254780476

254780476

two component response regulator

GeneID in NCBI database:8209465Locus tag:CLIBASIA_01805
Protein GI in NCBI database:254780476Protein Accession:YP_003064889.1
Gene range:-(398455, 398826)Protein Length:123aa
Gene description:two component response regulator
COG prediction:[T] FOG: CheY-like receiver
KEGG prediction:two component response regulator; K11443 two-component system, cell cycle response regulator DivK
SEED prediction:PUTATIVE 2-COMPONENT RECEIVER DOMAIN PROTEIN
Pathway involved in KEGG:Two-component system [PATH:las02020]
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120---
MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA
cccEEEEEcccHHHHHHHHHHHHHcccEEEEEccHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHccccccccEEEEcccccHHHHHHHHHccccEEEEccccHHHHHHHHHHHHHcc
cccEEEEEcccHHHHHHHHHHHHHcccEEEEEccHHHHHHHHHHHcccEEEEEcEccccEHHHHHHHHHcccccccccEEEEEccccHHHHHHHHHccccEEEEccccHHHHHHHHHHHHHcc
MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEITKQikedselqeiPVIAVTAFAMKGDEERIRKGgceayiskpiSLSIFMETIKKYIGEA
MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEITKQIkedselqeipVIAVTAFAMKGDEERIRKGGceayiskpislsiFMETIKKYIGEA
MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA
MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE*
MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA
*LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target123 two component response regulator [Candidatus Liberibact
254780450803 two-component sensor histidine kinase/response reg 4e-06
254780893 236 two component response regulator [Candidatus Liber 5e-06
254780312122 response regulator receiver protein [Candidatus Li 9e-06
>gi|254780450|ref|YP_003064863.1| two-component sensor histidine kinase/response regulator hybrid protein [Candidatus Liberibacter asiaticus str. psy62] Length = 803 Back     alignment
 Score = 41.6 bits (96), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 25/107 (23%), Positives = 58/107 (54%), Gaps = 4/107 (3%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELAR--QHKPDVIIMDIQLQEISGL 62
           V++VED +   +  + ++ET GY   +  +G +AL++    Q + D++I D+ + E+ G 
Sbjct: 684 VLLVEDEDSVRRGSKRMLETRGYTVHEAFSGTDALKVMEKLQGRVDIVISDVVMPEMDGP 743

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISL 109
            + +++++      +  I ++ +A     + + K    +++SKP SL
Sbjct: 744 TLLRELRK--TYPSLKFIFISGYAEDAFSKNLPKDAKFSFLSKPFSL 788

>gi|254780893|ref|YP_003065306.1| two component response regulator [Candidatus Liberibacter asiaticus str. psy62] Length = 236 Back     alignment
 Score = 41.2 bits (95), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 24/105 (22%), Positives = 55/105 (52%), Gaps = 2/105 (1%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           +++++ED++        ++++  +    T  G + +EL + ++ D II+D+ L +I G E
Sbjct: 2   RILLIEDDKALAHSIELMLKSENFNVYVTDLGEDGIELCKFYEFDAIILDLGLTDIPGFE 61

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPIS 108
           + + ++        PV  ++  +   D+ R  + G + YISKP +
Sbjct: 62  VLRALRVAK--ISTPVCILSGMSSIEDKVRGLQSGADDYISKPFN 104

>gi|254780312|ref|YP_003064725.1| response regulator receiver protein [Candidatus Liberibacter asiaticus str. psy62] Length = 122 Back     alignment
 Score = 40.4 bits (93), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 25/121 (20%), Positives = 57/121 (47%), Gaps = 4/121 (3%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +K+++ ED++   +     +  +GY  +   NG  A +  R+    +++ DI + E+ 
Sbjct: 1   MNQKILLAEDDDDMRRFLIKALGKAGYEVVSCNNGASAYDKVREEPFSLLLTDIVMPEMD 60

Query: 61  GLEITKQIKE-DSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
           G+E+ ++  E D +L+ + +    A A+  D    +       +SKP  L   +  + + 
Sbjct: 61  GIELARRATELDPDLKVMFITGFAAVALNPDSNAPKNAKV---LSKPFHLRDLVNEVNRL 117

Query: 120 I 120
           +
Sbjct: 118 L 118

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target123 two component response regulator [Candidatus Liberibact
315122068123 two component response regulator [Candidatus Liberibact 1 5e-59
222148303123 two component response regulator [Agrobacterium vitis S 1 3e-52
15965046123 putative 2-component receiver domain protein [Sinorhizo 1 1e-51
227821648149 putative response regulator in two-component regulatory 1 3e-51
86357266123 two-component response regulator protein [Rhizobium etl 1 3e-51
319783843123 response regulator receiver [Mesorhizobium ciceri biova 1 5e-51
222085607133 two-component response regulator protein [Agrobacterium 1 6e-51
260463924138 response regulator receiver protein [Mesorhizobium oppo 1 1e-50
218678690123 response regulator receiver protein [Rhizobium etli CIA 1 2e-50
159184699123 two component response regulator [Agrobacterium tumefac 1 2e-50
>gi|315122068|ref|YP_004062557.1| two component response regulator [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 123 Back     alignment and organism information
 Score =  230 bits (587), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 112/123 (91%), Positives = 121/123 (98%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KKVMIVEDNELNMKLFRDLIETSGY+++QTR+G+EALE+ARQHKPD+IIMDIQL EIS
Sbjct: 1   MPKKVMIVEDNELNMKLFRDLIETSGYMSIQTRSGLEALEIARQHKPDIIIMDIQLPEIS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLEITKQIKED+ELQ+IPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI
Sbjct: 61  GLEITKQIKEDNELQDIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120

Query: 121 GEA 123
           GEA
Sbjct: 121 GEA 123


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222148303|ref|YP_002549260.1| two component response regulator [Agrobacterium vitis S4] Length = 123 Back     alignment and organism information
>gi|15965046|ref|NP_385399.1| putative 2-component receiver domain protein [Sinorhizobium meliloti 1021] Length = 123 Back     alignment and organism information
>gi|227821648|ref|YP_002825618.1| putative response regulator in two-component regulatory system [Sinorhizobium fredii NGR234] Length = 149 Back     alignment and organism information
>gi|86357266|ref|YP_469158.1| two-component response regulator protein [Rhizobium etli CFN 42] Length = 123 Back     alignment and organism information
>gi|319783843|ref|YP_004143319.1| response regulator receiver [Mesorhizobium ciceri biovar biserrulae WSM1271] Length = 123 Back     alignment and organism information
>gi|222085607|ref|YP_002544137.1| two-component response regulator protein [Agrobacterium radiobacter K84] Length = 133 Back     alignment and organism information
>gi|260463924|ref|ZP_05812120.1| response regulator receiver protein [Mesorhizobium opportunistum WSM2075] Length = 138 Back     alignment and organism information
>gi|218678690|ref|ZP_03526587.1| response regulator receiver protein [Rhizobium etli CIAT 894] Length = 123 Back     alignment and organism information
>gi|159184699|ref|NP_354304.2| two component response regulator [Agrobacterium tumefaciens str. C58] Length = 123 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target123 two component response regulator [Candidatus Liberibact
PRK11107 919 PRK11107, PRK11107, hybrid sensory histidine kinase Bar 7e-21
pfam00072111 pfam00072, Response_reg, Response regulator receiver do 4e-20
COG0784130 COG0784, CheY, FOG: CheY-like receiver [Signal transduc 2e-16
TIGR02154 226 TIGR02154, PhoB, phosphate regulon transcriptional regu 2e-16
COG3437 360 COG3437, COG3437, Response regulator containing a CheY- 3e-15
KOG0519786 KOG0519, KOG0519, KOG0519, Sensory transduction histidi 2e-14
PRK15347 921 PRK15347, PRK15347, two component system sensor kinase 3e-14
PRK11091 779 PRK11091, PRK11091, aerobic respiration control sensor 4e-14
PRK09581 457 PRK09581, pleD, response regulator PleD; Reviewed 1e-13
COG0745 229 COG0745, OmpR, Response regulators consisting of a CheY 7e-13
COG2204 464 COG2204, AtoC, Response regulator containing CheY-like 7e-13
COG2197211 COG2197, CitB, Response regulator containing a CheY-lik 3e-12
COG4753 475 COG4753, COG4753, Response regulator containing CheY-li 2e-11
TIGR02956 968 TIGR02956, TMAO_torS, TMAO reductase sytem sensor TorS 2e-11
COG2201 350 COG2201, CheB, Chemotaxis response regulator containing 3e-11
COG3706 435 COG3706, PleD, Response regulator containing a CheY-lik 2e-10
PRK11361 457 PRK11361, PRK11361, acetoacetate metabolism regulatory 5e-10
