Back     alignment and domain information
>KOG0501 consensus Back     alignment and domain information
>cd07556 Nucleotidyl_cyc_III Class III nucleotidyl cyclases Back     alignment and domain information
>cd07302 CHD cyclase homology domain Back     alignment and domain information
>pfam05913 DUF871 Bacterial protein of unknown function (DUF871) Back     alignment and domain information
>TIGR01697 PNPH-PUNA-XAPA inosine guanosine and xanthosine phosphorylase family; InterPro: IPR011268 This entry describes a subset of the phosphorylase family Back     alignment and domain information
>pfam00072 Response_reg Response regulator receiver domain Back     alignment and domain information
>PRK05265 pyridoxine 5'-phosphate synthase; Provisional Back     alignment and domain information
>cd00156 REC Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; contains a phosphoacceptor site that is phosphorylated by histidine kinase homologs; usually found N-terminal to a DNA binding effector domain; forms homodimers Back     alignment and domain information
>PRK10610 chemotaxis regulatory protein CheY; Provisional Back     alignment and domain information
>PRK10841 hybrid sensory kinase in two-component regulatory system with RcsB and YojN; Provisional Back     alignment and domain information
>PRK00164 moaA molybdenum cofactor biosynthesis protein A; Reviewed Back     alignment and domain information
>TIGR02666 moaA molybdenum cofactor biosynthesis protein A; InterPro: IPR013483 The majority of molybdenum-containing enzymes utilise a molybdenum cofactor (MoCF or Moco) consisting of a Mo atom coordinated via a cisdithiolene moiety to molybdopterin (MPT) Back     alignment and domain information
>PRK13361 molybdenum cofactor biosynthesis protein A; Provisional Back     alignment and domain information
>cd00003 PNPsynthase Pyridoxine 5'-phosphate (PNP) synthase domain; pyridoxal 5'-phosphate is the active form of vitamin B6 that acts as an essential, ubiquitous coenzyme in amino acid metabolism Back     alignment and domain information
>TIGR03471 HpnJ hopanoid biosynthesis associated radical SAM protein HpnJ Back     alignment and domain information
>TIGR02577 cas_TM1794_Crm2 CRISPR-associated protein, Crm2 family; InterPro: IPR013407 This entry is encoded within the CRISPR-associated RAMP module, a set of six genes found together in prokaryotic genomes Back     alignment and domain information
>COG0191 Fba Fructose/tagatose bisphosphate aldolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK07709 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>pfam01116 F_bP_aldolase Fructose-bisphosphate aldolase class-II Back     alignment and domain information
>PRK09196 fructose-1,6-bisphosphate aldolase; Reviewed Back     alignment and domain information
>COG4485 Predicted membrane protein [Function unknown] Back     alignment and domain information
>PRK02240 GTP cyclohydrolase III; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target963 sensory box/GGDEF family protein [Candidatus Liberibact
2r6o_A294 Crystal Structure Of Putative Diguanylate CyclasePH 3e-77
3pjw_A430 Structure Of Pseudomonas Fluorescence Lapd Ggdef-Ea 3e-66
3hvb_A437 Crystal Structure Of The Dual-Domain Ggdef-Eal Modu 5e-65
>gi|158430646|pdb|2R6O|A Chain A, Crystal Structure Of Putative Diguanylate CyclasePHOSPHODIESTERASE FROM THIOBACILLUS DENITRIFICANS Length = 294 Back     alignment and structure
 Score =  295 bits (755), Expect = 3e-77,   Method: Composition-based stats.
