254780575

254780575

hypothetical protein CLIBASIA_02310

GeneID in NCBI database:8209572Locus tag:CLIBASIA_02310
Protein GI in NCBI database:254780575Protein Accession:YP_003064988.1
Gene range:-(706902, 707852)Protein Length:316aa
Gene description:hypothetical protein
COG prediction:[R] Predicted permeases
KEGG prediction:hypothetical protein; K05786 chloramphenicol-sensitive protein RarD
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM9 TM-Helix
TOPPRED9 TM-Helix
HMMTOP10 TM-Helix
MEMSAT10 TM-Helix
MEMSAT_SVM10 TM-Helix
PHOBIUS10 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310------
MGKGATKKEYSKGLSKENASLPTMMGTLFVFCAYILWGITPLYTQFLEQVSVLEVISHRVLWSLPGVFFAIVYFSGGLSLLKDTLKNPKAVGMLVFSATILAVHWGFFIYALLTRQGFLTSFSYFVTPVISVFLGSVFLKERLNHLQIIAALLIILSLLIMTLHSGIPLLSLAIAVTWSAYCFARKTIPVGSSEGFFIEMCVLAIPALFYVVWNGFSGGEHFFLGNIPDTLFLIGYGLLNSFVFCIFSYGIKRAKLSTVGIMEYTAPLLMIVSSVFILKQPIDTVRTIVFGIVVIAMVVYLLPTVINSGKNKTKKS
ccccHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHccc
ccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHcccccHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHccHHcHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHcc
mgkgatkkeyskglskenaslptmmGTLFVFCAYILWGITPLYTQFLEQVSVLEVISHRVLWSLPGVFFAIVYFSGGLSLLkdtlknpkavGMLVFSATILAVHWGFFIYALLTRQGFLTSFSYFVTPVISVFLGSVFLKERLNHLQIIAALLIILSLLIMTLHSGIPLLSLAIAVTWSAYCfarktipvgssegFFIEMCVLAIPALFYVVWngfsggehfflgnipdtLFLIGYGLLNSFVFCIFSYGIKRAKLSTVGIMEYTAPLLMIVSSVFIlkqpidtvrTIVFGIVVIAMVVYLLPTvinsgknktkks
mgkgatkkeyskglskenaslptMMGTLFVFCAYILWGITPLYTQFLEQVSVLEVISHRVLWSLPGVFFAIVYFSGGLSLLKDTLKNPKAVGMLVFSATILAVHWGFFIYALLTRQGFLTSFSYFVTPVISVFLGSVFLKERLNHLQIIAALLIILSLLIMTLHSGIPLLSLAIAVTWSAYCFARKTIPVGSSEGFFIEMCVLAIPALFYVVWNGFSGGEHFFLGNIPDTLFLIGYGLLNSFVFCIFSYGIKRAKLSTVGIMEYTAPLLMIVSSVFILKQPIDTVRTIVFGIVVIAMVVYLLptvinsgknktkks
MGKGATKKEYSKGLSKENASLPTMMGTLFVFCAYILWGITPLYTQFLEQVSVLEVISHRVLWSLPGVFFAIVYFSGGLSLLKDTLKNPKAVGMLVFSATILAVHWGFFIYALLTRQGFLTSFSYFVTPVISVFLGSVFLKERLNHLQiiaalliilslliMTLHSGIPLLSLAIAVTWSAYCFARKTIPVGSSEGFFIEMCVLAIPALFYVVWNGFSGGEHFFLGNIPDTLFLIGYGLLNSFVFCIFSYGIKRAKLSTVGIMEYTAPLLMIVSSVFILKQPIDTVRTIVFGIVVIAMVVYLLPTVINSGKNKTKKS
***************************LFVFCAYILWGITPLYTQFLEQVSVLEVISHRVLWSLPGVFFAIVYFSGGLSLLKDTLKNPKAVGMLVFSATILAVHWGFFIYALLTRQGFLTSFSYFVTPVISVFLGSVFLKERLNHLQIIAALLIILSLLIMTLHSGIPLLSLAIAVTWSAYCFARKTIPVGSSEGFFIEMCVLAIPALFYVVWNGFSGGEHFFLGNIPDTLFLIGYGLLNSFVFCIFSYGIKRAKLSTVGIMEYTAPLLMIVSSVFILKQPIDTVRTIVFGIVVIAMVVYLLPTV***********
**************SKENASLPTMMGTLFVFCAYILWGITPLYTQFLEQVSVLEVISHRVLWSLPGVFFAIVYFSGGLSLLKDTLKNPKAVGMLVFSATILAVHWGFFIYALLTRQGFLTSFSYFVTPVISVFLGSVFLKERLNHLQIIAALLIILSLLIMTLHSGIPLLSLAIAVTWSAYCFARKTIPVGSSEGFFIEMCVLAIPALFYVVWNGFSGGEHFFLGNIPDTLFLIGYGLLNSFVFCIFSYGIKRAKLSTVGIMEYTAPLLMIVSSVFILKQPIDTVRTIVFGIVVIAMVVYLLPTVINSGKNKTKKS
******KKEYSKGLS*****LPTMMGTLFVFCAYILWGITPLYTQFLEQVSVLEVISHRVLWSLPGVFFAIVYFSGGLSLLKDTLKNPKAVGMLVFSATILAVHWGFFIYALLTRQGFLTSFSYFVTPVISVFLGSVFLKERLNHLQIIAALLIILSLLIMTLHSGIPLLSLAIAVTWSAYCFARKTIPVGSSEGFFIEMCVLAIPALFYVVWNGFSGGEHFFLGNIPDTLFLIGYGLLNSFVFCIFSYGIKRAKLSTVGIMEYTAPLLMIVSSVFILKQPIDTVRTIVFGIVVIAMVVYLLPTVINSGKN*****
ooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiii
xxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooHHHHHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGKGATKKEYSKGLSKENASLPTMMGTLFVFCAYILWGITPLYTQFLEQVSVLEVISHRVLWSLPGVFFAIVYFSGGLSLLKDTLKNPKAVGMLVFSATILAVHWGFFIYALLTRQGFLTSFSYFVTPVISVFLGSVFLKERLNHLQIIAALLIILSLLIMTLHSGIPLLSLAIAVTWSAYCFARKTIPVGSSEGFFIEMCVLAIPALFYVVWNGFSGGEHFFLGNIPDTLFLIGYGLLNSFVFCIFSYGIKRAKLSTVGIMEYTAPLLMIVSSVFILKQPIDTVRTIVFGIVVIAMVVYLLPTVINSGKNKTKKS
MGKGATKKEYSKGLSKENASLPTMMGTLFVFCAYILWGITPLYTQFLEQVSVLEVISHRVLWSLPGVFFAIVYFSGGLSLLKDTLKNPKAVGMLVFSATILAVHWGFFIYALLTRQGFLTSFSYFVTPVISVFLGSVFLKERLNHLQIIAALLIILSLLIMTLHSGIPLLSLAIAVTWSAYCFARKTIPVGSSEGFFIEMCVLAIPALFYVVWNGFSGGEHFFLGNIPDTLFLIGYGLLNSFVFCIFSYGIKRAKLSTVGIMEYTAPLLMIVSSVFILKQPIDTVRTIVFGIVVIAMVVYLLPTVINSGKNKTKKS
MGKGATKKEYSKGLSKENASLPTMMGTLFVFCAYILWGITPLYTQFLEQVSVLEVISHRVLWSLPGVFFAIVYFSGGLSLLKDTLKNPKAVGMLVFSATILAVHWGFFIYALLTRQGFLTSFSYFVTPVISVFLGSVFLKERLNHLQIIAALLIILSLLIMTLHSGIPLLSLAIAVTWSAYCFARKTIPVGSSEGFFIEMCVLAIPALFYVVWNGFSGGEHFFLGNIPDTLFLIGYGLLNSFVFCIFSYGIKRAKLSTVGIMEYTAPLLMIVSSVFILKQPIDTVRTIVFGIVVIAMVVYLLPTVINSGKNKTKKS