PRK09191261 PRK09191, PRK09191, two-component response regulator; P 1e-09
PRK10365 441 PRK10365, PRK10365, transcriptional regulatory protein 5e-09
PRK00742 354 PRK00742, PRK00742, chemotaxis-specific methylesterase; 5e-09
TIGR01387 218 TIGR01387, cztR_silR_copR, heavy metal response regulat 7e-09
PRK10841924 PRK10841, PRK10841, hybrid sensory kinase in two-compon 7e-09
PRK10161 229 PRK10161, PRK10161, transcriptional regulator PhoB; Pro 7e-09
CHL00148 240 CHL00148, orf27, Ycf27; Reviewed 2e-08
PRK10710 240 PRK10710, PRK10710, DNA-binding transcriptional regulat 2e-08
TIGR02875 262 TIGR02875, spore_0_A, sporulation transcription factor 3e-08
PRK10610129 PRK10610, PRK10610, chemotaxis regulatory protein CheY; 3e-08
COG3947 361 COG3947, COG3947, Response regulator containing CheY-li 5e-08
COG4566202 COG4566, TtrR, Response regulator [Signal transduction 7e-08
COG3707194 COG3707, AmiR, Response regulator with putative antiter 1e-07
PRK11517 223 PRK11517, PRK11517, transcriptional regulatory protein 1e-07
COG4565 224 COG4565, CitB, Response regulator of citrate/malate met 4e-07
PRK11697 238 PRK11697, PRK11697, putative two-component response-reg 6e-07
PRK15369211 PRK15369, PRK15369, two component system sensor kinase 8e-07
PRK10529 225 PRK10529, PRK10529, DNA-binding transcriptional activat 1e-06
PRK12555 337 PRK12555, PRK12555, chemotaxis-specific methylesterase; 1e-06
PRK10403215 PRK10403, PRK10403, transcriptional regulator NarP; Pro 1e-06
PRK10766 221 PRK10766, PRK10766, DNA-binding transcriptional regulat 2e-06
PRK10651216 PRK10651, PRK10651, transcriptional regulator NarL; Pro 4e-06
PLN03029222 PLN03029, PLN03029, type-a response regulator protein; 6e-06
COG4567182 COG4567, COG4567, Response regulator consisting of a Ch 7e-06
PRK13435145 PRK13435, PRK13435, response regulator; Provisional 8e-06
PRK09836 227 PRK09836, PRK09836, DNA-binding transcriptional activat 9e-06
COG3706 435 COG3706, PleD, Response regulator containing a CheY-lik 1e-05
PRK15115 444 PRK15115, PRK15115, response regulator GlrR; Provisiona 3e-05
COG3279 244 COG3279, LytT, Response regulator of the LytR/AlgR fami 4e-05
TIGR03787 227 TIGR03787, marine_sort_RR, proteobacterial dedicated so 4e-05
PRK10693 303 PRK10693, PRK10693, response regulator of RpoS; Provisi 1e-04
PRK09483217 PRK09483, PRK09483, response regulator; Provisional 1e-04
PRK10923 469 PRK10923, glnG, nitrogen regulation protein NR(I); Prov 1e-04
PRK10955 232 PRK10955, PRK10955, DNA-binding transcriptional regulat 2e-04
TIGR01818 463 TIGR01818, ntrC, nitrogen regulation protein NR(I) 3e-04
PRK09958204 PRK09958, PRK09958, DNA-binding transcriptional activat 6e-04
PRK15479 221 PRK15479, PRK15479, transcriptional regulatory protein 0.001
cd00156113 cd00156, REC, Signal receiver domain; originally though 3e-20
smart0044855 smart00448, REC, cheY-homologous receiver domain 6e-11
PRK11173 237 PRK11173, PRK11173, two-component response regulator; P 0.001
PRK11083 228 PRK11083, PRK11083, DNA-binding response regulator CreB 6e-08
>gnl|CDD|182968 PRK11107, PRK11107, hybrid sensory histidine kinase BarA; Provisional Back     alignment and domain information
>gnl|CDD|143854 pfam00072, Response_reg, Response regulator receiver domain Back     alignment and domain information
>gnl|CDD|31127 COG0784, CheY, FOG: CheY-like receiver [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|131209 TIGR02154, PhoB, phosphate regulon transcriptional regulatory protein PhoB Back     alignment and domain information
>gnl|CDD|33243 COG3437, COG3437, Response regulator containing a CheY-like receiver domain and an HD-GYP domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|35739 KOG0519, KOG0519, KOG0519, Sensory transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|185245 PRK15347, PRK15347, two component system sensor kinase SsrA; Provisional Back     alignment and domain information
>gnl|CDD|182956 PRK11091, PRK11091, aerobic respiration control sensor protein ArcB; Provisional Back     alignment and domain information
>gnl|CDD|181966 PRK09581, pleD, response regulator PleD; Reviewed Back     alignment and domain information
>gnl|CDD|31088 COG0745, OmpR, Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>gnl|CDD|32386 COG2204, AtoC, Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|32379 COG2197, CitB, Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>gnl|CDD|34367 COG4753, COG4753, Response regulator containing CheY-like receiver domain and AraC-type DNA-binding domain [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|163083 TIGR02956, TMAO_torS, TMAO reductase sytem sensor TorS Back     alignment and domain information
>gnl|CDD|32383 COG2201, CheB, Chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain [Cell motility and secretion / Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|33501 COG3706, PleD, Response regulator containing a CheY-like receiver domain and a GGDEF domain [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|183099 PRK11361, PRK11361, acetoacetate metabolism regulatory protein AtoC; Provisional Back     alignment and domain information
>gnl|CDD|181686 PRK09191, PRK09191, two-component response regulator; Provisional Back     alignment and domain information
>gnl|CDD|182412 PRK10365, PRK10365, transcriptional regulatory protein ZraR; Provisional Back     alignment and domain information
>gnl|CDD|179106 PRK00742, PRK00742, chemotaxis-specific methylesterase; Provisional Back     alignment and domain information
>gnl|CDD|130454 TIGR01387, cztR_silR_copR, heavy metal response regulator Back     alignment and domain information
>gnl|CDD|182772 PRK10841, PRK10841, hybrid sensory kinase in two-component regulatory system with RcsB and YojN; Provisional Back     alignment and domain information
>gnl|CDD|182277 PRK10161, PRK10161, transcriptional regulator PhoB; Provisional Back     alignment and domain information
>gnl|CDD|164540 CHL00148, orf27, Ycf27; Reviewed Back     alignment and domain information
>gnl|CDD|182665 PRK10710, PRK10710, DNA-binding transcriptional regulator BaeR; Provisional Back     alignment and domain information
>gnl|CDD|131922 TIGR02875, spore_0_A, sporulation transcription factor Spo0A Back     alignment and domain information
>gnl|CDD|170568 PRK10610, PRK10610, chemotaxis regulatory protein CheY; Provisional Back     alignment and domain information
>gnl|CDD|33728 COG3947, COG3947, Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|34204 COG4566, TtrR, Response regulator [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|33502 COG3707, AmiR, Response regulator with putative antiterminator output domain [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|183172 PRK11517, PRK11517, transcriptional regulatory protein YedW; Provisional Back     alignment and domain information
>gnl|CDD|34203 COG4565, CitB, Response regulator of citrate/malate metabolism [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|183278 PRK11697, PRK11697, putative two-component response-regulatory protein YehT; Provisional Back     alignment and domain information
>gnl|CDD|185267 PRK15369, PRK15369, two component system sensor kinase SsrB; Provisional Back     alignment and domain information
>gnl|CDD|182522 PRK10529, PRK10529, DNA-binding transcriptional activator KdpE; Provisional Back     alignment and domain information
>gnl|CDD|183591 PRK12555, PRK12555, chemotaxis-specific methylesterase; Provisional Back     alignment and domain information
>gnl|CDD|182431 PRK10403, PRK10403, transcriptional regulator NarP; Provisional Back     alignment and domain information
>gnl|CDD|182711 PRK10766, PRK10766, DNA-binding transcriptional regulator TorR; Provisional Back     alignment and domain information
>gnl|CDD|182619 PRK10651, PRK10651, transcriptional regulator NarL; Provisional Back     alignment and domain information
>gnl|CDD|178599 PLN03029, PLN03029, type-a response regulator protein; Provisional Back     alignment and domain information
>gnl|CDD|34205 COG4567, COG4567, Response regulator consisting of a CheY-like receiver domain and a Fis-type HTH domain [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>gnl|CDD|184052 PRK13435, PRK13435, response regulator; Provisional Back     alignment and domain information
>gnl|CDD|182102 PRK09836, PRK09836, DNA-binding transcriptional activator CusR; Provisional Back     alignment and domain information