 Identities = 70/267 (26%), Positives = 131/267 (49%), Gaps = 3/267 (1%)

Query: 699 SFRSDRVMIKEDLCLAVENSELYLVYHPIIRLMDEEIVGLEALIQWDHPKWGNISSSEFM 758
               +R+ +   L  A+E +EL L Y PI+ L    IVG EAL++W+ P+ G +  S F+
Sbjct: 19  FQGHERLTLDTRLRQALERNELVLHYQPIVELASGRIVGGEALVRWEDPERGLVXPSAFI 78

Query: 759 LIAEELCMIKAINLFMLERIARDIISWRDQANM-PPIFILINIASKDLLDNELCEGMQAL 817
             AE+  +I A++ ++LE     + +W+ Q      + + +NI+++      L   +   
Sbjct: 79  PAAEDTGLIVALSDWVLEACCTQLRAWQQQGRAADDLTLSVNISTRQFEGEHLTRAVDRA 138

Query: 818 ISKTLYSPSRIKLSFSESVVMGNPERSRLLLGRLRKIGISLTLDDFGTKCSLLSYLGYIP 877
           ++++   P  ++L  +E+V +   +  R  L  LR  G+ L LDDFGT  S LSYL  +P
Sbjct: 139 LARSGLRPDCLELEITENVXLVXTDEVRTCLDALRARGVRLALDDFGTGYSSLSYLSQLP 198

Query: 878 FDTVKFNGSLMTGS--TEKRIAILRSIIPMAKNIETTIIAKDIYGEIDIKELTRMGCDYI 935
           F  +K + S +           I+ +I+ +A+ +   ++A+ I        L   GC++ 
Sbjct: 199 FHGLKIDQSFVRKIPAHPSETQIVTTILALARGLGXEVVAEGIETAQQYAFLRDRGCEFG 258

Query: 936 QDSHVASPLGFNSILKLLKERFPLVKN 962
           Q +  ++P   ++   LL  +    + 
Sbjct: 259 QGNLXSTPQAADAFASLLDRQKASGQR 285


>gi|322812532|pdb|3PJW|A Chain A, Structure Of Pseudomonas Fluorescence Lapd Ggdef-Eal Dual Domain, I23 Length = 430 Back     alignment and structure
>gi|256032701|pdb|3HVB|A Chain A, Crystal Structure Of The Dual-Domain Ggdef-Eal Module Of Fimx From Pseudomonas Aeruginosa Length = 437 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target963 sensory box/GGDEF family protein [Candidatus Liberibact
3hvb_A437 Protein FIMX; EAL phosphodiesterase, biofilm, C-DI-GMP, 7e-38
3gfz_A413 Klebsiella pneumoniae BLRP1; TIM-barrel, EAL domain, BL 2e-35
2r6o_A294 Putative diguanylate cyclase/phosphodiesterase (ggdef & 1e-31
2bas_A 431 YKUI protein; EAL domain, structural genomics, PSI, pro 3e-30
3hv8_A268 Protein FIMX; EAL phosphodiesterase, biofilm, C-DI-GMP, 2e-22
1w25_A459 Stalked-cell differentiation controlling protein; two-c 3e-31
3mtk_A178 Diguanylate cyclase/phosphodiesterase; structural genom 5e-31
3bre_A358 Probable two-component response regulator; protein-nucl 2e-26
3icl_A171 EAL/ggdef domain protein; structural genomics, PSI-2, p 2e-24
3hvw_A176 Diguanylate-cyclase (DGC); alpha-beta protein., structu 2e-22
3ign_A177 Diguanylate cyclase; ggdef domain, A1U3W3_marav, NESG, 6e-22
3hva_A177 Protein FIMX; ggdef diguanylate cyclase, biofilm, C-DI- 1e-11
3i5c_A206 Fusion of general control protein GCN4 and WSPR respons 3e-08
3ezu_A342 Ggdef domain protein; multidomain protein of unknown fu 9e-29
3pfm_A243 Ggdef domain protein; PSI2, MCSG, structural genomics, 8e-26
3kzp_A235 LMO0111 protein, putative diguanylate cyclase/phosphodi 4e-24
3nja_A125 Probable ggdef family protein; structural genomics, PSI 5e-18
3mr0_A142 Sensory box histidine kinase/response regulator; PAS fo 2e-14
3h9w_A115 Diguanylate cyclase with PAS/PAC sensor; alpha-beta pro 9e-13
3eeh_A125 Putative light and redox sensing histidine kinase; stru 4e-07
3icy_A118 Sensor protein; sensory box histidine kinase/response r 6e-07
3lyx_A124 Sensory BOX/ggdef domain protein; structural genomics, 3e-05
3f1p_B121 ARYL hydrocarbon receptor nuclear translocator; PAS dom 5e-05