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target316 hypothetical protein CLIBASIA_02310 [Candidatus Liberib
315121768311 hypothetical protein CKC_00090 [Candidatus Liberibacter 1 1e-114
159184603302 hypothetical protein Atu1068 [Agrobacterium tumefaciens 1 1e-53
325292447302 RarD protein [Agrobacterium sp. H13-3] Length = 302 1 3e-53
254511642301 RarD protein [Rhodobacteraceae bacterium KLH11] Length 1 4e-49
260469774305 RarD protein, DMT superfamily transporter [Mesorhizobiu 1 9e-49
319784474308 RarD protein, DMT superfamily transporter [Mesorhizobiu 1 2e-48
222085416303 hypothetical protein Arad_1629 [Agrobacterium radiobact 1 6e-48
110633324306 transporter DMT superfamily protein [Mesorhizobium sp. 1 2e-47
15964870313 hypothetical protein SMc02545 [Sinorhizobium meliloti 1 1 4e-47
260432350361 RarD protein [Silicibacter lacuscaerulensis ITI-1157] L 1 5e-47
>gi|315121768|ref|YP_004062257.1| hypothetical protein CKC_00090 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 311 Back     alignment and organism information
 Score =  415 bits (1067), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 204/312 (65%), Positives = 259/312 (83%), Gaps = 2/312 (0%)