>gnl|CDD|33501 COG3706, PleD, Response regulator containing a CheY-like receiver domain and a GGDEF domain [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|185070 PRK15115, PRK15115, response regulator GlrR; Provisional Back     alignment and domain information
>gnl|CDD|33090 COG3279, LytT, Response regulator of the LytR/AlgR family [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|163499 TIGR03787, marine_sort_RR, proteobacterial dedicated sortase system response regulator Back     alignment and domain information
>gnl|CDD|182652 PRK10693, PRK10693, response regulator of RpoS; Provisional Back     alignment and domain information
>gnl|CDD|181897 PRK09483, PRK09483, response regulator; Provisional Back     alignment and domain information
>gnl|CDD|182842 PRK10923, glnG, nitrogen regulation protein NR(I); Provisional Back     alignment and domain information
>gnl|CDD|182864 PRK10955, PRK10955, DNA-binding transcriptional regulator CpxR; Provisional Back     alignment and domain information
>gnl|CDD|162545 TIGR01818, ntrC, nitrogen regulation protein NR(I) Back     alignment and domain information
>gnl|CDD|182168 PRK09958, PRK09958, DNA-binding transcriptional activator EvgA; Provisional Back     alignment and domain information
>gnl|CDD|185376 PRK15479, PRK15479, transcriptional regulatory protein TctD; Provisional Back     alignment and domain information
>gnl|CDD|29071 cd00156, REC, Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; contains a phosphoacceptor site that is phosphorylated by histidine kinase homologs; usually found N-terminal to a DNA binding effector domain; forms homodimers Back     alignment and domain information
>gnl|CDD|128724 smart00448, REC, cheY-homologous receiver domain Back     alignment and domain information
>gnl|CDD|183013 PRK11173, PRK11173, two-component response regulator; Provisional Back     alignment and domain information
>gnl|CDD|182950 PRK11083, PRK11083, DNA-binding response regulator CreB; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 123 two component response regulator [Candidatus Liberibact
TIGR02154 226 PhoB phosphate regulon transcriptional regulatory prote 100.0
PRK11107 920 hybrid sensory histidine kinase BarA; Provisional 100.0
PRK09581 457 pleD response regulator PleD; Reviewed 100.0
PRK10841947 hybrid sensory kinase in two-component regulatory syste 100.0
PRK10161 229 transcriptional regulator PhoB; Provisional 100.0
PRK11091 779 aerobic respiration control sensor protein ArcB; Provis 100.0
PRK09959 1197 hybrid sensory histidine kinase in two-component regula 99.97
PRK10610129 chemotaxis regulatory protein CheY; Provisional 99.97
PRK10693 337 response regulator of RpoS; Provisional 99.97
PRK10923 469 glnG nitrogen regulation protein NR(I); Provisional 99.97
TIGR01387 219 cztR_silR_copR heavy metal response regulator; InterPro 99.97
CHL00148 240 orf27 Ycf27; Reviewed 99.97
PRK11466 912 hybrid sensory histidine kinase TorS; Provisional 99.97
PRK11083 229 DNA-binding response regulator CreB; Provisional 99.97
PRK09836 226 DNA-binding transcriptional activator CusR; Provisional 99.97
PRK10336219 DNA-binding transcriptional regulator QseB; Provisional 99.97
PRK10701 240 DNA-binding transcriptional regulator RstA; Provisional 99.97
pfam00072111 Response_reg Response regulator receiver domain. This d 99.97
PRK11517 223 transcriptional regulatory protein YedW; Provisional 99.96
PRK11361 457 acetoacetate metabolism regulatory protein AtoC; Provis 99.96
PRK09468 239 ompR osmolarity response regulator; Provisional 99.96
PRK10955 232 DNA-binding transcriptional regulator CpxR; Provisional 99.96
PRK10529 225 DNA-binding transcriptional activator KdpE; Provisional 99.96
PRK10766 224 DNA-binding transcriptional regulator TorR; Provisional 99.96
cd00156113 REC Signal receiver domain; originally thought to be un 99.96
PRK11173 237 two-component response regulator; Provisional 99.96
COG0745 229 OmpR Response regulators consisting of a CheY-like rece 99.96
PRK10365 441 transcriptional regulatory protein ZraR; Provisional 99.96
PRK13557538 histidine kinase; Provisional 99.96
PRK10046225 dpiA two-component response regulator DpiA; Provisional 99.96
PRK13856 241 two-component response regulator VirG; Provisional 99.96
PRK10710 240 DNA-binding transcriptional regulator BaeR; Provisional 99.95
PRK10643 222 DNA-binding transcriptional regulator BasR; Provisional 99.95
KOG0519786 consensus 99.95
PRK10816 223 DNA-binding transcriptional regulator PhoP; Provisional 99.95
PRK09390202 fixJ response regulator FixJ; Provisional 99.95
PRK10430 239 DNA-binding transcriptional activator DcuR; Provisional 99.94
TIGR02875 270 spore_0_A sporulation transcription factor Spo0A; Inter 99.94
COG2204 464 AtoC Response regulator containing CheY-like receiver, 99.94
COG4753 475 Response regulator containing CheY-like receiver domain 99.94
TIGR02956 1052 TMAO_torS TMAO reductase sytem sensor TorS; InterPro: I 99.94
PRK13435141 response regulator; Provisional 99.93
COG3437 360 Response regulator containing a CheY-like receiver doma 99.92
PRK00742 345 chemotaxis-specific methylesterase; Provisional 99.92
TIGR01818 471 ntrC nitrogen regulation protein NR(I); InterPro: IPR01 99.92
COG3706 435 PleD Response regulator containing a CheY-like receiver 99.92
PRK12555 340 chemotaxis-specific methylesterase; Provisional 99.9
PRK09958204 DNA-binding transcriptional activator EvgA; Provisional 99.89
PRK09483216 response regulator; Provisional 99.89
PRK10651216 transcriptional regulator NarL; Provisional 99.88
PRK10403215 transcriptional regulator NarP; Provisional 99.88
COG4565 224 CitB Response regulator of citrate/malate metabolism [T 99.86
COG4566202 TtrR Response regulator [Signal transduction mechanisms 99.86
PRK09935210 transcriptional regulator FimZ; Provisional 99.86
PRK10360196 DNA-binding transcriptional activator UhpA; Provisional 99.86
COG2197211 CitB Response regulator containing a CheY-like receiver 99.85
COG0784130 CheY FOG: CheY-like receiver [Signal transduction mecha 99.84
PRK13837831 two-component VirA-like sensor kinase; Provisional 99.84
PRK10840216 transcriptional regulator RcsB; Provisional 99.83
PRK11697 239 putative two-component response-regulatory protein YehT 99.83
COG3947 361 Response regulator containing CheY-like receiver and SA 99.8
PRK09191261 two-component response regulator; Provisional 99.8
COG2201 350 CheB Chemotaxis response regulator containing a CheY-li 99.74
TIGR02915 451 PEP_resp_reg putative PEP-CTERM system response regulat 99.73
COG4567182 Response regulator consisting of a CheY-like receiver d 99.69
PRK10100216 DNA-binding transcriptional regulator CsgD; Provisional 99.67
PRK13558 674 bacterio-opsin activator; Provisional 99.62
COG3707194 AmiR Response regulator with putative antiterminator ou 99.61
PRK11475205 DNA-binding transcriptional activator BglJ; Provisional 99.47
COG3279 244 LytT Response regulator of the LytR/AlgR family [Transc 99.37
PRK09581 457 pleD response regulator PleD; Reviewed 99.31
PRK11107 920 hybrid sensory histidine kinase BarA; Provisional 99.28
COG3706 435 PleD Response regulator containing a CheY-like receiver 99.22
pfam06490109 FleQ Flagellar regulatory protein FleQ. This domain is 98.6
cd02067119 B12-binding B12 binding domain (B12-BD). This domain bi 97.24
TIGR01815726 TrpE-clade3 anthranilate synthase; InterPro: IPR010112 97.03
cd02072128 Glm_B12_BD B12 binding domain of glutamate mutase (Glm) 96.35
COG4999140 Uncharacterized domain of BarA-like signal transduction 96.25
PRK02261137 methylaspartate mutase subunit S; Provisional 96.2
cd02070201 corrinoid_protein_B12-BD B12 binding domain of corrinoi 95.82
COG2185143 Sbm Methylmalonyl-CoA mutase, C-terminal domain/subunit 95.82
cd02071122 MM_CoA_mut_B12_BD methylmalonyl CoA mutase B12 binding 95.25
PRK07206 415 hypothetical protein; Provisional 94.54
pfam00563233 EAL EAL domain. This domain is found in diverse bacteri 94.41
PRK09426715 methylmalonyl-CoA mutase; Reviewed 94.11
PRK10551518 hypothetical protein; Provisional 92.33
cd01948240 EAL EAL domain. This domain is found in diverse bacteri 91.51
smart00052241 EAL Putative diguanylate phosphodiesterase. Putative di 91.29
pfam05582287 Peptidase_U57 YabG peptidase U57. YabG is a protease in 91.21