3mjq_A126 Uncharacterized protein; NESG, structural genomics, PSI 7e-04
1n9l_A109 PHOT-LOV1, putative blue light receptor; phototropin, f 7e-04
1wa9_A368 Period circadian protein; PAS domain, circadian rhythm, 0.001
3f1p_A117 Endothelial PAS domain-containing protein 1; PAS domain 0.001
2z6d_A130 Phototropin-2; PAS-fold, LOV-fold, alternative splicing 0.002
3clo_A258 Transcriptional regulator; NP_811094.1, bacterial regul 0.003
3luq_A114 Sensor protein; PAS, histidine, kinase, PSI, MCSG, stru 0.003
3gdi_A309 Period circadian protein homolog 2; tandem PAS domains, 8e-05
3cax_A369 Uncharacterized protein PF0695; structural genomics, un 0.001
3mqq_A120 Transcriptional regulator, LUXR family; PAS domain, PSI 0.002
3mxq_A152 Sensor protein; PSI2, MCSG, structural genomics, protei 0.004
2wkq_A332 NPH1-1, RAS-related C3 botulinum toxin substrate 1; tra 0.002
>3hvb_A Protein FIMX; EAL phosphodiesterase, biofilm, C-DI-GMP, hydrolase; 2.99A {Pseudomonas aeruginosa PAO1} Length = 437 Back     alignment and structure
 Score =  154 bits (390), Expect = 7e-38
 Identities = 75/416 (18%), Positives = 162/416 (38%), Gaps = 7/416 (1%)

Query: 533 AFQDNLTGIPNRQSFLDRLTTILDLSATDDNLRPTVMVIDIDKYKKINDVLGIAVGDDVL 592
           + QD +TG+ NR  FLD +   +   A       T+  I ++ Y  +    G++  D +L
Sbjct: 13  SSQDPVTGLYNRSHFLDLMDAAVQ-QAVTARKPSTLAYIHLNGYPSLQADHGLSGIDLLL 71

Query: 593 VSLTRRIGELLKFPDILARLSGNRFGIILISENNSLKIADFAIAMRKSIAMPINLLEREI 652
             L   + E       LAR   + F  +   +      A     ++K       L  R  
Sbjct: 72  GQLAGLMREQFGEEADLARFGDSIFAALFKGKTPEQAQAALQRLLKKVENHLFELNGRSA 131

Query: 653 TVTASIGFASWTSSKITSSEMLKNAELAMYHAKHRGGNHVESFRVSSFRSDRVMIKEDLC 712
             T SIG A        + +++  A      A  +GG+ ++ +  +   +      + + 
Sbjct: 132 QATLSIGVAGLDEKTAKAQDVMNRAHRCADDAARKGGSQIKQYNPAEELAAAAQRGDVIA 191

Query: 713 LA---VENSELYLVYHPIIRLMDEEIVGLEALIQWDHPKWGNISSSEFMLIAEELCMIKA 769
           +    +E +   L++ P+I L  +     E L++  +P+   +  +EF+  A+E  + + 
Sbjct: 192 ILQQALETNSFRLLFQPVISLRGDSHENYEVLLRLLNPQGQEVPPAEFLHAAKEAGLAEK 251

Query: 770 INLFMLERIARDIISWRDQANMPPIFILINIASKDLLDNELCEGMQALISKTLYSPSRIK 829
           I+ +++    + +   R + +   +F+ ++ AS    D  L   +   +      P  + 
Sbjct: 252 IDRWVILNSIKLLAEHRAKGHQTKLFVHLSSASLQ--DPGLLPWLGVALKAARLPPESLV 309

Query: 830 LSFSESVVMGNPERSRLLLGRLRKIGISLTLDDFGTKCSLLSYLGYIPFDTVKFNGSLMT 889
              SE+      ++++ L   L  +     +  FG   +  + L ++    +K +GS + 
Sbjct: 310 FQISEADATSYLKQAKQLTQGLATLHCQAAISQFGCSLNPFNALKHLTVQFIKIDGSFVQ 369

Query: 890 G-STEKRIAILRSIIPMAKNIETTIIAKDIYGEIDIKELTRMGCDYIQDSHVASPL 944
             +  +   IL+ +I      +   I   +     +  L + G  YIQ  ++  P 
Sbjct: 370 DLNQVENQEILKGLIAELHEQQKLSIVPFVESASVLATLWQAGATYIQGYYLQGPS 425


>3gfz_A Klebsiella pneumoniae BLRP1; TIM-barrel, EAL domain, BLUF domain, hydrolase, signaling protein; HET: C2E FMN; 2.05A {Klebsiella pneumoniae subsp} PDB: 3gfy_A* 3gfx_A* 3gg0_A* 3gg1_A* 2kb2_A* Length = 413 Back     alignment and structure
>2r6o_A Putative diguanylate cyclase/phosphodiesterase (ggdef & EAL domains); ggdef and EAL domains, structural genomics, PSI-2; 1.80A {Thiobacillus denitrificans atcc 25259} PDB: 3ii8_A* Length = 294 Back     alignment and structure