Query: 1   MGKGATKK-EYSKGLSKENASLPTMMGTLFVFCAYILWGITPLYTQFLEQVSVLEVISHR 59
           M  G  KK ++SK L K N +  T+ G L V  A+I WG+TPLYTQFLE+VSVLEVISHR
Sbjct: 1   MQNGVNKKQDFSKKLDK-NGNQTTITGLLCVLFAFIAWGMTPLYTQFLEKVSVLEVISHR 59

Query: 60  VLWSLPGVFFAIVYFSGGLSLLKDTLKNPKAVGMLVFSATILAVHWGFFIYALLTRQGFL 119
           +LWSLPGVFFA+VYFSGGLSLLK TLKNPK + ML+ SA +LA HW  F+YALL+RQG  
Sbjct: 60  ILWSLPGVFFAVVYFSGGLSLLKSTLKNPKTLFMLMVSAALLASHWSVFVYALLSRQGLA 119

Query: 120 TSFSYFVTPVISVFLGSVFLKERLNHLQIIAALLIILSLLIMTLHSGIPLLSLAIAVTWS 179
           TS S+FVTPV ++ LG++FLKERLN LQIIAA+ I+ +++IMT+++GIP+LSLAIAVTWS
Sbjct: 120 TSLSFFVTPVFALSLGAIFLKERLNLLQIIAAINIVAAMVIMTIYNGIPMLSLAIAVTWS 179

Query: 180 AYCFARKTIPVGSSEGFFIEMCVLAIPALFYVVWNGFSGGEHFFLGNIPDTLFLIGYGLL 239
           AYCFARKTIPV S+EGFFIEMC+LA+PALFYV+W   +   HFF+ N  +T FL+GYGLL
Sbjct: 180 AYCFARKTIPVNSNEGFFIEMCILAVPALFYVIWLIVADKNHFFMHNTQETFFLMGYGLL 239

Query: 240 NSFVFCIFSYGIKRAKLSTVGIMEYTAPLLMIVSSVFILKQPIDTVRTIVFGIVVIAMVV 299
           NS +FC+F+YGIKR KL+TVG+MEY APLLM  ++VFILKQPI+TV  +VF +V++AM++
Sbjct: 240 NSIIFCVFAYGIKRTKLTTVGLMEYIAPLLMAANTVFILKQPINTVNIVVFSMVIVAMII 299