PRK097761116 putative sensor protein; Provisional 91.11
pfam02310121 B12-binding B12 binding domain. This domain binds to B1 91.03
cd02068127 radical_SAM_B12_BD B12 binding domain_like associated w 90.87
TIGR02855292 spore_yabG sporulation peptidase YabG; InterPro: IPR008 90.86
PRK05928252 hemD uroporphyrinogen-III synthase; Reviewed 90.65
COG2200256 Rtn c-di-GMP phosphodiesterase class I (EAL domain) [Si 90.16
PRK10060663 RNase II stability modulator; Provisional 90.01
smart0044855 REC cheY-homologous receiver domain. CheY regulates the 99.14
PRK13566724 anthranilate synthase; Provisional 96.97
pfam03709111 OKR_DC_1_N Orn/Lys/Arg decarboxylase, N-terminal domain 96.61
PRK09522 531 bifunctional anthranilate synthase/anthranilate phospho 95.38
PRK05637208 anthranilate synthase component II; Provisional 95.28
COG0512191 PabA Anthranilate/para-aminobenzoate synthases componen 94.38
PRK06895191 para-aminobenzoate synthase component II; Provisional 92.92
PRK00758184 GMP synthase subunit A; Validated 92.31
>TIGR02154 PhoB phosphate regulon transcriptional regulatory protein PhoB; InterPro: IPR011879 PhoB is a DNA-binding response regulator protein acting with PhoR in a 2-component system responding to phosphate ion Back     alignment and domain information
>PRK11107 hybrid sensory histidine kinase BarA; Provisional Back     alignment and domain information
>PRK09581 pleD response regulator PleD; Reviewed Back     alignment and domain information
>PRK10841 hybrid sensory kinase in two-component regulatory system with RcsB and YojN; Provisional Back     alignment and domain information
>PRK10161 transcriptional regulator PhoB; Provisional Back     alignment and domain information
>PRK11091 aerobic respiration control sensor protein ArcB; Provisional Back     alignment and domain information
>PRK09959 hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional Back     alignment and domain information
>PRK10610 chemotaxis regulatory protein CheY; Provisional Back     alignment and domain information
>PRK10693 response regulator of RpoS; Provisional Back     alignment and domain information
>PRK10923 glnG nitrogen regulation protein NR(I); Provisional Back     alignment and domain information
>TIGR01387 cztR_silR_copR heavy metal response regulator; InterPro: IPR006291 Members of this family contain a response regulator receiver domain and an associated transcriptional regulatory region Back     alignment and domain information
>CHL00148 orf27 Ycf27; Reviewed Back     alignment and domain information
>PRK11466 hybrid sensory histidine kinase TorS; Provisional Back     alignment and domain information
>PRK11083 DNA-binding response regulator CreB; Provisional Back     alignment and domain information
>PRK09836 DNA-binding transcriptional activator CusR; Provisional Back     alignment and domain information
>PRK10336 DNA-binding transcriptional regulator QseB; Provisional Back     alignment and domain information
>PRK10701 DNA-binding transcriptional regulator RstA; Provisional Back     alignment and domain information
>pfam00072 Response_reg Response regulator receiver domain Back     alignment and domain information
>PRK11517 transcriptional regulatory protein YedW; Provisional Back     alignment and domain information
>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional Back     alignment and domain information
>PRK09468 ompR osmolarity response regulator; Provisional Back     alignment and domain information
>PRK10955 DNA-binding transcriptional regulator CpxR; Provisional Back     alignment and domain information
>PRK10529 DNA-binding transcriptional activator KdpE; Provisional Back     alignment and domain information
>PRK10766 DNA-binding transcriptional regulator TorR; Provisional Back     alignment and domain information
>cd00156 REC Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; contains a phosphoacceptor site that is phosphorylated by histidine kinase homologs; usually found N-terminal to a DNA binding effector domain; forms homodimers Back     alignment and domain information
>PRK11173 two-component response regulator; Provisional Back     alignment and domain information
>COG0745 OmpR Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>PRK10365 transcriptional regulatory protein ZraR; Provisional Back     alignment and domain information
>PRK13557 histidine kinase; Provisional Back     alignment and domain information
>PRK10046 dpiA two-component response regulator DpiA; Provisional Back     alignment and domain information
>PRK13856 two-component response regulator VirG; Provisional Back     alignment and domain information
>PRK10710 DNA-binding transcriptional regulator BaeR; Provisional Back     alignment and domain information
>PRK10643 DNA-binding transcriptional regulator BasR; Provisional Back     alignment and domain information
>KOG0519 consensus Back     alignment and domain information
>PRK10816 DNA-binding transcriptional regulator PhoP; Provisional Back     alignment and domain information
>PRK09390 fixJ response regulator FixJ; Provisional Back     alignment and domain information
>PRK10430 DNA-binding transcriptional activator DcuR; Provisional Back     alignment and domain information
>TIGR02875 spore_0_A sporulation transcription factor Spo0A; InterPro: IPR012052 Members of this group are response regulators/transcription factors that contain CheY-like receiver (phosphoacceptor) domain and a unique DNA-binding domain Back     alignment and domain information
>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>COG4753 Response regulator containing CheY-like receiver domain and AraC-type DNA-binding domain [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02956 TMAO_torS TMAO reductase sytem sensor TorS; InterPro: IPR014302 This protein, TorS, is part of a regulatory system for the torCAD operon that encodes the pterin molybdenum cofactor-containing enzyme trimethylamine-N-oxide (TMAO) reductase (TorA), a cognate chaperone (TorD), and a penta-haem cytochrome (TorC) Back     alignment and domain information
>PRK13435 response regulator; Provisional Back     alignment and domain information
>COG3437 Response regulator containing a CheY-like receiver domain and an HD-GYP domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK00742 chemotaxis-specific methylesterase; Provisional Back     alignment and domain information
>TIGR01818 ntrC nitrogen regulation protein NR(I); InterPro: IPR010114 This entry represents Nitrogen regulatory protein C (NtrC), which is a bacterial enhancer-binding protein that activates the transcription of genes encoding enzymes required for nitrogen metabolism Back     alignment and domain information
>COG3706 PleD Response regulator containing a CheY-like receiver domain and a GGDEF domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK12555 chemotaxis-specific methylesterase; Provisional Back     alignment and domain information
>PRK09958 DNA-binding transcriptional activator EvgA; Provisional Back     alignment and domain information
>PRK09483 response regulator; Provisional Back     alignment and domain information
>PRK10651 transcriptional regulator NarL; Provisional Back     alignment and domain information
>PRK10403 transcriptional regulator NarP; Provisional Back     alignment and domain information
>COG4565 CitB Response regulator of citrate/malate metabolism [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>COG4566 TtrR Response regulator [Signal transduction mechanisms] Back     alignment and domain information
>PRK09935 transcriptional regulator FimZ; Provisional Back     alignment and domain information
>PRK10360 DNA-binding transcriptional activator UhpA; Provisional Back     alignment and domain information
>COG2197 CitB Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>COG0784 CheY FOG: CheY-like receiver [Signal transduction mechanisms] Back     alignment and domain information
>PRK13837 two-component VirA-like sensor kinase; Provisional Back     alignment and domain information
>PRK10840 transcriptional regulator RcsB; Provisional Back     alignment and domain information
>PRK11697 putative two-component response-regulatory protein YehT; Provisional Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>PRK09191 two-component response regulator; Provisional Back     alignment and domain information
