254780554

254780554

Holliday junction resolvase

GeneID in NCBI database:8209550Locus tag:CLIBASIA_02205
Protein GI in NCBI database:254780554Protein Accession:YP_003064967.1
Gene range:+(726527, 727036)Protein Length:169aa
Gene description:Holliday junction resolvase
COG prediction:none
KEGG prediction:ruvC; Holliday junction resolvase (EC:3.1.22.4); K01159 crossover junction endodeoxyribonuclease RuvC [EC:3.1.22.4]
SEED prediction:Crossover junction endodeoxyribonuclease RuvC (EC 3.1.22.4)
Pathway involved in KEGG:Homologous recombination [PATH:las03440]
Subsystem involved in SEED:RuvABC plus a hypothetical;
DNA-replication
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------17
MRKSIRIIGIDPGLRRTGWGIVDVAGDNLCFVSSGTIVSCVRQSLAFRLCQLYEGLTDVIKNWRPEEAAVEQVFVNKDAVATLKLGQARAIAILSPALARIPVSEYAPNTIKKAVIGVGHGDKKQIHMMLKMLMPESFFKGKDAADALAIAVCHAYHANSGYYKIASQD
ccccEEEEEEcccccccEEEEEEEEccEEEEEEEcEEEccccccHHHHHHHHHHHHHHHHHHccccEEEEEHHHHcccHHHHHHHHHHHHHHHHHHHHccccEEEEcHHHHHHHHcccccccHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHccccEEEEcccc
ccccEEEEEEcccccEcEEEEEEccccEEEEEEcEEEEccccccHHHHHHHHHHHHHHHHHHccccEEEEEEccccccHHHHHHHHHHHHHHHHHHHHccccEEEEEHHHHHHHHcccccccHHHcHHHHHHHcccccccccccHHHHHHHHHHHHccHHHHHHHHccc
mrksiriigidpglrrtgwgivdvagdnlcfvssgTIVSCVRQSLAFRLCQLYEGLTDVIKNWRPEEAAVEQVFVNKDAVATLKLGQARAIAILspalaripvseyapntiKKAVIGVGHGDKKQIHMMLKMlmpesffkgkdAADALAIAVCHAYhansgyykiasqd
mrksiriigidpglrrtgWGIVDVAGDNLCFVSSGTIVSCVRQSLAFRLCQLYEGLTDVIKNWRPEEAAVEQVFVNKDAVATLKLGQARAIAILSPALARIPVSEYAPNTIKKAVIGVGHGDKKQIHMMLKMLMPESFFKGKDAADALAIAVCHAYHANSGYYKIASQD
MRKSIRIIGIDPGLRRTGWGIVDVAGDNLCFVSSGTIVSCVRQSLAFRLCQLYEGLTDVIKNWRPEEAAVEQVFVNKDAVATLKLGQARAIAILSPALARIPVSEYAPNTIKKAVIGVGHGDKKQIHMMLKMLMPESFFKGKDAADALAIAVCHAYHANSGYYKIASQD
**KSIRIIGIDPGLRRTGWGIVDVAGDNLCFVSSGTIVSCVRQSLAFRLCQLYEGLTDVIKNWRPEEAAVEQVFVNKDAVATLKLGQARAIAILSPALARIPVSEYAPNTIKKAVIGVGHGDKKQIHMMLKMLMPESFFKGKDAADALAIAVCHAYHANS*********
MRKSIRIIGIDPGLRRTGWGIVDVAGDNLCFVSSGTIVSCVRQSLAFRLCQLYEGLTDVIKNWRPEEAAVEQVFVNKDAVATLKLGQARAIAILSPALARIPVSEYAPNTIKKAVIGVGHGDKKQIHMMLKMLMPESFFKGKDAADALAIAVCHAYHANSGYYKIASQD
*RKSIRIIGIDPGLRRTGWGIVDVAGDNLCFVSSGTIVSCVRQSLAFRLCQLYEGLTDVIKNWRPEEAAVEQVFVNKDAVATLKLGQARAIAILSPALARIPVSEYAPNTIKKAVIGVGHGDKKQIHMMLKMLMPESFFKGKDAADALAIAVCHAYHANSGYYKIASQ*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRKSIRIIGIDPGLRRTGWGIVDVAGDNLCFVSSGTIVSCVRQSLAFRLCQLYEGLTDVIKNWRPEEAAVEQVFVNKDAVATLKLGQARAIAILSPALARIPVSEYAPNTIKKAVIGVGHGDKKQIHMMLKMLMPESFFKGKDAADALAIAVCHAYHANSGYYKIASQD
MRKSIRIIGIDPGLRRTGWGIVDVAGDNLCFVSSGTIVSCVRQSLAFRLCQLYEGLTDVIKNWRPEEAAVEQVFVNKDAVATLKLGQARAIAILSPALARIPVSEYAPNTIKKAVIGVGHGDKKQIHMMLKMLMPESFFKGKDAADALAIAVCHAYHANSGYYKIASQD
MRKSIRIIGIDPGLRRTGWGIVDVAGDNLCFVSSGTIVSCVRQSLAFRLCQLYEGLTDVIKNWRPEEAAVEQVFVNKDAVATLKLGQARAIAILSPALARIPVSEYAPNTIKKAVIGVGHGDKKQIHMMLKMLMPESFFKGKDAADALAIAVCHAYHANSGYYKIASQD

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target169 Holliday junction resolvase [Candidatus Liberibacter as
315122881168 Holliday junction resolvase [Candidatus Liberibacter so 1 2e-75
13473342169 Holliday junction resolvase [Mesorhizobium loti MAFF303 1 1e-57
319781016169 crossover junction endodeoxyribonuclease RuvC [Mesorhiz 1 2e-57
260467056170 crossover junction endodeoxyribonuclease RuvC [Mesorhiz 1 2e-57
163758806168 crossover junction endodeoxyribonuclease RuvC [Hoeflea 1 2e-55
121602663167 Holliday junction resolvase [Bartonella bacilliformis K 1 2e-55
86359069169 Holliday junction resolvase [Rhizobium etli CFN 42] Len 1 6e-55
222086990170 crossover junction endodeoxyribonuclease RuvC [Agrobact 1 9e-55
116253725169 Holliday junction resolvase [Rhizobium leguminosarum bv 1 2e-54
332716454170 crossover junction endodeoxyribonuclease RuvC [Agrobact 1 9e-54
>gi|315122881|ref|YP_004063370.1| Holliday junction resolvase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 168 Back     alignment and organism information
 Score =  284 bits (727), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 137/166 (82%), Positives = 148/166 (89%)

Query: 2   RKSIRIIGIDPGLRRTGWGIVDVAGDNLCFVSSGTIVSCVRQSLAFRLCQLYEGLTDVIK 61
           RKSIRIIGIDPGLRRTGWGI+D  GDNLCFVSSGT+VSC +QSLA RL QLYEGL D+++
Sbjct: 3   RKSIRIIGIDPGLRRTGWGIIDAVGDNLCFVSSGTVVSCAQQSLAVRLRQLYEGLADIMR 62