>2bas_A YKUI protein; EAL domain, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.61A {Bacillus subtilis} SCOP: c.1.33.1 d.110.6.2 PDB: 2w27_A* Length = 431 Back     alignment and structure
>3hv8_A Protein FIMX; EAL phosphodiesterase, biofilm, C-DI-GMP, hydrolase; HET: C2E; 1.45A {Pseudomonas aeruginosa PAO1} PDB: 3hv9_A Length = 268 Back     alignment and structure
>1w25_A Stalked-cell differentiation controlling protein; two-component system, response regulator, diguanylate cyclase, ggdef domain; HET: C2E; 2.70A {Caulobacter vibrioides} SCOP: c.23.1.1 c.23.1.1 d.58.29.2 PDB: 2v0n_A* Length = 459 Back     alignment and structure
>3mtk_A Diguanylate cyclase/phosphodiesterase; structural genomics, PSI-2, protein structure initiative; 2.24A {Caldicellulosiruptor saccharolyticus} Length = 178 Back     alignment and structure
>3bre_A Probable two-component response regulator; protein-nucleotide complex, signaling protein; HET: C2E; 2.40A {Pseudomonas aeruginosa PAO1} PDB: 3i5a_A* Length = 358 Back     alignment and structure
>3icl_A EAL/ggdef domain protein; structural genomics, PSI-2, protein structure initiative, northeast structural genomics, consortium, NESG; HET: MSE; 2.00A {Methylococcus capsulatus} Length = 171 Back     alignment and structure
>3hvw_A Diguanylate-cyclase (DGC); alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.70A {Pseudomonas aeruginosa} Length = 176 Back     alignment and structure
>3ign_A Diguanylate cyclase; ggdef domain, A1U3W3_marav, NESG, MQR89A, structural genomics, PSI-2, protein structure initiative; HET: C2E; 1.83A {Marinobacter aquaeolei VT8} Length = 177 Back     alignment and structure
>3hva_A Protein FIMX; ggdef diguanylate cyclase, biofilm, C-DI-GMP, transferase; 2.04A {Pseudomonas aeruginosa PAO1} Length = 177 Back     alignment and structure
>3i5c_A Fusion of general control protein GCN4 and WSPR response regulator protein; C-DI-GMP, ggdef, leucine zipper, signaling protein; HET: C2E; 1.94A {Pseudomonas aeruginosa PAO1} PDB: 3i5b_A* Length = 206 Back     alignment and structure
>3ezu_A Ggdef domain protein; multidomain protein of unknown function with ggdef-domain, structural genomics; 1.95A {Geobacter sulfurreducens} Length = 342 Back     alignment and structure
>3pfm_A Ggdef domain protein; PSI2, MCSG, structural genomics, protein structure initiativ midwest center for structural genomics, EAL domain; 2.91A {Pseudomonas fluorescens} Length = 243 Back     alignment and structure
>3kzp_A LMO0111 protein, putative diguanylate cyclase/phosphodiesterase; EAL-domain, structural genomics, PSI-2, protein structure initiative; 2.00A {Listeria monocytogenes} Length = 235 Back     alignment and structure
>3nja_A Probable ggdef family protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.37A {Chromobacterium violaceum} Length = 125 Back     alignment and structure
>3mr0_A Sensory box histidine kinase/response regulator; PAS fold, structural genomics, PSI-2; HET: PG5; 1.49A {Burkholderia thailandensis} Length = 142 Back     alignment and structure