>COG2201 CheB Chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain [Cell motility and secretion / Signal transduction mechanisms] Back     alignment and domain information
>TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator; InterPro: IPR014264 Members of this protein family share full-length homology with (but do not include) the acetoacetate metabolism regulatory protein AtoC (see Q06065 from SWISSPROT) Back     alignment and domain information
>COG4567 Response regulator consisting of a CheY-like receiver domain and a Fis-type HTH domain [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>PRK10100 DNA-binding transcriptional regulator CsgD; Provisional Back     alignment and domain information
>PRK13558 bacterio-opsin activator; Provisional Back     alignment and domain information
>COG3707 AmiR Response regulator with putative antiterminator output domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK11475 DNA-binding transcriptional activator BglJ; Provisional Back     alignment and domain information
>COG3279 LytT Response regulator of the LytR/AlgR family [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK09581 pleD response regulator PleD; Reviewed Back     alignment and domain information
>PRK11107 hybrid sensory histidine kinase BarA; Provisional Back     alignment and domain information
>COG3706 PleD Response regulator containing a CheY-like receiver domain and a GGDEF domain [Signal transduction mechanisms] Back     alignment and domain information
>pfam06490 FleQ Flagellar regulatory protein FleQ Back     alignment and domain information
>cd02067 B12-binding B12 binding domain (B12-BD) Back     alignment and domain information
>TIGR01815 TrpE-clade3 anthranilate synthase; InterPro: IPR010112 This entry represents a small clade of anthranilate synthases from alpha proteobacteria and Nostoc (a cyanobacterium) Back     alignment and domain information
>cd02072 Glm_B12_BD B12 binding domain of glutamate mutase (Glm) Back     alignment and domain information
>COG4999 Uncharacterized domain of BarA-like signal transduction histidine kinases [Signal transduction mechanisms] Back     alignment and domain information
>PRK02261 methylaspartate mutase subunit S; Provisional Back     alignment and domain information
>cd02070 corrinoid_protein_B12-BD B12 binding domain of corrinoid proteins Back     alignment and domain information
>COG2185 Sbm Methylmalonyl-CoA mutase, C-terminal domain/subunit (cobalamin-binding) [Lipid metabolism] Back     alignment and domain information
>cd02071 MM_CoA_mut_B12_BD methylmalonyl CoA mutase B12 binding domain Back     alignment and domain information
>PRK07206 hypothetical protein; Provisional Back     alignment and domain information
>pfam00563 EAL EAL domain Back     alignment and domain information
>PRK09426 methylmalonyl-CoA mutase; Reviewed Back     alignment and domain information
>PRK10551 hypothetical protein; Provisional Back     alignment and domain information
>cd01948 EAL EAL domain Back     alignment and domain information
>smart00052 EAL Putative diguanylate phosphodiesterase Back     alignment and domain information
>pfam05582 Peptidase_U57 YabG peptidase U57 Back     alignment and domain information
>PRK09776 putative sensor protein; Provisional Back     alignment and domain information
>pfam02310 B12-binding B12 binding domain Back     alignment and domain information
>cd02068 radical_SAM_B12_BD B12 binding domain_like associated with radical SAM domain Back     alignment and domain information
>TIGR02855 spore_yabG sporulation peptidase YabG; InterPro: IPR008764 Peptidases are grouped into clans and families Back     alignment and domain information
>PRK05928 hemD uroporphyrinogen-III synthase; Reviewed Back     alignment and domain information
>COG2200 Rtn c-di-GMP phosphodiesterase class I (EAL domain) [Signal transduction mechanisms] Back     alignment and domain information
>PRK10060 RNase II stability modulator; Provisional Back     alignment and domain information
>smart00448 REC cheY-homologous receiver domain Back     alignment and domain information
>PRK13566 anthranilate synthase; Provisional Back     alignment and domain information
>pfam03709 OKR_DC_1_N Orn/Lys/Arg decarboxylase, N-terminal domain Back     alignment and domain information
>PRK09522 bifunctional anthranilate synthase/anthranilate phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK05637 anthranilate synthase component II; Provisional Back     alignment and domain information
>COG0512 PabA Anthranilate/para-aminobenzoate synthases component II [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PRK06895 para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>PRK00758 GMP synthase subunit A; Validated Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target123 two component response regulator [Candidatus Liberibact
1zes_A125 Bef3- Activated Phob Receiver Domain Length = 125 2e-40
2iyn_A124 The Co-Factor-Induced Pre-Active Conformation In Ph 3e-40
1b00_A127 Phob Receiver Domain From Escherichia Coli Length = 4e-40
1mvo_A136 Crystal Structure Of The Phop Receiver Domain From 5e-40
1nxo_A120 Micarec Ph7.0 Length = 120 2e-39
2jba_A127 Phob Response Regulator Receiver Domain Constitutiv 3e-39
1nxt_A120 Micarec Ph 4.0 Length = 120 3e-39
2jba_B127 Phob Response Regulator Receiver Domain Constitutiv 4e-39
3f6p_A120 Crystal Structure Of Unphosphorelated Receiver Doma 3e-38
2jb9_A127 Phob Response Regulator Receiver Domain Constitutiv 3e-38
2zwm_A130 Crystal Structure Of Yycf Receiver Domain From Baci 3e-38
2wb4_A 459 Activated Diguanylate Cyclase Pled In Complex With 2e-36
2wb4_A 459 Activated Diguanylate Cyclase Pled In Complex With 2e-12
3dge_C122 Structure Of A Histidine Kinase-Response Regulator 9e-36
3gl9_A122 The Structure Of A Histidine Kinase-Response Regula 1e-35
1m5t_A124 Crystal Structure Of The Response Regulator Divk Le 2e-35
1w25_A 459 Response Regulator Pled In Complex With C-Digmp Len 5e-35
1w25_A 459 Response Regulator Pled In Complex With C-Digmp Len 3e-12
2oqr_A 230 The Structure Of The Response Regulator Regx3 From 9e-35
>gi|78101053|pdb|1ZES|A Chain A, Bef3- Activated Phob Receiver Domain Length = 125 Back     alignment and structure
 Score =  168 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 65/122 (53%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +++++VED     ++   ++E +G+  ++  +   A+    +  PD+I++D  L   S
Sbjct: 1   MARRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G++  K +K +S  ++IPV+ +TA   + D  R  + G + YI+KP S    +  IK  +
Sbjct: 61  GIQFIKHLKRESMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVM 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|114794859|pdb|2IYN|A Chain A, The Co-Factor-Induced Pre-Active Conformation In Phob Length = 124 Back     alignment and structure
gi|6573458|pdb|1B00|A Chain A, Phob Receiver Domain From Escherichia Coli Length = 127 Back     alignment and structure
>gi|24987831|pdb|1MVO|A Chain A, Crystal Structure Of The Phop Receiver Domain From Bacillus Subtilis Length = 136 Back     alignment and structure
>gi|46014953|pdb|1NXO|A Chain A, Micarec Ph7.0 Length = 120 Back     alignment and structure
>gi|126031095|pdb|2JBA|A Chain A, Phob Response Regulator Receiver Domain Constitutively- Active Double Mutant D53a And Y102c Length = 127 Back     alignment and structure
>gi|46014956|pdb|1NXT|A Chain A, Micarec Ph 4.0 Length = 120 Back     alignment and structure
>gi|126031096|pdb|2JBA|B Chain B, Phob Response Regulator Receiver Domain Constitutively- Active Double Mutant D53a And Y102c Length = 127 Back     alignment and structure
>gi|290560102|pdb|3F6P|A Chain A, Crystal Structure Of Unphosphorelated Receiver Domain Of Yycf Length = 120 Back     alignment and structure
>gi|126031093|pdb|2JB9|A Chain A, Phob Response Regulator Receiver Domain Constitutively- Active Double Mutant D10a And D53e. Length = 127 Back     alignment and structure
>gi|254220896|pdb|2ZWM|A Chain A, Crystal Structure Of Yycf Receiver Domain From Bacillus Subtilis Length = 130 Back     alignment and structure
>gi|294979306|pdb|2WB4|A Chain A, Activated Diguanylate Cyclase Pled In Complex With C-Di-Gmp Length = 459 Back     alignment and structure