Query: 62  NWRPEEAAVEQVFVNKDAVATLKLGQARAIAILSPALARIPVSEYAPNTIKKAVIGVGHG 121
           ++ PEEAAVEQVFVNKDAVATLKLGQARAIAILSPAL  I VSEYAPNTIKKAVIGVGHG
Sbjct: 63  DFHPEEAAVEQVFVNKDAVATLKLGQARAIAILSPALTGISVSEYAPNTIKKAVIGVGHG 122

Query: 122 DKKQIHMMLKMLMPESFFKGKDAADALAIAVCHAYHANSGYYKIAS 167
           DK+QIHMMLKML+P   FKGKDAADALAIAVCHA+H N   YKI S
Sbjct: 123 DKRQIHMMLKMLIPGIMFKGKDAADALAIAVCHAHHTNYNRYKIES 168


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|13473342|ref|NP_104909.1| Holliday junction resolvase [Mesorhizobium loti MAFF303099] Length = 169 Back     alignment and organism information
>gi|319781016|ref|YP_004140492.1| crossover junction endodeoxyribonuclease RuvC [Mesorhizobium ciceri biovar biserrulae WSM1271] Length = 169 Back     alignment and organism information
>gi|260467056|ref|ZP_05813236.1| crossover junction endodeoxyribonuclease RuvC [Mesorhizobium opportunistum WSM2075] Length = 170 Back     alignment and organism information
>gi|163758806|ref|ZP_02165893.1| crossover junction endodeoxyribonuclease RuvC [Hoeflea phototrophica DFL-43] Length = 168 Back     alignment and organism information
>gi|121602663|ref|YP_988489.1| Holliday junction resolvase [Bartonella bacilliformis KC583] Length = 167 Back     alignment and organism information
>gi|86359069|ref|YP_470961.1| Holliday junction resolvase [Rhizobium etli CFN 42] Length = 169 Back     alignment and organism information
>gi|222086990|ref|YP_002545524.1| crossover junction endodeoxyribonuclease RuvC [Agrobacterium radiobacter K84] Length = 170 Back     alignment and organism information
>gi|116253725|ref|YP_769563.1| Holliday junction resolvase [Rhizobium leguminosarum bv. viciae 3841] Length = 169 Back     alignment and organism information
>gi|332716454|ref|YP_004443920.1| crossover junction endodeoxyribonuclease RuvC [Agrobacterium sp. H13-3] Length = 170 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target169 Holliday junction resolvase [Candidatus Liberibacter as
PRK00039164 PRK00039, ruvC, Holliday junction resolvase; Reviewed 4e-62
cd00529154 cd00529, RuvC_resolvase, Holliday junction resolvases ( 7e-39
pfam02075148 pfam02075, RuvC, Crossover junction endodeoxyribonuclea 1e-34
TIGR00228156 TIGR00228, ruvC, crossover junction endodeoxyribonuclea 3e-31
COG0817160 COG0817, RuvC, Holliday junction resolvasome, endonucle 5e-51
>gnl|CDD|178813 PRK00039, ruvC, Holliday junction resolvase; Reviewed Back     alignment and domain information
>gnl|CDD|29627 cd00529, RuvC_resolvase, Holliday junction resolvases (HJRs) are endonucleases that specifically resolve Holliday junction DNA intermediates during homologous recombination Back     alignment and domain information
>gnl|CDD|111017 pfam02075, RuvC, Crossover junction endodeoxyribonuclease RuvC Back     alignment and domain information
>gnl|CDD|129331 TIGR00228, ruvC, crossover junction endodeoxyribonuclease RuvC Back     alignment and domain information
>gnl|CDD|31159 COG0817, RuvC, Holliday junction resolvasome, endonuclease subunit [DNA replication, recombination, and repair] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 169 Holliday junction resolvase [Candidatus Liberibacter as
PRK00039169 ruvC Holliday junction resolvase; Reviewed 100.0
COG0817160 RuvC Holliday junction resolvasome, endonuclease subuni 100.0
cd00529154 RuvC_resolvase Holliday junction resolvases (HJRs) are 100.0
pfam02075148 RuvC Crossover junction endodeoxyribonuclease RuvC. 100.0
TIGR00228158 ruvC crossover junction endodeoxyribonuclease RuvC; Int 100.0
pfam04848143 Pox_A22 Poxvirus A22 protein. 98.06
COG0816141 Predicted endonuclease involved in recombination (possi 97.55
pfam07066162 Phage_Lacto_M3 Lactococcus phage M3 protein. This famil 97.5
pfam04312138 DUF460 Protein of unknown function (DUF460). Archaeal p 97.39
COG2433 652 Uncharacterized conserved protein [Function unknown] 97.27
pfam03652134 UPF0081 Uncharacterized protein family (UPF0081). 98.22
PRK00109141 Holliday junction resolvase-like protein; Reviewed 97.82
smart0073299 YqgFc Likely ribonuclease with RNase H fold. YqgF prote 97.8
pfam09159253 Ydc2-catalyt Mitochondrial resolvase Ydc2, catalytic. M 96.69
pfam11215138 DUF3010 Protein of unknown function (DUF3010). This fam 96.6
COG1214220 Inactive homolog of metal-dependent proteases, putative 96.22
PRK09604 335 putative DNA-binding/iron metalloprotein/AP endonucleas 91.61
PTZ00340 348 O-sialoglycoprotein endopeptidase; Provisional 91.07
TIGR00250133 TIGR00250 conserved hypothetical protein TIGR00250; Int 90.26
pfam07318 336 DUF1464 Protein of unknown function (DUF1464). This fam 90.23
TIGR01865 1140 cas_Csn1 CRISPR-associated protein, Csn1 family; InterP 96.24
COG3513 1088 Predicted CRISPR-associated nuclease, contains McrA/HNH 93.38
COG2410178 Predicted nuclease (RNAse H fold) [General function pre 95.26
COG2183 780 Tex Transcriptional accessory protein [Transcription] 95.24
pfam03237380 Terminase_6 Terminase-like family. This family represen 94.72
PRK05082 291 N-acetylmannosamine kinase; Provisional 93.92
COG1940 314 NagC Transcriptional regulator/sugar kinase [Transcript 93.38
PRK09698 302 D-allose kinase; Provisional 92.33
COG1548 330 Predicted transcriptional regulator/sugar kinase [Trans 90.27
>PRK00039 ruvC Holliday junction resolvase; Reviewed Back     alignment and domain information
>COG0817 RuvC Holliday junction resolvasome, endonuclease subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>cd00529 RuvC_resolvase Holliday junction resolvases (HJRs) are endonucleases that specifically resolve Holliday junction DNA intermediates during homologous recombination Back     alignment and domain information
>pfam02075 RuvC Crossover junction endodeoxyribonuclease RuvC Back     alignment and domain information
>TIGR00228 ruvC crossover junction endodeoxyribonuclease RuvC; InterPro: IPR002176 The Escherichia coli ruvC gene is involved in DNA repair and in the late step of RecE and RecF pathway recombination Back     alignment and domain information
>pfam04848 Pox_A22 Poxvirus A22 protein Back     alignment and domain information
>COG0816 Predicted endonuclease involved in recombination (possible Holliday junction resolvase in Mycoplasmas and B Back     alignment and domain information
>pfam07066 Phage_Lacto_M3 Lactococcus phage M3 protein Back     alignment and domain information
>pfam04312 DUF460 Protein of unknown function (DUF460) Back     alignment and domain information
>COG2433 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>pfam03652 UPF0081 Uncharacterized protein family (UPF0081) Back     alignment and domain information
>PRK00109 Holliday junction resolvase-like protein; Reviewed Back     alignment and domain information
>smart00732 YqgFc Likely ribonuclease with RNase H fold Back     alignment and domain information
>pfam09159 Ydc2-catalyt Mitochondrial resolvase Ydc2, catalytic Back     alignment and domain information
>pfam11215 DUF3010 Protein of unknown function (DUF3010) Back     alignment and domain information
>COG1214 Inactive homolog of metal-dependent proteases, putative molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09604 putative DNA-binding/iron metalloprotein/AP endonuclease; Reviewed Back     alignment and domain information
>PTZ00340 O-sialoglycoprotein endopeptidase; Provisional Back     alignment and domain information
>TIGR00250 TIGR00250 conserved hypothetical protein TIGR00250; InterPro: IPR005227 Holliday junction resolvases (HJRs) are key enzymes of DNA recombination Back     alignment and domain information
>pfam07318 DUF1464 Protein of unknown function (DUF1464) Back     alignment and domain information
>TIGR01865 cas_Csn1 CRISPR-associated protein, Csn1 family; InterPro: IPR010145 CRISPR loci appear to be mobile elements with a wide host range Back     alignment and domain information
>COG3513 Predicted CRISPR-associated nuclease, contains McrA/HNH-nuclease and RuvC-like nuclease domain [Defense mechanisms] Back     alignment and domain information
>COG2410 Predicted nuclease (RNAse H fold) [General function prediction only] Back     alignment and domain information
>COG2183 Tex Transcriptional accessory protein [Transcription] Back     alignment and domain information
>pfam03237 Terminase_6 Terminase-like family Back     alignment and domain information
>PRK05082 N-acetylmannosamine kinase; Provisional Back     alignment and domain information
>COG1940 NagC Transcriptional regulator/sugar kinase [Transcription / Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK09698 D-allose kinase; Provisional Back     alignment and domain information
>COG1548 Predicted transcriptional regulator/sugar kinase [Transcription / Carbohydrate transport and metabolism] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target169 Holliday junction resolvase [Candidatus Liberibacter as
1hjr_A158 Atomic Structure Of The Ruvc Resolvase: A Holliday 2e-34
>gi|999741|pdb|1HJR|A Chain A, Atomic Structure Of The Ruvc Resolvase: A Holliday Junction- Specific Endonuclease From E. Coli Length = 158 Back     alignment and structure
 Score =  148 bits (375), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 52/136 (38%), Positives = 83/136 (61%), Gaps = 1/136 (0%)