>3h9w_A Diguanylate cyclase with PAS/PAC sensor; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.90A {Marinobacter aquaeolei VT8} Length = 115 Back     alignment and structure
>3eeh_A Putative light and redox sensing histidine kinase; structural genomics, PSI, MCSG, protein structure initiative; HET: PG5; 1.95A {Haloarcula marismortui} Length = 125 Back     alignment and structure
>3icy_A Sensor protein; sensory box histidine kinase/response regulator domain, kinase, chlorobium tepidum TLS, PSI-2; 2.68A {Chlorobaculum tepidum} Length = 118 Back     alignment and structure
>3lyx_A Sensory BOX/ggdef domain protein; structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 2.00A {Colwellia psychrerythraea} Length = 124 Back     alignment and structure
>3f1p_B ARYL hydrocarbon receptor nuclear translocator; PAS domain, heterodimer, internal cavity, activator, angiogenesis, congenital erythrocytosis; 1.17A {Homo sapiens} PDB: 3f1o_B* 3f1n_B 3h7w_B* 3h82_B* 1x0o_A 2hv1_A 2b02_A* 2k7s_A 2a24_B Length = 121 Back     alignment and structure
>3mjq_A Uncharacterized protein; NESG, structural genomics, PSI-2, protein structure initiati northeast structural genomics consortium; 2.60A {Desulfitobacterium hafniense} Length = 126 Back     alignment and structure
>1n9l_A PHOT-LOV1, putative blue light receptor; phototropin, flavin, electron transport; HET: FMN; 1.90A {Chlamydomonas reinhardtii} SCOP: d.110.3.6 PDB: 1n9n_A* 1n9o_A* Length = 109 Back     alignment and structure
>1wa9_A Period circadian protein; PAS domain, circadian rhythm, clock protein, phosphorylation, polymorphism; 3.15A {Drosophila melanogaster} PDB: 3gec_A Length = 368 Back     alignment and structure
>3f1p_A Endothelial PAS domain-containing protein 1; PAS domain, heterodimer, internal cavity, activator, angiogenesis, congenital erythrocytosis; 1.17A {Homo sapiens} PDB: 3f1o_A* 3f1n_A 3h7w_A* 3h82_A* 1p97_A 2a24_A Length = 117 Back     alignment and structure
>2z6d_A Phototropin-2; PAS-fold, LOV-fold, alternative splicing, ATP-binding, chromophore, flavoprotein, FMN, kinase, membrane, nucleotide-binding; HET: FMN; 2.00A {Arabidopsis thaliana} PDB: 2z6c_A* Length = 130 Back     alignment and structure
>3clo_A Transcriptional regulator; NP_811094.1, bacterial regulatory proteins, LUXR family, structural genomics; 2.04A {Bacteroides thetaiotaomicron vpi-5482} Length = 258 Back     alignment and structure
>3luq_A Sensor protein; PAS, histidine, kinase, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: PGE; 2.49A {Geobacter sulfurreducens} Length = 114 Back     alignment and structure
>3gdi_A Period circadian protein homolog 2; tandem PAS domains, biological rhythms, cytoplasm, nucleus, phosphoprotein, transcription; 2.40A {Mus musculus} Length = 309 Back     alignment and structure
>3cax_A Uncharacterized protein PF0695; structural genomics, unknown function, PSI-2, protein structure initiative; 2.43A {Pyrococcus furiosus dsm 3638} Length = 369 Back     alignment and structure
>3mqq_A Transcriptional regulator, LUXR family; PAS domain, PSI, MCSG, structural genomics, center for structural genomics; 1.65A {Burkholderia thailandensis} PDB: 3mqo_A Length = 120 Back     alignment and structure