>gi|294979306|pdb|2WB4|A Chain A, Activated Diguanylate Cyclase Pled In Complex With C-Di-Gmp Length = 459 Back     alignment and structure
gi|251836870|pdb|3DGE|C Chain C, Structure Of A Histidine Kinase-Response Regulator Complex Reveals Insights Into Two-Component Signaling And A Novel Cis-Autophosphorylation Mechanism Length = 122 Back     alignment and structure
>gi|262118598|pdb|3GL9|A Chain A, The Structure Of A Histidine Kinase-Response Regulator Complex Sheds Light Into Two-Component Signaling And Reveals A Novel Cis Autophosphorylation Mechanism Length = 122 Back     alignment and structure
>gi|27065585|pdb|1M5T|A Chain A, Crystal Structure Of The Response Regulator Divk Length = 124 Back     alignment and structure
>gi|56966618|pdb|1W25|A Chain A, Response Regulator Pled In Complex With C-Digmp Length = 459 Back     alignment and structure
>gi|56966618|pdb|1W25|A Chain A, Response Regulator Pled In Complex With C-Digmp Length = 459 Back     alignment and structure
>gi|158429258|pdb|2OQR|A Chain A, The Structure Of The Response Regulator Regx3 From Mycobacterium Tuberculosis Length = 230 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target123 two component response regulator [Candidatus Liberibact
1mb3_A124 Cell division response regulator DIVK; signal transduct 8e-29
1w25_A 459 Stalked-cell differentiation controlling protein; two-c 4e-26
1w25_A 459 Stalked-cell differentiation controlling protein; two-c 2e-09
3m6m_D143 Sensory/regulatory protein RPFC; RPFF, REC, enoyl-COA h 3e-24
3nhm_A133 Response regulator; protein structure initiative II(PSI 3e-24
3lte_A132 Response regulator; structural genomics, PSI, protein s 2e-23
3f6p_A120 Transcriptional regulatory protein YYCF; unphosphorelat 2e-23
3eq2_A 394 Probable two-component response regulator; adaptor sigm 8e-23
3i42_A127 Response regulator receiver domain protein (CHEY- like) 8e-23
1jbe_A128 Chemotaxis protein CHEY; signaling protein; 1.08A {Esch 9e-23
3h1g_A129 Chemotaxis protein CHEY homolog; sulfate-bound CHEY, cy 2e-22
3kht_A144 Response regulator; PSI-II, structural genomics, protei 1e-21
3bre_A 358 Probable two-component response regulator; protein-nucl 1e-21
2ayx_A254 Sensor kinase protein RCSC; two independent structural 1e-21
2zwm_A130 Transcriptional regulatory protein YYCF; two-component 2e-21
1k66_A149 Phytochrome response regulator RCPB; CHEY homologue, ho 2e-21
1k68_A140 Phytochrome response regulator RCPA; phosphorylated asp 3e-21
3b2n_A133 Uncharacterized protein Q99UF4; structural genomics, PS 6e-21
3lua_A140 Response regulator receiver protein; two-component sign 1e-20
1srr_A124 SPO0F, sporulation response regulatory protein; asparta 1e-20
1p6q_A129 CHEY2; chemotaxis, signal transduction, response regula 1e-20
1i3c_A149 Response regulator RCP1; phytochrome, signaling protein 2e-20
3f6c_A134 Positive transcription regulator EVGA; structural genom 3e-20
3hdg_A137 Uncharacterized protein; two-component sensor activity, 3e-20
1mvo_A136 PHOP response regulator; phosphate regulon, transcripti 3e-20
1dz3_A130 Stage 0 sporulation protein A; response regulator, doma 5e-20
3gl9_A122 Response regulator; beta-sheet, surrounded by alpha hel 1e-19
3cnb_A143 DNA-binding response regulator, MERR family; signal rec 4e-19
3kyj_B145 CHEY6 protein, putative histidine protein kinase; prote 4e-19
3eul_A152 Possible nitrate/nitrite response transcriptional regul 7e-19
3c97_A140 Signal transduction histidine kinase; structural genomi 7e-19
3hv2_A153 Response regulator/HD domain protein; PSI-2, NYSGXRC, s 8e-19
1tmy_A120 CHEY protein, TMY; chemotaxis, phosphoryl transfer, sig 1e-18
3grc_A140 Sensor protein, kinase; protein structure initiative II 2e-18
1s8n_A205 Putative antiterminator; structural genomics, transcrip 2e-18
1dcf_A136 ETR1 protein; beta-alpha five sandwich; 2.50A {Arabidop 2e-18
1qkk_A155 DCTD, C4-dicarboxylate transport transcriptional regula 3e-18
2jba_A127 Phosphate regulon transcriptional regulatory protein PH 3e-18
1dc7_A124 NTRC, nitrogen regulation protein; receiver domain, pho 3e-18
3n0r_A286 Response regulator; sigma factor, receiver, two-compone 4e-18
3cu5_A141 Two component transcriptional regulator, ARAC family; s 4e-18
2j48_A119 Two-component sensor kinase; pseudo-receiver, circadian 4e-18
3heb_A152 Response regulator receiver domain protein (CHEY); NYSG 6e-18
3hdv_A136 Response regulator; PSI-II, structural genomics, protei 7e-18
3dzd_A 368 Transcriptional regulator (NTRC family); sigma43 activa 7e-18
2qsj_A154 DNA-binding response regulator, LUXR family; structural 9e-18
2zay_A147 Response regulator receiver protein; structural genomic 2e-17
3cz5_A153 Two-component response regulator, LUXR family; structur 2e-17
3cg4_A142 Response regulator receiver domain protein (CHEY- like) 3e-17
2gkg_A127 Response regulator homolog; social motility, receiver d 3e-17
3luf_A259 Two-component system response regulator/ggdef domain pr 3e-17
3kto_A136 Response regulator receiver protein; PSI-II,structural 3e-17
3hzh_A157 Chemotaxis response regulator (CHEY-3); phosphatase, co 4e-17
2qv0_A143 Protein MRKE; structural genomics, transcription, PSI-2 5e-17
2b4a_A138 BH3024; 10175646, structural genomics, joint center for 6e-17
1a2o_A 349 CHEB methylesterase; bacterial chemotaxis, adaptation, 6e-17
3eqz_A135 Response regulator; structural genomics, unknown functi 8e-17
2qvg_A143 Two component response regulator; NYSGXRC, PSI-2, struc 9e-17
3a10_A116 Response regulator; phosphoacceptor, signaling protein; 1e-16
3c3m_A138 Response regulator receiver protein; structural genomic 1e-16
1ny5_A 387 Transcriptional regulator (NTRC family); AAA+ ATPase, s 1e-16
2a9o_A120 Response regulator; essential protein, YYCF/YYCG homolo 3e-16
3eod_A130 Protein HNR; response regulator, phosphoprotein, two-co 4e-16
3cg0_A140 Response regulator receiver modulated diguanylate cycla 6e-16
3cfy_A137 Putative LUXO repressor protein; structural genomics, u 1e-15
3gt7_A154 Sensor protein; structural genomics, signal receiver do 9e-15
2r25_B133 Osmosensing histidine protein kinase SLN1; alpha5-BETA5 1e-14
2qxy_A142 Response regulator; regulation of transcription, NYSGXR 1e-14
1zh2_A121 KDP operon transcriptional regulatory protein KDPE; two 2e-14
2jk1_A139 HUPR, hydrogenase transcriptional regulatory protein HU 2e-14
2qr3_A140 Two-component system response regulator; structural gen 3e-14
3h5i_A140 Response regulator/sensory box protein/ggdef domain pro 4e-14
2rjn_A154 Response regulator receiver:metal-dependent phosphohydr 7e-14
3ilh_A146 Two component response regulator; NYSGXRC, PSI-II, prot 1e-13
3crn_A132 Response regulator receiver domain protein, CHEY- like; 1e-13
3kcn_A151 Adenylate cyclase homolog; SGX, PSI 2, structural genom 2e-13
1zgz_A122 Torcad operon transcriptional regulatory protein TORR; 4e-13
3cwo_X 237 Beta/alpha-barrel protein based on 1THF and 1TMY; XRAY, 7e-13
1xhf_A123 DYE resistance, aerobic respiration control protein ARC 7e-13
2qzj_A136 Two-component response regulator; 11017X, PSI-II, struc 8e-13
1dbw_A126 Transcriptional regulatory protein FIXJ; doubly wound f 9e-13
2rdm_A132 Response regulator receiver protein; structural genomic 1e-12
2pl1_A121 Transcriptional regulatory protein PHOP; CHEY-like fold 1e-12
1qo0_D196 AMIR; binding protein, gene regulator, receptor; 2.25A 2e-11
3klo_A225 Transcriptional regulator VPST; REC domain, HTH domain, 2e-11
2gwr_A 238 DNA-binding response regulator MTRA; two-component regu 4e-11
1kgs_A 225 DRRD, DNA binding response regulator D; DNA-binding pro 3e-10
2oqr_A 230 Sensory transduction protein REGX3; response regulator, 3e-10
1p2f_A 220 Response regulator; DRRB, OMPR/PHOB, transcription; HET 4e-10
1yio_A208 Response regulatory protein; transcription regulation, 9e-10
3jte_A143 Response regulator receiver protein; structural genomic 1e-09
2pln_A137 HP1043, response regulator; signaling protein; 1.80A {H 6e-08
1ys7_A 233 Transcriptional regulatory protein PRRA; response regul 1e-07
1a04_A215 Nitrate/nitrite response regulator protein NARL; signal 1e-05
3luf_A 259 Two-component system response regulator/ggdef domain pr 1e-10
3c3w_A 225 Two component transcriptional regulatory protein DEVR; 6e-08
2hqr_A 223 Putative transcriptional regulator; phosporylation-inde 5e-06
>1mb3_A Cell division response regulator DIVK; signal transduction protein, structural proteomics in europe, spine, structural genomics; 1.41A {Caulobacter vibrioides} SCOP: c.23.1.1 PDB: 1m5u_A 1mav_A 1mb0_A 1m5t_A Length = 124 Back     alignment and structure