Query: 6   RIIGIDPGLRRTGWGIVDVAGDNLCFVSSGTIVSCVRQSLAFRLCQLYEGLTDVIKNWRP 65
            I+GIDPG R TG+G++   G  L ++ SG I +     L  RL  +Y G+T++I  ++P
Sbjct: 2   IILGIDPGSRVTGYGVIRQVGRQLSYLGSGCIRT-KVDDLPSRLKLIYAGVTEIITQFQP 60

Query: 66  EEAAVEQVFVNKDAVATLKLGQARAIAILSPALARIPVSEYAPNTIKKAVIGVGHGDKKQ 125
           +  A+EQVF+ K+A + LKLGQAR +AI++     +PV EYA   +K+ V+G+G  +K Q
Sbjct: 61  DYFAIEQVFMAKNADSALKLGQARGVAIVAAVNQELPVFEYAARQVKQTVVGIGSAEKSQ 120

Query: 126 IHMMLKMLMPESFFKG 141
           +  M++ L+       
Sbjct: 121 VQHMVRTLLKLPANPQ 136


Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target169 Holliday junction resolvase [Candidatus Liberibacter as
1hjr_A158 Holliday junction resolvase (RUVC); site-specific recom 7e-40
>1hjr_A Holliday junction resolvase (RUVC); site-specific recombinase; 2.50A {Escherichia coli} SCOP: c.55.3.6 Length = 158 Back     alignment and structure
 Score =  158 bits (400), Expect = 7e-40
 Identities = 62/154 (40%), Positives = 96/154 (62%), Gaps = 1/154 (0%)

Query: 7   IIGIDPGLRRTGWGIVDVAGDNLCFVSSGTIVSCVRQSLAFRLCQLYEGLTDVIKNWRPE 66
           I+GIDPG R TG+G++   G  L ++ SG I       L  RL  +Y G+T++I  ++P+
Sbjct: 3   ILGIDPGSRVTGYGVIRQVGRQLSYLGSGCI-RTKVDDLPSRLKLIYAGVTEIITQFQPD 61

Query: 67  EAAVEQVFVNKDAVATLKLGQARAIAILSPALARIPVSEYAPNTIKKAVIGVGHGDKKQI 126
             A+EQVF+ K+A + LKLGQAR +AI++     +PV EYA   +K+ V+G+G  +K Q+
Sbjct: 62  YFAIEQVFMAKNADSALKLGQARGVAIVAAVNQELPVFEYAARQVKQTVVGIGSAEKSQV 121

Query: 127 HMMLKMLMPESFFKGKDAADALAIAVCHAYHANS 160
             M++ L+        DAADALAIA+ H + + +
Sbjct: 122 QHMVRTLLKLPANPQADAADALAIAITHCHVSQN 155


Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target169 Holliday junction resolvase [Candidatus Liberibacter as
1hjr_A158 Holliday junction resolvase (RUVC); site-specific recom 100.0
1kcf_A258 Hypothetical 30.2 KD protein C25G10.02 in chromosome I; 98.28
1vhx_A150 Putative holliday junction resolvase; structural genomi 98.22
1nu0_A138 Hypothetical protein YQGF; structural genomics, structu 98.01
1iv0_A98 Hypothetical protein; rnaseh-like, YQGF, structural gen 97.66
2gel_A231 Putative GRAM negative resuscitation promoting factor; 96.22
2ivn_A 330 O-sialoglycoprotein endopeptidase; UP1 keops complex, F 96.05
3eno_A 334 Putative O-sialoglycoprotein endopeptidase; hydrolase, 95.85
3en9_A 540 Glycoprotease, O-sialoglycoprotein endopeptidase/protei 95.64
2a6a_A218 Hypothetical protein TM0874; glycoprotein endopeptidase 95.57
3bzc_A 785 TEX; helix-turn-helix, helix-hairpin-helix, S1 domain, 96.7
2gup_A 292 ROK family protein; sugar kinase, APC80695, sucrose, st 95.01
1zc6_A 305 Probable N-acetylglucosamine kinase; NESG, Q7NU07_chrvo 94.8
2aa4_A 289 Mannac kinase, putative N-acetylmannosamine kinase; sug 94.66
2qm1_A 326 Glucokinase; alpha-beta structure, putative helix-turn- 94.26
2e2o_A 299 Hexokinase; acetate and sugar kinases, HSP70, actin sup 93.02
1t6c_A 315 Exopolyphosphatase; alpha/beta protein, actin-like fold 92.13
1hux_A 270 Activator of (R)-2-hydroxyglutaryl-COA dehydratase; act 91.87
3eo3_A 333 Bifunctional UDP-N-acetylglucosamine 2- epimerase/N-ace 91.78
3ll3_A 504 Gluconate kinase; xylulose kinase, nysgx, ATP, ADP, xyl 90.92
1woq_A267 Inorganic polyphosphate/ATP-glucomannokinase; transfera 90.88
>1hjr_A Holliday junction resolvase (RUVC); site-specific recombinase; 2.50A {Escherichia coli} SCOP: c.55.3.6 Back     alignment and structure
Probab=100.00  E-value=0  Score=344.84  Aligned_cols=156  Identities=40%  Similarity=0.677  Sum_probs=150.4

Q ss_pred             EEEEECCCCCEEEEEEEEEECCEEEEEEEEEEECCCCCCHHHHHHHHHHHHHHHHHCCCCCEEEEEHHHHCCCHHHHHHH
Q ss_conf             69999788872058999971996899983368738899988899999998999862279627788503320241247889
Q gi|254780554|r    6 RIIGIDPGLRRTGWGIVDVAGDNLCFVSSGTIVSCVRQSLAFRLCQLYEGLTDVIKNWRPEEAAVEQVFVNKDAVATLKL   85 (169)
Q Consensus         6 rILGIDPGl~~tG~avie~~~~~~~li~~g~I~t~~~~~~~~Rl~~I~~~l~~ii~~~~Pd~vaiE~~F~~~n~~t~~~l   85 (169)
                      .|||||||+++|||||+|.++++++++++|+|+|+++ ++++||..|++++.+++++|+||.|++|++||++|++|++++
T Consensus         2 iILGiDPgl~~tG~avid~~~~~~~~i~~g~i~t~~~-~~~~Rl~~I~~~l~~ii~~~~pd~vaiE~~f~~~n~~sa~~l   80 (158)
T 1hjr_A            2 IILGIDPGSRVTGYGVIRQVGRQLSYLGSGCIRTKVD-DLPSRLKLIYAGVTEIITQFQPDYFAIEQVFMAKNADSALKL   80 (158)
T ss_dssp             EEEEEECCSSEEEEEEEEEETTEEEEEEEEEEECCCS-CHHHHHHHHHHHHHHHHHHHCCSEEEEEECCCCCCTTTHHHH
T ss_pred             EEEEECCCCCCEEEEEEEEECCEEEEEEEEEEECCCC-CHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHCCCHHHHHHH
T ss_conf             8999843558568999995398789998668977998-879999999999999997139735369898862388899999


Q ss_pred             HHHHHHHHHHHHHCCCCEEEECHHHHHHHHCCCCCCCHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHCCCHH
Q ss_conf             99999999999860161775260677765316888899999999999628899999556789999999764168756
Q gi|254780554|r   86 GQARAIAILSPALARIPVSEYAPNTIKKAVIGVGHGDKKQIHMMLKMLMPESFFKGKDAADALAIAVCHAYHANSGY  162 (169)
Q Consensus        86 g~arGvi~l~~~~~~i~v~ey~P~~vKkavtG~G~A~KeqV~~mV~~ll~~~~~~~~D~aDAlAiAl~h~~~~~~~~  162 (169)
                      ||+||++++++.++++|++||+|++|||++||+|+|+|+||+.||+++|++.+++.+|++||+|+|+||+|+.+|+.
T Consensus        81 ~~a~G~i~~~~~~~~i~i~~~~P~~vKk~vtG~G~A~K~qV~~mv~~~l~l~~~~~~D~aDAlAial~h~~~~~~~~  157 (158)
T 1hjr_A           81 GQARGVAIVAAVNQELPVFEYAARQVKQTVVGIGSAEKSQVQHMVRTLLKLPANPQADAADALAIAITHCHVSQNAM  157 (158)
T ss_dssp             HHHHHHHHHHHHTTTCCEEEEEHHHHHHHHTSSSSCCHHHHHHHHHHHTTCCCCCSSCTHHHHHHHHHHHHTTSSSC
T ss_pred             HHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHCCCCCCHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHCCCC
T ss_conf             99999999999985996013688999999857997799999999999819999999987999999999997623446