>3mxq_A Sensor protein; PSI2, MCSG, structural genomics, protein structure initiativ midwest center for structural genomics; 2.78A {Vibrio cholerae o1 biovar el tor} Length = 152 Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Length = 332 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target963 sensory box/GGDEF family protein [Candidatus Liberibact
3hvb_A437 Protein FIMX; EAL phosphodiesterase, biofilm, C-DI-GMP, 100.0
3hv8_A268 Protein FIMX; EAL phosphodiesterase, biofilm, C-DI-GMP, 100.0
2r6o_A294 Putative diguanylate cyclase/phosphodiesterase (ggdef & 100.0
3gfz_A413 Klebsiella pneumoniae BLRP1; TIM-barrel, EAL domain, BL 100.0
3pfm_A243 Ggdef domain protein; PSI2, MCSG, structural genomics, 100.0
2bas_A 431 YKUI protein; EAL domain, structural genom protein stru 100.0
3kzp_A235 LMO0111 protein, putative diguanylate cyclase/phosphodi 100.0
1w25_A459 Stalked-cell differentiation controlling protein; two-c 100.0
3ezu_A342 Ggdef domain protein; multidomain protein of unknown fu 99.96
3bre_A358 Probable two-component response regulator; protein-nucl 99.96
3mtk_A178 Diguanylate cyclase/phosphodiesterase; structural genom 99.95
3hva_A177 Protein FIMX; ggdef diguanylate cyclase, biofilm, C-DI- 99.94
3ign_A177 Diguanylate cyclase; ggdef domain, A1U3W3_marav, NESG, 99.94
3icl_A171 EAL/ggdef domain protein; structural genomics, PSI-2, p 99.93
3i5c_A206 Fusion of general control protein GCN4 and WSPR R regul 99.92
3hvw_A176 Diguanylate-cyclase (DGC); alpha-beta protein., structu 99.82
3nja_A125 Probable ggdef family protein; structural genomics, PSI 99.76
3mr0_A142 Sensory box histidine kinase/response regulator; PAS fo 99.76
3eeh_A125 Putative light and redox sensing histidine kinase; stru 99.7
3h9w_A115 Diguanylate cyclase with PAS/PAC sensor; alpha-beta pro 99.55
2wkq_A332 NPH1-1, RAS-related C3 botulinum toxin substrate 1; tra 99.49
2gj3_A120 Nitrogen fixation regulatory protein; PAS domain, FAD, 99.46
3lyx_A124 Sensory BOX/ggdef domain protein; structural genomics, 99.45
2v0u_A146 NPH1-1, LOV2; kinase, transferase, ATP-binding, serine/ 99.43
2z6d_A130 Phototropin-2; PAS-fold, LOV-fold, alternative splicing 99.42
1v9y_A167 Heme PAS sensor protein; signaling protein; HET: HEM; 1 99.36
3icy_A118 Sensor protein; sensory box histidine kinase/response r 99.36
2vlg_A111 Sporulation kinase A; histidine kinase, two-component r 99.36
2pr5_A132 Blue-light photoreceptor; light-oxygen-voltage, LOV, PE 99.34
3f1p_B121 ARYL hydrocarbon receptor nuclear translocator; PAS dom 99.33
3bwl_A126 Sensor protein; structural genomics, APC87707.1, PAS do 99.3
1d06_A130 Nitrogen fixation regulatory protein FIXL; oxygen senso 99.26
2r78_A117 Sensor protein; sensory box sensor histidine kinase/res 99.25
1n9l_A109 PHOT-LOV1, putative blue light receptor; phototropin, f 99.24
3f1p_A117 Endothelial PAS domain-containing protein 1; PAS domain 99.24
3mxq_A152 Sensor protein; PSI2, MCSG, structural genomics, protei 99.22
1wa9_A368 Period circadian protein; PAS domain, circadian rhythm, 99.21
1byw_A110 Protein (human ERG potassium channel); PAS domain, pota 99.21