 Score =  120 bits (303), Expect = 8e-29
 Identities = 85/118 (72%), Positives = 102/118 (86%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           KKV+IVEDNELNMKLF DL+E  GY  LQTR G+ AL +AR++KPD+I+MDIQL EISGL
Sbjct: 2   KKVLIVEDNELNMKLFHDLLEAQGYETLQTREGLSALSIARENKPDLILMDIQLPEISGL 61

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           E+TK +KED +L  IPV+AVTAFAMKGDEERIR+GGCEAYISKPIS+  F+ETIK+ +
Sbjct: 62  EVTKWLKEDDDLAHIPVVAVTAFAMKGDEERIREGGCEAYISKPISVVHFLETIKRLL 119


>1w25_A Stalked-cell differentiation controlling protein; two-component system, response regulator, diguanylate cyclase, ggdef domain; HET: C2E; 2.70A {Caulobacter vibrioides} SCOP: c.23.1.1 c.23.1.1 d.58.29.2 PDB: 2v0n_A* Length = 459 Back     alignment and structure
>1w25_A Stalked-cell differentiation controlling protein; two-component system, response regulator, diguanylate cyclase, ggdef domain; HET: C2E; 2.70A {Caulobacter vibrioides} SCOP: c.23.1.1 c.23.1.1 d.58.29.2 PDB: 2v0n_A* Length = 459 Back     alignment and structure
>3m6m_D Sensory/regulatory protein RPFC; RPFF, REC, enoyl-COA hydratase, lyase-transferase COMP; 2.50A {Xanthomonas campestris PV} Length = 143 Back     alignment and structure
>3nhm_A Response regulator; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.19A {Myxococcus xanthus} Length = 133 Back     alignment and structure
>3lte_A Response regulator; structural genomics, PSI, protein structure initiative, nysgrc, NEW YORK structural genomix research consortium; 2.00A {Bermanella marisrubri} Length = 132 Back     alignment and structure
>3f6p_A Transcriptional regulatory protein YYCF; unphosphorelated, receiver domain, cytoplasm, DNA-binding, phosphoprotein, transcription regulation; 1.95A {Bacillus subtilis} PDB: 2zwm_A Length = 120 Back     alignment and structure
>3eq2_A Probable two-component response regulator; adaptor sigmas, signaling protein; 3.40A {Pseudomonas aeruginosa} Length = 394 Back     alignment and structure
>3i42_A Response regulator receiver domain protein (CHEY- like); structural genomics, PSI-2, protein structure initiative; 2.15A {Methylobacillus flagellatus KT} Length = 127 Back     alignment and structure
>1jbe_A Chemotaxis protein CHEY; signaling protein; 1.08A {Escherichia coli} SCOP: c.23.1.1 PDB: 3chy_A 1a0o_A 1cey_A 1bdj_A 1eay_A 1f4v_A 1ffg_A 1ffs_A 1ffw_A 1fqw_A 2b1j_A 1chn_A 1djm_A 1kmi_Y* 1d4z_A 1cye_A 2che_A 2chf_A 2pl9_A* 2pmc_A ... Length = 128 Back     alignment and structure
>3h1g_A Chemotaxis protein CHEY homolog; sulfate-bound CHEY, cytoplasm, flagellar rotatio magnesium, metal-binding, phosphoprotein; 1.70A {Helicobacter pylori} PDB: 3gwg_A 3h1e_A 3h1f_A Length = 129 Back     alignment and structure
>3kht_A Response regulator; PSI-II, structural genomics, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.10A {Hahella chejuensis kctc 2396} Length = 144 Back     alignment and structure
>3bre_A Probable two-component response regulator; protein-nucleotide complex, signaling protein; HET: C2E; 2.40A {Pseudomonas aeruginosa PAO1} PDB: 3i5a_A* Length = 358 Back     alignment and structure
>2ayx_A Sensor kinase protein RCSC; two independent structural domains, transferase; NMR {Escherichia coli} SCOP: c.23.1.1 c.23.1.6 PDB: 2ayz_A 2ayy_A Length = 254 Back     alignment and structure
>2zwm_A Transcriptional regulatory protein YYCF; two-component system, response regulator, dimerization domain, phosphorylation site, cytoplasm; 2.04A {Bacillus subtilis} Length = 130 Back     alignment and structure
>1k66_A Phytochrome response regulator RCPB; CHEY homologue, homodimer, APO-protein, (beta/alpha)5, signaling protein; 1.75A {Tolypothrix SP} SCOP: c.23.1.1 Length = 149 Back     alignment and structure
>1k68_A Phytochrome response regulator RCPA; phosphorylated aspartate, CHEY homologue, homodimer, (beta/alpha)5, signaling protein; HET: PHD; 1.90A {Tolypothrix SP} SCOP: c.23.1.1 Length = 140 Back     alignment and structure
>3b2n_A Uncharacterized protein Q99UF4; structural genomics, PSI-2, protein structure initiative; 2.04A {Staphylococcus aureus} Length = 133 Back     alignment and structure
>3lua_A Response regulator receiver protein; two-component signal transduction system, histidine kinase, phosphorelay, receiver domain, nysgxrc; 2.40A {Clostridium thermocellum} Length = 140 Back     alignment and structure
>1srr_A SPO0F, sporulation response regulatory protein; aspartate pocket, two component system; 1.90A {Bacillus subtilis} SCOP: c.23.1.1 PDB: 1pey_A 2ftk_E* 1fsp_A 1nat_A 1pux_A 2fsp_A 2jvj_A 2jvk_A 2jvi_A 1f51_E Length = 124 Back     alignment and structure
>1p6q_A CHEY2; chemotaxis, signal transduction, response regulator, structural proteomics in europe, spine, structural genomics; NMR {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1p6u_A Length = 129 Back     alignment and structure
>1i3c_A Response regulator RCP1; phytochrome, signaling protein; 1.90A {Synechocystis SP} SCOP: c.23.1.1 PDB: 1jlk_A Length = 149 Back     alignment and structure
>3f6c_A Positive transcription regulator EVGA; structural genomics, , PSI-2, protein structure initiative; 1.45A {Escherichia coli k-12} Length = 134 Back     alignment and structure
>3hdg_A Uncharacterized protein; two-component sensor activity, response regulator, PSI-II, 11227F, NYSGXRC, structural genomics; 2.27A {Wolinella succinogenes} Length = 137 Back     alignment and structure
>1mvo_A PHOP response regulator; phosphate regulon, transcriptional regulatory protein, alpha/beta doubly wound fold, phosphorylation; 1.60A {Bacillus subtilis} SCOP: c.23.1.1 Length = 136 Back     alignment and structure
>1dz3_A Stage 0 sporulation protein A; response regulator, domain swapping; 1.65A {Bacillus stearothermophilus} SCOP: c.23.1.1 PDB: 1qmp_A* Length = 130 Back     alignment and structure
>3gl9_A Response regulator; beta-sheet, surrounded by alpha helices, BOTH sides, signaling protein; HET: BFD; 1.80A {Thermotoga maritima} PDB: 3dgf_C 3dge_C Length = 122 Back     alignment and structure
>3cnb_A DNA-binding response regulator, MERR family; signal receiver domain, DNA binding protein, protein structure initiative, PSI-2; 2.00A {Colwellia psychrerythraea 34H} Length = 143 Back     alignment and structure
>3kyj_B CHEY6 protein, putative histidine protein kinase; protein-protein interaction, histidine kinase, response regulator, phosphorylation; 1.40A {Rhodobacter sphaeroides} PDB: 3kyi_B* Length = 145 Back     alignment and structure
>3eul_A Possible nitrate/nitrite response transcriptional regulatory protein NARL (DNA-binding...; central beta strand flanked by alpha helices; 1.90A {Mycobacterium tuberculosis} Length = 152 Back     alignment and structure
>3c97_A Signal transduction histidine kinase; structural genomics, signaling, PSI-2, protein structure initiative; 1.70A {Aspergillus oryzae RIB40} Length = 140 Back     alignment and structure
>3hv2_A Response regulator/HD domain protein; PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.50A {Pseudomonas fluorescens pf-5} Length = 153 Back     alignment and structure
>1tmy_A CHEY protein, TMY; chemotaxis, phosphoryl transfer, signal transduction; 1.90A {Thermotoga maritima} SCOP: c.23.1.1 PDB: 2tmy_A 3tmy_A 4tmy_A 1u0s_Y Length = 120 Back     alignment and structure
>3grc_A Sensor protein, kinase; protein structure initiative II(PSI II), NYSGXRC, 11025B, structural genomics; 2.21A {Polaromonas SP} Length = 140 Back     alignment and structure
>1s8n_A Putative antiterminator; structural genomics, transcriptional antiterminator, two component system, PSI; 1.48A {Mycobacterium tuberculosis H37RV} SCOP: c.23.1.1 PDB: 1sd5_A Length = 205 Back     alignment and structure
>1dcf_A ETR1 protein; beta-alpha five sandwich; 2.50A {Arabidopsis thaliana} SCOP: c.23.1.2 Length = 136 Back     alignment and structure
>1qkk_A DCTD, C4-dicarboxylate transport transcriptional regulatory protein; receiver domain, 2-component signal transduction; 1.7A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1l5z_A 1l5y_A Length = 155 Back     alignment and structure
>2jba_A Phosphate regulon transcriptional regulatory protein PHOB; transcription factor, sensory transduction, phosphate regulation; 1.45A {Escherichia coli} PDB: 2jba_B 1b00_A 2iyn_A 2jb9_A 1zes_A Length = 127 Back     alignment and structure