>1kcf_A Hypothetical 30.2 KD protein C25G10.02 in chromosome I; beta-alpha-beta motif, RUVC resolvase family, hydrolase; 2.30A {Schizosaccharomyces pombe} SCOP: a.140.2.1 c.55.3.7 Back     alignment and structure
>1vhx_A Putative holliday junction resolvase; structural genomics, hydrolase; 1.96A {Bacillus subtilis} SCOP: c.55.3.8 Back     alignment and structure
>1nu0_A Hypothetical protein YQGF; structural genomics, structure 2 function project, S2F, unknown function; 1.60A {Escherichia coli} SCOP: c.55.3.8 PDB: 1nmn_A 1ovq_A Back     alignment and structure
>1iv0_A Hypothetical protein; rnaseh-like, YQGF, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Thermus thermophilus} SCOP: c.55.3.8 Back     alignment and structure
>2gel_A Putative GRAM negative resuscitation promoting factor; YEAZ, RPF, actin-like-fold, glycoprotease, chaperone; 2.05A {Salmonella typhimurium LT2} PDB: 2gem_A 1okj_A Back     alignment and structure
>2ivn_A O-sialoglycoprotein endopeptidase; UP1 keops complex, Fe/Zn dependent nucleotide phosphatase, metalloprotease, hypothetical protein, zinc; HET: ANP; 1.65A {Pyrococcus abyssi} PDB: 2ivo_A 2ivp_A* Back     alignment and structure
>3eno_A Putative O-sialoglycoprotein endopeptidase; hydrolase, metal-binding, metalloprotease, protease, zinc, keops complex, ATPase, metal ION binding; 3.02A {Thermoplasma acidophilum} Back     alignment and structure
>3en9_A Glycoprotease, O-sialoglycoprotein endopeptidase/protein kinase; endopeptidase activity, protein kinase activity; HET: TBR; 2.67A {Methanocaldococcus jannaschii} PDB: 3enh_A* 2vwb_A* Back     alignment and structure
>2a6a_A Hypothetical protein TM0874; glycoprotein endopeptidase, structural genomics, joint center for structural genomics, JCSG; 2.50A {Thermotoga maritima MSB8} SCOP: c.55.1.9 c.55.1.9 Back     alignment and structure
>3bzc_A TEX; helix-turn-helix, helix-hairpin-helix, S1 domain, YQGF domain, transcription, RNA binding protein; 2.27A {Pseudomonas aeruginosa} SCOP: a.60.2.6 a.60.2.6 a.294.1.1 b.40.4.5 c.55.3.13 PDB: 3bzk_A 2oce_A Back     alignment and structure
>2gup_A ROK family protein; sugar kinase, APC80695, sucrose, structural genomics, PSI, protein structure initiative; HET: SUC; 2.01A {Streptococcus pneumoniae TIGR4} SCOP: c.55.1.10 c.55.1.10 Back     alignment and structure
>1zc6_A Probable N-acetylglucosamine kinase; NESG, Q7NU07_chrvo, CVR23, structural genomics, PSI, protein structure initiative; 2.20A {Chromobacterium violaceum atcc 12472} SCOP: c.55.1.5 c.55.1.5 Back     alignment and structure
>2aa4_A Mannac kinase, putative N-acetylmannosamine kinase; sugar methabolism, structural genomics, PSI, protein structure initiative; 2.20A {Escherichia coli} SCOP: c.55.1.10 c.55.1.10 Back     alignment and structure
>2qm1_A Glucokinase; alpha-beta structure, putative helix-turn-helix, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.02A {Enterococcus faecalis V583} Back     alignment and structure
>2e2o_A Hexokinase; acetate and sugar kinases, HSP70, actin superfamily, ribonuclease-H fold, sugar kinase, glucose, conformational change; HET: BGC; 1.65A {Sulfolobus tokodaii} PDB: 2e2n_A* 2e2p_A* 2e2q_A* Back     alignment and structure
>1t6c_A Exopolyphosphatase; alpha/beta protein, actin-like fold, hydrolase; 1.53A {Aquifex aeolicus VF5} SCOP: c.55.1.8 c.55.1.8 PDB: 1t6d_A 2j4r_A* Back     alignment and structure
>1hux_A Activator of (R)-2-hydroxyglutaryl-COA dehydratase; actin fold, metal binding protein; HET: ADP; 3.00A {Acidaminococcus fermentans} SCOP: c.55.1.5 Back     alignment and structure
>3eo3_A Bifunctional UDP-N-acetylglucosamine 2- epimerase/N-acetylmannosamine kinase; non-protein kinase, sialic acid biosynthesis; 2.84A {Homo sapiens} Back     alignment and structure
>3ll3_A Gluconate kinase; xylulose kinase, nysgx, ATP, ADP, xylulose, transferase, structural genomics, PSI-2, protein structure initiative; HET: ATP DXP XUL ADP; 2.00A {Lactobacillus acidophilus} PDB: 3gbt_A* Back     alignment and structure
>1woq_A Inorganic polyphosphate/ATP-glucomannokinase; transferase; HET: BGC; 1.80A {Arthrobacter SP} SCOP: c.55.1.10 c.55.1.10 Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 169 Holliday junction resolvase [Candidatus Liberibacter as
d1hjra_158 c.55.3.6 (A:) RuvC resolvase {Escherichia coli [TaxId: 1e-35
>d1hjra_ c.55.3.6 (A:) RuvC resolvase {Escherichia coli [TaxId: 562]} Length = 158 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Ribonuclease H-like motif
superfamily: Ribonuclease H-like
family: RuvC resolvase
domain: RuvC resolvase
species: Escherichia coli [TaxId: 562]
 Score =  143 bits (361), Expect = 1e-35
 Identities = 62/154 (40%), Positives = 97/154 (62%), Gaps = 1/154 (0%)

Query: 7   IIGIDPGLRRTGWGIVDVAGDNLCFVSSGTIVSCVRQSLAFRLCQLYEGLTDVIKNWRPE 66
           I+GIDPG R TG+G++   G  L ++ SG I +     L  RL  +Y G+T++I  ++P+
Sbjct: 3   ILGIDPGSRVTGYGVIRQVGRQLSYLGSGCIRTK-VDDLPSRLKLIYAGVTEIITQFQPD 61

Query: 67  EAAVEQVFVNKDAVATLKLGQARAIAILSPALARIPVSEYAPNTIKKAVIGVGHGDKKQI 126
             A+EQVF+ K+A + LKLGQAR +AI++     +PV EYA   +K+ V+G+G  +K Q+
Sbjct: 62  YFAIEQVFMAKNADSALKLGQARGVAIVAAVNQELPVFEYAARQVKQTVVGIGSAEKSQV 121

Query: 127 HMMLKMLMPESFFKGKDAADALAIAVCHAYHANS 160
             M++ L+        DAADALAIA+ H + + +
Sbjct: 122 QHMVRTLLKLPANPQADAADALAIAITHCHVSQN 155


Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target169 Holliday junction resolvase [Candidatus Liberibacter as
d1hjra_158 RuvC resolvase {Escherichia coli [TaxId: 562]} 100.0
d1kcfa2218 Mitochondrial resolvase ydc2 catalytic domain {Fission 98.05
d1vhxa_140 Hypothetical protein YrrK (RuvX) {Bacillus subtilis [Ta 98.38
d1nu0a_138 Hypothetical protein YqgF (RuvX) {Escherichia coli [Tax 97.95
d1iv0a_98 Hypothetical protein, YqgF homologue {Thermus thermophi 97.64
d1okja1106 Hypothetical protein YeaZ {Escherichia coli [TaxId: 562 95.5
d2a6aa1103 Hypothetical protein TM0874 {Thermotoga maritima [TaxId 95.46
d1t6ca1126 Exopolyphosphatase Ppx {Aquifex aeolicus [TaxId: 63363] 94.44
d3bzka5149 Transcriptional accessory factor Tex {Pseudomonas aerug 98.27
d2aa4a1119 N-acetylmannosamine kinase NanK {Escherichia coli [TaxI 95.76
d2gupa1114 Hypothetical protein SP2142 {Streptococcus pneumoniae [ 95.35
d1huxa_259 Hydroxyglutaryl-CoA dehydratase component A {Acidaminoc 94.85
d2d0oa2241 Diol dehydratase-reactivating factor large subunit DdrA 91.2
d1zc6a1114 Probable N-acetylglucosamine kinase CV2896 {Chromobacte 91.0
>d1hjra_ c.55.3.6 (A:) RuvC resolvase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Ribonuclease H-like motif
superfamily: Ribonuclease H-like
family: RuvC resolvase
domain: RuvC resolvase
species: Escherichia coli [TaxId: 562]
Probab=100.00  E-value=0  Score=348.73  Aligned_cols=156  Identities=40%  Similarity=0.677  Sum_probs=150.2