Query: 300 YLLPTVINSGKN 311
           Y+LPT++N+ K+
Sbjct: 300 YVLPTILNNKKS 311


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|159184603|ref|NP_354092.2| hypothetical protein Atu1068 [Agrobacterium tumefaciens str. C58] Length = 302 Back     alignment and organism information
>gi|325292447|ref|YP_004278311.1| RarD protein [Agrobacterium sp. H13-3] Length = 302 Back     alignment and organism information
>gi|254511642|ref|ZP_05123709.1| RarD protein [Rhodobacteraceae bacterium KLH11] Length = 301 Back     alignment and organism information
>gi|260469774|ref|ZP_05813932.1| RarD protein, DMT superfamily transporter [Mesorhizobium opportunistum WSM2075] Length = 305 Back     alignment and organism information
>gi|319784474|ref|YP_004143950.1| RarD protein, DMT superfamily transporter [Mesorhizobium ciceri biovar biserrulae WSM1271] Length = 308 Back     alignment and organism information
>gi|222085416|ref|YP_002543946.1| hypothetical protein Arad_1629 [Agrobacterium radiobacter K84] Length = 303 Back     alignment and organism information
>gi|110633324|ref|YP_673532.1| transporter DMT superfamily protein [Mesorhizobium sp. BNC1] Length = 306 Back     alignment and organism information
>gi|15964870|ref|NP_385223.1| hypothetical protein SMc02545 [Sinorhizobium meliloti 1021] Length = 313 Back     alignment and organism information
>gi|260432350|ref|ZP_05786321.1| RarD protein [Silicibacter lacuscaerulensis ITI-1157] Length = 361 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target316 hypothetical protein CLIBASIA_02310 [Candidatus Liberib
PRK15430296 PRK15430, PRK15430, putative chloramphenical resistance 1e-28
TIGR00688256 TIGR00688, rarD, rarD protein 1e-26
COG2962293 COG2962, RarD, Predicted permeases [General function pr 9e-47
pfam00892126 pfam00892, EamA, EamA-like transporter family 0.003
>gnl|CDD|185328 PRK15430, PRK15430, putative chloramphenical resistance permease RarD; Provisional Back     alignment and domain information
>gnl|CDD|129771 TIGR00688, rarD, rarD protein Back     alignment and domain information
>gnl|CDD|32782 COG2962, RarD, Predicted permeases [General function prediction only] Back     alignment and domain information
>gnl|CDD|144477 pfam00892, EamA, EamA-like transporter family Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 316 hypothetical protein CLIBASIA_02310 [Candidatus Liberib
COG2962293 RarD Predicted permeases [General function prediction o 100.0
PRK11272293 hypothetical protein; Provisional 100.0
PRK11453299 O-acetylserine/cysteine export protein; Provisional 100.0
PRK11689295 hypothetical protein; Provisional 100.0
TIGR00950275 2A78 Carboxylate/Amino Acid/Amine Transporter; InterPro 99.97
PRK10532293 threonine and homoserine efflux system; Provisional 99.96
COG0697292 RhaT Permeases of the drug/metabolite transporter (DMT) 99.94
COG5006292 rhtA Threonine/homoserine efflux transporter [Amino aci 99.84
KOG4510346 consensus 99.82
TIGR03340281 phn_DUF6 phosphonate utilization associated putative me 99.73
pfam08449303 UAA UAA transporter family. This family includes transp 99.5
pfam06027335 DUF914 Eukaryotic protein of unknown function (DUF914). 99.43
KOG1441316 consensus 98.94
KOG2234345 consensus 98.88
KOG1443349 consensus 98.67
TIGR00776336 RhaT RhaT L-rhamnose-proton symporter family protein; I 98.17
pfam05653300 DUF803 Protein of unknown function (DUF803). This famil 98.14
COG4975288 GlcU Putative glucose uptake permease [Carbohydrate tra 97.47
KOG2766336 consensus 97.25
KOG2922335 consensus 96.76
TIGR00817346 tpt Tpt phosphate/phosphoenolpyruvate translocator; Int 96.07
TIGR00688259 rarD RarD protein; InterPro: IPR004626 This uncharacter 99.68
pfam00892126 EamA EamA-like transporter family. This family includes 99.63
KOG1441 316 consensus 96.72
TIGR00817 346 tpt Tpt phosphate/phosphoenolpyruvate translocator; Int 95.8
pfam00892126 EamA EamA-like transporter family. This family includes 99.3
COG2510140 Predicted membrane protein [Function unknown] 99.08
PRK11272293 hypothetical protein; Provisional 98.88
PRK11453299 O-acetylserine/cysteine export protein; Provisional 98.75
TIGR00950275 2A78 Carboxylate/Amino Acid/Amine Transporter; InterPro 98.36