3mjq_A126 Uncharacterized protein; NESG, structural genomics, PSI 99.2
3cax_A369 Uncharacterized protein PF0695; structural genomics, un 99.2
2vv6_A119 FIXL, sensor protein FIXL; signaling protein, transfera 99.19
3luq_A114 Sensor protein; PAS, histidine, kinase, PSI, MCSG, stru 99.16
3k3c_A158 Protein RV1364C/MT1410; sensor, PAS, signal transductio 99.15
3mqq_A120 Transcriptional regulator, LUXR family; PAS domain, PSI 99.14
3mfx_A129 Sensory BOX/ggdef family protein; alpha-beta protein, s 99.09
3kx0_X185 Uncharacterized protein RV1364C/MT1410; PAS domain, sen 99.07
2qkp_A151 Uncharacterized protein; structural genomics, unknown f 99.06
3olo_A118 Two-component sensor histidine kinase; structural genom 98.92
3ewk_A227 Sensor protein; PAS domain, alpha/beta fold, kinase, ph 98.91
3clo_A258 Transcriptional regulator; NP_811094.1, bacterial regul 98.9
3fc7_A125 HTR-like protein, sensor protein; APC87712.1, HTR-like 98.89
3d72_A149 Vivid PAS protein VVD; circadian, photoreceptor, blue-l 98.87
3gdi_A309 Period circadian protein homolog 2; tandem PAS domains, 98.59
3fg8_A118 Uncharacterized protein RHA05790; PAS domain, structura 98.58
1oj5_A132 Steroid receptor coactivator 1A; transcriptional coacti 98.44
1wa9_A368 Period circadian protein; PAS domain, circadian rhythm, 98.42
3b33_A115 Sensor protein; structural genomics, PAS domain, nitrog 98.37
1ll8_A114 PAS kinase; PAS domain, ligand binding, ligand screenin 98.35
1nwz_A125 PYP, photoactive yellow protein; PAS, LOV, GAF, domains 98.26
3a0r_A349 Sensor protein; four helix bundle, PAS fold, kinase, ph 98.21
3a0s_A96 Sensor protein; PAS-fold, kinase, phosphoprotein, trans 98.11
1mzu_A129 PPR; photoactive yellow protein, PAS, PYP, signaling pr 98.08
2w0n_A118 Sensor protein DCUS; signal transduction, two-component 97.73
2jhe_A190 Transcription regulator TYRR; aromatic hydrocarbons cat 97.52
3jyb_A145 Sensor protein; beta barrel, carbohydrate binding domai 99.74
2xbz_A171 RETS-hybrid sensor kinase; phosphoprotein, biofilm, tra 99.72
3gdi_A309 Period circadian protein homolog 2; tandem PAS domains, 99.6
3ewk_A227 Sensor protein; PAS domain, alpha/beta fold, kinase, ph 99.2
2ool_A337 Sensor protein; bacteriophytochrome, photoconversion, p 96.96
1i3c_A149 Response regulator RCP1; phytochrome, signaling protein 96.54
3kht_A144 Response regulator; PSI-II, structural genomics, protei 96.18
3heb_A152 Response regulator receiver domain protein (CHEY); NYSG 96.14
3c3m_A138 Response regulator receiver protein; structural genomic 96.09
1mb3_A124 Cell division response regulator DIVK; signal transduct 95.92
3cnb_A143 DNA-binding response regulator, MERR family; signal rec 95.87
1k68_A140 Phytochrome response regulator RCPA; phosphorylated asp 95.84
1p6q_A129 CHEY2; chemotaxis, signal transduction, response regula 95.81
1jbe_A128 Chemotaxis protein CHEY; signaling protein; 1.08A {Esch 95.75
3gl9_A122 Response regulator; beta-sheet, surrounded by alpha hel 95.65
1dz3_A130 Stage 0 sporulation protein A; response regulator, doma 95.53
2gkg_A127 Response regulator homolog; social motility, receiver d 95.48
1k66_A149 Phytochrome response regulator RCPB; CHEY homologue, ho 95.47