Q ss_pred             EEEEECCCCCEEEEEEEEEECCEEEEEEEEEEECCCCCCHHHHHHHHHHHHHHHHHCCCCCEEEEEHHHHCCCHHHHHHH
Q ss_conf             69999788872058999971996899983368738899988899999998999862279627788503320241247889
Q gi|254780554|r    6 RIIGIDPGLRRTGWGIVDVAGDNLCFVSSGTIVSCVRQSLAFRLCQLYEGLTDVIKNWRPEEAAVEQVFVNKDAVATLKL   85 (169)
Q Consensus         6 rILGIDPGl~~tG~avie~~~~~~~li~~g~I~t~~~~~~~~Rl~~I~~~l~~ii~~~~Pd~vaiE~~F~~~n~~t~~~l   85 (169)
                      .|||||||+++|||||+|.++++++++++|+|+|+++ ++++||..|++++.++|++|+||.|++|++||++|++|++++
T Consensus         2 iILGIDPGl~~~G~avid~~~~~~~~v~~g~i~t~~~-~~~~Rl~~i~~~l~~li~~~~Pd~vaiE~~f~~~n~~sa~~l   80 (158)
T d1hjra_           2 IILGIDPGSRVTGYGVIRQVGRQLSYLGSGCIRTKVD-DLPSRLKLIYAGVTEIITQFQPDYFAIEQVFMAKNADSALKL   80 (158)
T ss_dssp             EEEEEECCSSEEEEEEEEEETTEEEEEEEEEEECCCS-CHHHHHHHHHHHHHHHHHHHCCSEEEEEECCCCCCTTTHHHH
T ss_pred             EEEEECCCCCCEEEEEEEEECCEEEEEEEEEEECCCC-CHHHHHHHHHHHHHHHHHCCCCCEEEEEEEHHCCCHHHHHHH
T ss_conf             8999836778658999996498789999527967998-769999999999999985349987898740002488999999


Q ss_pred             HHHHHHHHHHHHHCCCCEEEECHHHHHHHHCCCCCCCHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHCCCHH
Q ss_conf             99999999999860161775260677765316888899999999999628899999556789999999764168756
Q gi|254780554|r   86 GQARAIAILSPALARIPVSEYAPNTIKKAVIGVGHGDKKQIHMMLKMLMPESFFKGKDAADALAIAVCHAYHANSGY  162 (169)
Q Consensus        86 g~arGvi~l~~~~~~i~v~ey~P~~vKkavtG~G~A~KeqV~~mV~~ll~~~~~~~~D~aDAlAiAl~h~~~~~~~~  162 (169)
                      ||+||++++++.++++|++||+|++|||++||+|+|+|+||+.||+++|+++.++.+|++||+|+|+||+|..+|+.
T Consensus        81 ~~arG~i~l~a~~~~ipi~e~~P~~vKk~vtG~G~A~K~qV~~mv~~~l~l~~~~~~D~aDAlAiAl~h~~~~~~~~  157 (158)
T d1hjra_          81 GQARGVAIVAAVNQELPVFEYAARQVKQTVVGIGSAEKSQVQHMVRTLLKLPANPQADAADALAIAITHCHVSQNAM  157 (158)
T ss_dssp             HHHHHHHHHHHHTTTCCEEEEEHHHHHHHHTSSSSCCHHHHHHHHHHHTTCCCCCSSCTHHHHHHHHHHHHTTSSSC
T ss_pred             HHHHHHHHHHHHHCCCCEEECCHHHHHEEECCCCCCCHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHCCCC
T ss_conf             99999999999980865012441422201447887589999999999829999999987999999999998745656



>d1kcfa2 c.55.3.7 (A:39-256) Mitochondrial resolvase ydc2 catalytic domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1vhxa_ c.55.3.8 (A:) Hypothetical protein YrrK (RuvX) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nu0a_ c.55.3.8 (A:) Hypothetical protein YqgF (RuvX) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iv0a_ c.55.3.8 (A:) Hypothetical protein, YqgF homologue {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1okja1 c.55.1.9 (A:1-106) Hypothetical protein YeaZ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a6aa1 c.55.1.9 (A:1-103) Hypothetical protein TM0874 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1t6ca1 c.55.1.8 (A:7-132) Exopolyphosphatase Ppx {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d3bzka5 c.55.3.13 (A:325-473) Transcriptional accessory factor Tex {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2aa4a1 c.55.1.10 (A:1-119) N-acetylmannosamine kinase NanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gupa1 c.55.1.10 (A:1-114) Hypothetical protein SP2142 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1huxa_ c.55.1.5 (A:) Hydroxyglutaryl-CoA dehydratase component A {Acidaminococcus fermentans [TaxId: 905]} Back     information, alignment and structure
>d2d0oa2 c.55.1.6 (A:1-92,A:255-403) Diol dehydratase-reactivating factor large subunit DdrA {Klebsiella oxytoca [TaxId: 571]} Back     information, alignment and structure
>d1zc6a1 c.55.1.5 (A:8-121) Probable N-acetylglucosamine kinase CV2896 {Chromobacterium violaceum [TaxId: 536]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 169 Holliday junction resolvase [Candidatus Liberibact
1hjr_A_158 (A:) Holliday junction resolvase (RUVC); site-spec 3e-44
1vhx_A_150 (A:) Putative holliday junction resolvase; structu 5e-19
>1hjr_A (A:) Holliday junction resolvase (RUVC); site-specific recombinase; 2.50A {Escherichia coli}Length = 158 Back     alignment and structure
 Score =  171 bits (436), Expect = 3e-44
 Identities = 63/155 (40%), Positives = 98/155 (63%), Gaps = 1/155 (0%)

Query: 6   RIIGIDPGLRRTGWGIVDVAGDNLCFVSSGTIVSCVRQSLAFRLCQLYEGLTDVIKNWRP 65
            I+GIDPG R TG+G++   G  L ++ SG I + V   L  RL  +Y G+T++I  ++P
Sbjct: 2   IILGIDPGSRVTGYGVIRQVGRQLSYLGSGCIRTKVDD-LPSRLKLIYAGVTEIITQFQP 60

Query: 66  EEAAVEQVFVNKDAVATLKLGQARAIAILSPALARIPVSEYAPNTIKKAVIGVGHGDKKQ 125
           +  A+EQVF+ K+A + LKLGQAR +AI++     +PV EYA   +K+ V+G+G  +K Q
Sbjct: 61  DYFAIEQVFMAKNADSALKLGQARGVAIVAAVNQELPVFEYAARQVKQTVVGIGSAEKSQ 120

Query: 126 IHMMLKMLMPESFFKGKDAADALAIAVCHAYHANS 160
           +  M++ L+        DAADALAIA+ H + + +
Sbjct: 121 VQHMVRTLLKLPANPQADAADALAIAITHCHVSQN 155