PRK11689295 hypothetical protein; Provisional 98.33
pfam08449303 UAA UAA transporter family. This family includes transp 97.9
pfam03151149 TPT Triose-phosphate Transporter family. This family in 97.86
PRK10532293 threonine and homoserine efflux system; Provisional 97.85
pfam06027335 DUF914 Eukaryotic protein of unknown function (DUF914). 97.67
pfam06800268 Sugar_transport Sugar transport protein. This is a fami 96.95
COG2510140 Predicted membrane protein [Function unknown] 99.25
TIGR03340 281 phn_DUF6 phosphonate utilization associated putative me 98.89
COG0697 292 RhaT Permeases of the drug/metabolite transporter (DMT) 98.6
PRK02971129 hypothetical protein; Provisional 98.42
PRK10452120 multidrug efflux system protein MdtJ; Provisional 98.23
COG2962 293 RarD Predicted permeases [General function prediction o 98.19
pfam03151149 TPT Triose-phosphate Transporter family. This family in 98.04
PRK09541110 emrE multidrug efflux protein; Reviewed 98.0
PRK10650109 multidrug efflux system protein MdtI; Provisional 97.95
COG2076106 EmrE Membrane transporters of cations and cationic drug 97.9
TIGR00776 336 RhaT RhaT L-rhamnose-proton symporter family protein; I 97.8
PRK11431105 quaternary ammonium compound-resistance protein SugE; P 97.72
KOG4510 346 consensus 97.49
pfam0089393 Multi_Drug_Res Small Multidrug Resistance protein. This 96.75
pfam04657139 DUF606 Protein of unknown function, DUF606. This family 96.27
KOG2922335 consensus 96.24
COG4975 288 GlcU Putative glucose uptake permease [Carbohydrate tra 95.26
KOG2765416 consensus 99.18
pfam04142238 Nuc_sug_transp Nucleotide-sugar transporter. This famil 98.78
KOG1581327 consensus 98.66
KOG1444314 consensus 98.65
COG5070309 VRG4 Nucleotide-sugar transporter [Carbohydrate transpo 98.15
pfam06800268 Sugar_transport Sugar transport protein. This is a fami 98.04
KOG3912372 consensus 95.81
KOG4314290 consensus 95.24
KOG1580337 consensus 98.18
KOG1583330 consensus 97.41
KOG1442347 consensus 97.28
KOG1582367 consensus 97.12
TIGR00803235 nst UDP-galactose transporter; InterPro: IPR004689 Nucl 90.58
pfam05653300 DUF803 Protein of unknown function (DUF803). This famil 97.44
pfam04142238 Nuc_sug_transp Nucleotide-sugar transporter. This famil 97.22
KOG2765 416 consensus 96.92
KOG2234345 consensus 95.56
KOG4314290 consensus 94.81
pfam10639112 UPF0546 Uncharacterized protein family UPF0546. This fa 93.52
COG3086150 RseC Positive regulator of sigma E activity [Signal tra 93.2
pfam04246135 RseC_MucC Positive regulator of sigma(E), RseC/MucC. Th 92.42
>COG2962 RarD Predicted permeases [General function prediction only] Back     alignment and domain information
>PRK11272 hypothetical protein; Provisional Back     alignment and domain information
>PRK11453 O-acetylserine/cysteine export protein; Provisional Back     alignment and domain information
>PRK11689 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00950 2A78 Carboxylate/Amino Acid/Amine Transporter; InterPro: IPR004779 Proteins in this entry contain between eight and ten predicted transmembrane regions and are thought to function as transporters Back     alignment and domain information
>PRK10532 threonine and homoserine efflux system; Provisional Back     alignment and domain information
>COG0697 RhaT Permeases of the drug/metabolite transporter (DMT) superfamily [Carbohydrate transport and metabolism / Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>COG5006 rhtA Threonine/homoserine efflux transporter [Amino acid transport and metabolism] Back     alignment and domain information
>KOG4510 consensus Back     alignment and domain information
>TIGR03340 phn_DUF6 phosphonate utilization associated putative membrane protein Back     alignment and domain information
>pfam08449 UAA UAA transporter family Back     alignment and domain information
>pfam06027 DUF914 Eukaryotic protein of unknown function (DUF914) Back     alignment and domain information
>KOG1441 consensus Back     alignment and domain information
>KOG2234 consensus Back     alignment and domain information
>KOG1443 consensus Back     alignment and domain information
>TIGR00776 RhaT RhaT L-rhamnose-proton symporter family protein; InterPro: IPR004673 These proteins are members of the L-Rhamnose Symporter (RhaT) family Back     alignment and domain information