2qvg_A143 Two component response regulator; NYSGXRC, PSI-2, struc 95.4
1srr_A124 SPO0F, sporulation response regulatory protein; asparta 95.37
2zay_A147 Response regulator receiver protein; structural genomic 95.34
3lte_A132 Response regulator; structural genomics, PSI, protein s 95.27
3i42_A127 Response regulator receiver domain protein (CHEY- like) 95.2
3gt7_A154 Sensor protein; structural genomics, signal receiver do 95.12
2qxy_A142 Response regulator; regulation of transcription, NYSGXR 94.69
3nhm_A133 Response regulator; protein structure initiative II(PSI 94.58
1tmy_A120 CHEY protein, TMY; chemotaxis, phosphoryl transfer, sig 94.48
3crn_A132 Response regulator receiver domain protein, CHEY- like; 93.9
3cfy_A137 Putative LUXO repressor protein; structural genomics, u 93.76
1qkk_A155 DCTD, C4-dicarboxylate transport transcriptional regula 93.69
2jk1_A139 HUPR, hydrogenase transcriptional regulatory protein HU 93.5
3cg4_A142 Response regulator receiver domain protein (CHEY- like) 93.27
3m6m_D143 Sensory/regulatory protein RPFC; RPFF, REC, enoyl-COA h 93.23
1dcf_A136 ETR1 protein; beta-alpha five sandwich, transferase; 2. 93.14
2j48_A119 Two-component sensor kinase; pseudo-receiver, circadian 93.08
3b2n_A133 Uncharacterized protein Q99UF4; structural genomics, PS 92.82
1dbw_A126 Transcriptional regulatory protein FIXJ; doubly wound f 92.79
3grc_A140 Sensor protein, kinase; protein structure initiative II 92.61
2rjn_A154 Response regulator receiver:metal-dependent phosphohydr 92.52
1mvo_A136 PHOP response regulator; phosphate regulon, transcripti 92.18
2pl1_A121 Transcriptional regulatory protein PHOP; CHEY-like fold 92.17
3f6c_A134 Positive transcription regulator EVGA; structural genom 92.11
2ayx_A254 Sensor kinase protein RCSC; two independent structural 92.09
2a9o_A120 Response regulator; essential protein, YYCF/YYCG homolo 92.04
3luf_A259 Two-component system response regulator/ggdef domain pr 92.02
3hzh_A157 Chemotaxis response regulator (CHEY-3); phosphatase, co 91.73
2jba_A127 Phosphate regulon transcriptional regulatory protein PH 91.32
3eul_A152 Possible nitrate/nitrite response transcriptional regul 91.27
3h1g_A129 Chemotaxis protein CHEY homolog; sulfate-bound CHEY, cy 91.26
2r25_B133 Osmosensing histidine protein kinase SLN1; alpha5-BETA5 91.24
3f6p_A120 Transcriptional regulatory protein YYCF; unphosphorelat 91.22
3c97_A140 Signal transduction histidine kinase; structural genomi 90.95
3kto_A136 Response regulator receiver protein; PSI-II,structural 90.86
3hv2_A153 Response regulator/HD domain protein; PSI-2, NYSGXRC, s 90.78
2qsj_A154 DNA-binding response regulator, LUXR family; structural 90.59
3hdg_A137 Uncharacterized protein; two-component sensor activity, 90.55
3eod_A130 Protein HNR; response regulator, phosphoprotein, two-co 90.43
3igs_A232 N-acetylmannosamine-6-phosphate 2-epimerase 2; energy m 90.34
3a10_A116 Response regulator; phosphoacceptor, signaling protein; 90.22
3cu5_A141 Two component transcriptional regulator, ARAC family; s 90.15
2p0o_A372 Hypothetical protein DUF871; structural genomics, TIM b 94.05
3et6_A190 Soluble guanylyl cyclase beta; guanylate cyclase, dimet 93.81