>1vhx_A (A:) Putative holliday junction resolvase; structural genomics, hydrolase; 1.96A {Bacillus subtilis}Length = 150 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target169 Holliday junction resolvase [Candidatus Liberibacter as
1hjr_A_158 Holliday junction resolvase (RUVC); site-specific 100.0
1kcf_A_258 Hypothetical 30.2 KD protein C25G10.02 in chromoso 98.59
3bzc_A_326-467142 TEX; helix-turn-helix, helix-hairpin-helix, S1 dom 98.15
3i8b_A_1-74_255-284_436-494163 Xylulose kinase; strain ATCC 15703 / DSM 20083, 11 97.04
1vhx_A_150 Putative holliday junction resolvase; structural g 99.79
1nu0_A_138 Hypothetical protein YQGF; structural genomics, st 98.15
1iv0_A_98 Hypothetical protein; rnaseh-like, YQGF, structura 98.02
3en9_A_1-125_287-326165 Glycoprotease, O-sialoglycoprotein endopeptidase/p 97.0
2a6a_A_1-104_174-218149 Hypothetical protein TM0874; glycoprotein endopept 96.39
3eno_A_1-126_288-334173 Putative O-sialoglycoprotein endopeptidase; hydrol 96.14
2ivn_A_1-118_283-330166 O-sialoglycoprotein endopeptidase; UP1 keops compl 96.02
2gel_A_1-93_190-231135 Putative GRAM negative resuscitation promoting fac 95.9
1saz_A_1-172_333-381221 Probable butyrate kinase 2; askha (acetate and sug 94.25
1t6c_A_1-136_299-315153 Exopolyphosphatase; alpha/beta protein, actin-like 93.61
3c6a_A_232 Terminase large subunit; terminase nuclease, viral 96.34
2e1z_A_1-173_394-415195 Propionate kinase; TDCD, native, acetate kinase, n 93.73
1zc6_A_1-121_280-305147 Probable N-acetylglucosamine kinase; NESG, Q7NU07_ 93.17
3hi0_A_1-121121 Putative exopolyphosphatase; 17739545, structural 92.99
3cpe_A_384-592209 Terminase, DNA packaging protein GP17; large termi 92.89
2qm1_A_1-131_308-326150 Glucokinase; alpha-beta structure, putative helix- 92.87
2hoe_A_86-211_358-380149 N-acetylglucosamine kinase; TM1224, structural gen 92.85
3gbt_A_1-237237 Gluconate kinase; LBA0354, FGGY kinase family, car 92.75
2e2o_A_1-105_275-299130 Hexokinase; acetate and sugar kinases, HSP70, acti 92.67
3khy_A_1-158_371-384172 Propionate kinase; csgid, IDP01739, ATP-binding, n 92.24
1sz2_A_1-122_314-332141 Glucokinase, glucose kinase; ATP-dependent, glucos 92.24
2ch5_A_1-119_314-347153 NAGK protein; transferase, N-acetylglucosamine, gl 92.2
2aa4_A_1-119_275-289134 Mannac kinase, putative N-acetylmannosamine kinase 92.15
1hux_A_1-95_239-270127 Activator of (R)-2-hydroxyglutaryl-COA dehydratase 91.71
3eo3_A_1-144_315-333163 Bifunctional UDP-N-acetylglucosamine 2- epimerase/ 91.05
2iir_A_1-164_386-403182 Acetate kinase; transferase; 3.30A {Thermotoga mar 90.37
>1hjr_A (A:) Holliday junction resolvase (RUVC); site-specific recombinase; 2.50A {Escherichia coli} Back     alignment and structure
Probab=100.00  E-value=0  Score=304.61  Aligned_cols=156  Identities=40%  Similarity=0.668  Sum_probs=150.6

Q ss_pred             EEEEECCCCCEEEEEEEEEECCEEEEEEEEEEECCCCCCHHHHHHHHHHHHHHHHHCCCCCEEEEEHHHHCCCHHHHHHH
Q ss_conf             69999788872058999971996899983368738899988899999998999862279627788503320241247889
Q gi|254780554|r    6 RIIGIDPGLRRTGWGIVDVAGDNLCFVSSGTIVSCVRQSLAFRLCQLYEGLTDVIKNWRPEEAAVEQVFVNKDAVATLKL   85 (169)
Q Consensus         6 rILGIDPGl~~tG~avie~~~~~~~li~~g~I~t~~~~~~~~Rl~~I~~~l~~ii~~~~Pd~vaiE~~F~~~n~~t~~~l   85 (169)
                      ||||||||+++||||++|.++++++++++|+|+++ +.+.++|+..|++.+.+++++|+|+.|+||++||++|+++++++
T Consensus         2 rvLgiDpg~~~tG~av~~~~~~~~~~i~~g~i~~~-~~~~~~R~~~i~~~l~~~l~~~~p~~v~iE~~~~~~~~~s~~~l   80 (158)
T 1hjr_A            2 IILGIDPGSRVTGYGVIRQVGRQLSYLGSGCIRTK-VDDLPSRLKLIYAGVTEIITQFQPDYFAIEQVFMAKNADSALKL   80 (158)
T ss_dssp             EEEEEECCSSEEEEEEEEEETTEEEEEEEEEEECC-CSCHHHHHHHHHHHHHHHHHHHCCSEEEEEECCCCCCTTTHHHH
T ss_pred             EEEEECCCCCCEEEEEEEEECCEEEEEEEEEEECC-CCCHHHHHHHHHHHHHHHHHCCCCCEEEEEEHHHCCCHHHHHHH
T ss_conf             89998457784689999966997899995348459-87779999999999999986359866999841221573578889


Q ss_pred             HHHHHHHHHHHHHCCCCEEEECHHHHHHHHCCCCCCCHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHCCCHH
Q ss_conf             99999999999860161775260677765316888899999999999628899999556789999999764168756
Q gi|254780554|r   86 GQARAIAILSPALARIPVSEYAPNTIKKAVIGVGHGDKKQIHMMLKMLMPESFFKGKDAADALAIAVCHAYHANSGY  162 (169)
Q Consensus        86 g~arGvi~l~~~~~~i~v~ey~P~~vKkavtG~G~A~KeqV~~mV~~ll~~~~~~~~D~aDAlAiAl~h~~~~~~~~  162 (169)
                      ++++|++++++.++++|+.+|+|+++||++||+|+|+||||++||+++++...++++|++||+|+|+||+++.++.+
T Consensus        81 ~~~~G~i~~~~~~~~ipi~~v~P~~vKk~~tG~G~A~Ke~v~~~v~~~~~~~~~~~dd~aDA~aia~~~~~~~~~~~  157 (158)
T 1hjr_A           81 GQARGVAIVAAVNQELPVFEYAARQVKQTVVGIGSAEKSQVQHMVRTLLKLPANPQADAADALAIAITHCHVSQNAM  157 (158)
T ss_dssp             HHHHHHHHHHHHTTTCCEEEEEHHHHHHHHTSSSSCCHHHHHHHHHHHTTCCCCCSSCTHHHHHHHHHHHHTTSSSC
T ss_pred             HHHHHHHHHHHHHCCCEEEEECHHHHHHHHCCCCCCCHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHCCCC
T ss_conf             99999999999975973899768998876105997799999999999839899999987999999999988734657