>1dc7_A NTRC, nitrogen regulation protein; receiver domain, phosphorylation, signal transduction, conformational rearrangement; NMR {Salmonella typhimurium} SCOP: c.23.1.1 PDB: 1j56_A 1krw_A 1krx_A 1ntr_A 1dc8_A* Length = 124 Back     alignment and structure
>3n0r_A Response regulator; sigma factor, receiver, two-component SI transduction, signaling protein; HET: MSE GOL; 1.25A {Caulobacter vibrioides} Length = 286 Back     alignment and structure
>3cu5_A Two component transcriptional regulator, ARAC family; structural genomics, protein structure initiative; 2.60A {Clostridium phytofermentans isdg} Length = 141 Back     alignment and structure
>2j48_A Two-component sensor kinase; pseudo-receiver, circadian clock, transferase, response regulator, histidine protein kinase; NMR {Synechococcus elongatus} Length = 119 Back     alignment and structure
>3heb_A Response regulator receiver domain protein (CHEY); NYSGXRC, PSI-II, respose regulator, protein structure initiative; 2.40A {Rhodospirillum rubrum atcc 11170} Length = 152 Back     alignment and structure
>3hdv_A Response regulator; PSI-II, structural genomics, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.09A {Pseudomonas putida KT2440} Length = 136 Back     alignment and structure
>3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A Length = 368 Back     alignment and structure
>2qsj_A DNA-binding response regulator, LUXR family; structural genomics, PSI-2, protein structure initiative; 2.10A {Silicibacter pomeroyi dss-3} Length = 154 Back     alignment and structure
>2zay_A Response regulator receiver protein; structural genomics, NYSGXRC, target 11006U, PSI-2, protein structure initiative; 2.00A {Desulfuromonas acetoxidans dsm 684} Length = 147 Back     alignment and structure
>3cz5_A Two-component response regulator, LUXR family; structural genomics, protein structure initiative; 2.70A {Aurantimonas SP} Length = 153 Back     alignment and structure
>3cg4_A Response regulator receiver domain protein (CHEY- like); structural genomics, unknown function, uncharacterized protein; HET: MSE; 1.61A {Methanospirillum hungatei jf-1} Length = 142 Back     alignment and structure
>2gkg_A Response regulator homolog; social motility, receiver domain, signalling, high resolution, signaling protein; 1.00A {Myxococcus xanthus} PDB: 2i6f_A 2nt4_A 2nt3_A Length = 127 Back     alignment and structure
>3luf_A Two-component system response regulator/ggdef domain protein; structural genomics, ASA_2441, PSI-2, protein structure initiative; HET: MSE; 1.76A {Aeromonas salmonicida} PDB: 3mf4_A* Length = 259 Back     alignment and structure
>3kto_A Response regulator receiver protein; PSI-II,structural genomics, protein structure initiative; 1.98A {Pseudoalteromonas atlantica T6C} Length = 136 Back     alignment and structure
>3hzh_A Chemotaxis response regulator (CHEY-3); phosphatase, complex, response regulator, receiver domain, two-component signal transduction; HET: BFD; 1.96A {Borrelia burgdorferi} Length = 157 Back     alignment and structure
>2qv0_A Protein MRKE; structural genomics, transcription, PSI-2, protein structure initiative; 2.40A {Klebsiella pneumoniae} Length = 143 Back     alignment and structure
>2b4a_A BH3024; 10175646, structural genomics, joint center for structural genomics, JCSG, protein structure initiative PSI, unknown function; 2.42A {Bacillus halodurans c-125} SCOP: c.23.1.1 Length = 138 Back     alignment and structure
>1a2o_A CHEB methylesterase; bacterial chemotaxis, adaptation, serine hydrolase; 2.40A {Salmonella typhimurium} SCOP: c.23.1.1 c.40.1.1 Length = 349 Back     alignment and structure
>3eqz_A Response regulator; structural genomics, unknown function, PSI-2, protein structure initiative; 2.15A {Colwellia psychrerythraea 34H} Length = 135 Back     alignment and structure
>2qvg_A Two component response regulator; NYSGXRC, PSI-2, structural genomics, protein structure initiative; 1.50A {Legionella pneumophila subsp} Length = 143 Back     alignment and structure
>3a10_A Response regulator; phosphoacceptor, signaling protein; HET: MSE PG4; 1.63A {Thermotoga maritima} PDB: 3a0r_B* 3a0u_A* Length = 116 Back     alignment and structure
>3c3m_A Response regulator receiver protein; structural genomics, unknown function, PSI-2, protein structure initiative; HET: MSE; 1.70A {Methanoculleus marisnigri JR1} Length = 138 Back     alignment and structure
>1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, dimer; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 1zy2_A* Length = 387 Back     alignment and structure
>2a9o_A Response regulator; essential protein, YYCF/YYCG homolog, signaling protein; 1.65A {Streptococcus pneumoniae} SCOP: c.23.1.1 PDB: 1nxo_A 1nxs_A 1nxv_A 1nxw_A 1nxx_A 1nxp_A 2a9p_A 2a9q_A 1nxt_A* 2a9r_A* Length = 120 Back     alignment and structure
>3eod_A Protein HNR; response regulator, phosphoprotein, two-component regulatory system, signaling protein; 1.75A {Escherichia coli K12} Length = 130 Back     alignment and structure
>3cg0_A Response regulator receiver modulated diguanylate cyclase with PAS/PAC sensor; signal receiver domain; 2.15A {Desulfovibrio desulfuricans subsp} Length = 140 Back     alignment and structure
>3cfy_A Putative LUXO repressor protein; structural genomics, unknown function, uncharacterized protein, signal receiver domain; 2.50A {Vibrio parahaemolyticus rimd 2210633} Length = 137 Back     alignment and structure
>3gt7_A Sensor protein; structural genomics, signal receiver domain, kinase, PSI-2, protein structure initiative; 2.30A {Syntrophus aciditrophicus SB} Length = 154 Back     alignment and structure
>2r25_B Osmosensing histidine protein kinase SLN1; alpha5-BETA5, response regulator, four helix bundle, histidine phosphotransfer (HPT) protein; 1.70A {Saccharomyces cerevisiae} SCOP: c.23.1.1 PDB: 1oxk_B 1oxb_B Length = 133 Back     alignment and structure
>2qxy_A Response regulator; regulation of transcription, NYSGXRC, protein structure initiative II (PSI II), structural genomics; 1.95A {Thermotoga maritima} Length = 142 Back     alignment and structure
>1zh2_A KDP operon transcriptional regulatory protein KDPE; two-component system, gene regulation, transcription factor, KDP potassium transport system; 2.00A {Escherichia coli} SCOP: c.23.1.1 PDB: 1zh4_A Length = 121 Back     alignment and structure
>2jk1_A HUPR, hydrogenase transcriptional regulatory protein HUPR1; nucleotide-binding, transcription regulation; 2.10A {Rhodobacter capsulatus} PDB: 2vui_B 2vuh_B Length = 139 Back     alignment and structure
>2qr3_A Two-component system response regulator; structural genomics, signal receiver, PSI-2, protein structure initiative; 1.80A {Bacteroides fragilis YCH46} Length = 140 Back     alignment and structure
>3h5i_A Response regulator/sensory box protein/ggdef domain protein; structural genomics, transcription, PSI-2; 1.90A {Carboxydothermus hydrogenoformans z-2901} Length = 140 Back     alignment and structure
>2rjn_A Response regulator receiver:metal-dependent phosphohydrolase, HD subdomain; structural genomics, oceanospirillum SP. MED92, PSI-2; 2.10A {Neptuniibacter caesariensis} Length = 154 Back     alignment and structure
>3ilh_A Two component response regulator; NYSGXRC, PSI-II, protein structure initiative, structural genomics; 2.59A {Cytophaga hutchinsonii atcc 33406} Length = 146 Back     alignment and structure
>3crn_A Response regulator receiver domain protein, CHEY- like; structural genomics, signal regulator receiver domain; HET: PHD; 1.58A {Methanospirillum hungatei jf-1} Length = 132 Back     alignment and structure
>3kcn_A Adenylate cyclase homolog; SGX, PSI 2, structural genomics, protein structure initiative; 2.45A {Rhodopirellula baltica} Length = 151 Back     alignment and structure
>1zgz_A Torcad operon transcriptional regulatory protein TORR; two-component system, gene regulation, transcription factor, TMAO respiratory system; 1.80A {Escherichia coli} SCOP: c.23.1.1 Length = 122 Back     alignment and structure
>3cwo_X Beta/alpha-barrel protein based on 1THF and 1TMY; XRAY, CHEY, HISF, half barrel, de novo protein; 3.10A {Thermotoga maritima} Length = 237 Back     alignment and structure