>1kcf_A (A:) Hypothetical 30.2 KD protein C25G10.02 in chromosome I; beta-alpha-beta motif, RUVC resolvase family, hydrolase; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3bzc_A (A:326-467) TEX; helix-turn-helix, helix-hairpin-helix, S1 domain, YQGF domain, transcription, RNA binding protein; 2.27A {Pseudomonas aeruginosa} Back     alignment and structure
>3i8b_A (A:1-74,A:255-284,A:436-494) Xylulose kinase; strain ATCC 15703 / DSM 20083, 11200J,, transferase, structural genomics, PSI-2; 2.00A {Bifidobacterium adolescentis ATCC15703} Back     alignment and structure
>1vhx_A (A:) Putative holliday junction resolvase; structural genomics, hydrolase; 1.96A {Bacillus subtilis} Back     alignment and structure
>1nu0_A (A:) Hypothetical protein YQGF; structural genomics, structure 2 function project, S2F, unknown function; 1.60A {Escherichia coli} Back     alignment and structure
>1iv0_A (A:) Hypothetical protein; rnaseh-like, YQGF, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Thermus thermophilus} Back     alignment and structure
>3en9_A (A:1-125,A:287-326) Glycoprotease, O-sialoglycoprotein endopeptidase/protein kinase; endopeptidase activity, protein kinase activity; HET: TBR; 2.67A {Methanocaldococcus jannaschii} PDB: 3enh_A* 2vwb_A* Back     alignment and structure
>2a6a_A (A:1-104,A:174-218) Hypothetical protein TM0874; glycoprotein endopeptidase, structural genomics, joint center for structural genomics, JCSG; 2.50A {Thermotoga maritima MSB8} Back     alignment and structure
>3eno_A (A:1-126,A:288-334) Putative O-sialoglycoprotein endopeptidase; hydrolase, metal-binding, metalloprotease, protease, zinc, keops complex, ATPase, metal ION binding; 3.02A {Thermoplasma acidophilum} Back     alignment and structure
>2ivn_A (A:1-118,A:283-330) O-sialoglycoprotein endopeptidase; UP1 keops complex, Fe/Zn dependent nucleotide phosphatase, metalloprotease, hypothetical protein, zinc; HET: ANP; 1.65A {Pyrococcus abyssi} PDB: 2ivo_A 2ivp_A* Back     alignment and structure
>2gel_A (A:1-93,A:190-231) Putative GRAM negative resuscitation promoting factor; YEAZ, RPF, actin-like-fold, glycoprotease, chaperone; 2.05A {Salmonella typhimurium LT2} PDB: 2gem_A 1okj_A Back     alignment and structure
>1saz_A (A:1-172,A:333-381) Probable butyrate kinase 2; askha (acetate and sugar kinases, HSC70, actin) superfamily, acetate kinase, isobutyrate kinase; HET: ACP; 2.50A {Thermotoga maritima} Back     alignment and structure
>1t6c_A (A:1-136,A:299-315) Exopolyphosphatase; alpha/beta protein, actin-like fold, hydrolase; 1.53A {Aquifex aeolicus VF5} Back     alignment and structure
>3c6a_A (A:) Terminase large subunit; terminase nuclease, viral protein; 1.16A {Enterobacteria phage RB49} PDB: 3c6h_A Back     alignment and structure
>2e1z_A (A:1-173,A:394-415) Propionate kinase; TDCD, native, acetate kinase, nucleotide, AP4A, ADP, ATP, AMPPNP, transferase; HET: B4P; 1.98A {Salmonella typhimurium} Back     alignment and structure
>1zc6_A (A:1-121,A:280-305) Probable N-acetylglucosamine kinase; NESG, Q7NU07_chrvo, CVR23, structural genomics, PSI, protein structure initiative; 2.20A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>3hi0_A (A:1-121) Putative exopolyphosphatase; 17739545, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>3cpe_A (A:384-592) Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A* Back     alignment and structure
>2qm1_A (A:1-131,A:308-326) Glucokinase; alpha-beta structure, putative helix-turn-helix, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.02A {Enterococcus faecalis V583} Back     alignment and structure
>2hoe_A (A:86-211,A:358-380) N-acetylglucosamine kinase; TM1224, structural genomics, PSI-2, protein structure initiative, joint center for structural genomics, JCSG; 2.46A {Thermotoga maritima} Back     alignment and structure
>3gbt_A (A:1-237) Gluconate kinase; LBA0354, FGGY kinase family, carbohydrate metabolic process, transferase, structural genomics, PSI-2; 2.40A {Lactobacillus acidophilus ncfm} Back     alignment and structure
>2e2o_A (A:1-105,A:275-299) Hexokinase; acetate and sugar kinases, HSP70, actin superfamily, ribonuclease-H fold, sugar kinase, glucose, conformational change; HET: BGC; 1.65A {Sulfolobus tokodaii} PDB: 2e2n_A* 2e2p_A* 2e2q_A* Back     alignment and structure
>3khy_A (A:1-158,A:371-384) Propionate kinase; csgid, IDP01739, ATP-binding, nucleotide-binding, transferase, structural genomics; 1.98A {Francisella tularensis subsp} Back     alignment and structure
>1sz2_A (A:1-122,A:314-332) Glucokinase, glucose kinase; ATP-dependent, glucose binding, transferase; HET: MSE BGC; 2.20A {Escherichia coli} Back     alignment and structure
>2ch5_A (A:1-119,A:314-347) NAGK protein; transferase, N-acetylglucosamine, glcnac, sugar kinase, ribonuclease H fold, sugar kinase/HSP70/actin superfamily, domain rotation; HET: NAG NDG; 1.9A {Homo sapiens} Back     alignment and structure
>2aa4_A (A:1-119,A:275-289) Mannac kinase, putative N-acetylmannosamine kinase; sugar methabolism, structural genomics, PSI, protein structure initiative; 2.20A {Escherichia coli} Back     alignment and structure
>1hux_A (A:1-95,A:239-270) Activator of (R)-2-hydroxyglutaryl-COA dehydratase; actin fold, metal binding protein; HET: ADP; 3.00A {Acidaminococcus fermentans} Back     alignment and structure
>3eo3_A (A:1-144,A:315-333) Bifunctional UDP-N-acetylglucosamine 2- epimerase/N-acetylmannosamine kinase; non-protein kinase, sialic acid biosynthesis; 2.84A {Homo sapiens} Back     alignment and structure
>2iir_A (A:1-164,A:386-403) Acetate kinase; transferase; 3.30A {Thermotoga maritima} Back     alignment and structure