>pfam05653 DUF803 Protein of unknown function (DUF803) Back     alignment and domain information
>COG4975 GlcU Putative glucose uptake permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2766 consensus Back     alignment and domain information
>KOG2922 consensus Back     alignment and domain information
>TIGR00817 tpt Tpt phosphate/phosphoenolpyruvate translocator; InterPro: IPR004696 Functionally characterised members of the 6-8 TMS Triose-phosphate Transporter (TPT) family are derived from the inner envelope membranes of chloroplasts and non-green plastids of plants Back     alignment and domain information
>TIGR00688 rarD RarD protein; InterPro: IPR004626 This uncharacterised protein is predicted to have many membrane-spanning domains Back     alignment and domain information
>pfam00892 EamA EamA-like transporter family Back     alignment and domain information
>KOG1441 consensus Back     alignment and domain information
>TIGR00817 tpt Tpt phosphate/phosphoenolpyruvate translocator; InterPro: IPR004696 Functionally characterised members of the 6-8 TMS Triose-phosphate Transporter (TPT) family are derived from the inner envelope membranes of chloroplasts and non-green plastids of plants Back     alignment and domain information
>pfam00892 EamA EamA-like transporter family Back     alignment and domain information
>COG2510 Predicted membrane protein [Function unknown] Back     alignment and domain information
>PRK11272 hypothetical protein; Provisional Back     alignment and domain information
>PRK11453 O-acetylserine/cysteine export protein; Provisional Back     alignment and domain information
>TIGR00950 2A78 Carboxylate/Amino Acid/Amine Transporter; InterPro: IPR004779 Proteins in this entry contain between eight and ten predicted transmembrane regions and are thought to function as transporters Back     alignment and domain information
>PRK11689 hypothetical protein; Provisional Back     alignment and domain information
>pfam08449 UAA UAA transporter family Back     alignment and domain information
>pfam03151 TPT Triose-phosphate Transporter family Back     alignment and domain information
>PRK10532 threonine and homoserine efflux system; Provisional Back     alignment and domain information
>pfam06027 DUF914 Eukaryotic protein of unknown function (DUF914) Back     alignment and domain information
>pfam06800 Sugar_transport Sugar transport protein Back     alignment and domain information
>COG2510 Predicted membrane protein [Function unknown] Back     alignment and domain information
>TIGR03340 phn_DUF6 phosphonate utilization associated putative membrane protein Back     alignment and domain information
>COG0697 RhaT Permeases of the drug/metabolite transporter (DMT) superfamily [Carbohydrate transport and metabolism / Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK02971 hypothetical protein; Provisional Back     alignment and domain information
>PRK10452 multidrug efflux system protein MdtJ; Provisional Back     alignment and domain information
>COG2962 RarD Predicted permeases [General function prediction only] Back     alignment and domain information
>pfam03151 TPT Triose-phosphate Transporter family Back     alignment and domain information
>PRK09541 emrE multidrug efflux protein; Reviewed Back     alignment and domain information
>PRK10650 multidrug efflux system protein MdtI; Provisional Back     alignment and domain information
>COG2076 EmrE Membrane transporters of cations and cationic drugs [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00776 RhaT RhaT L-rhamnose-proton symporter family protein; InterPro: IPR004673 These proteins are members of the L-Rhamnose Symporter (RhaT) family Back     alignment and domain information
>PRK11431 quaternary ammonium compound-resistance protein SugE; Provisional Back     alignment and domain information
>KOG4510 consensus Back     alignment and domain information
>pfam00893 Multi_Drug_Res Small Multidrug Resistance protein Back     alignment and domain information
>pfam04657 DUF606 Protein of unknown function, DUF606 Back     alignment and domain information
>KOG2922 consensus Back     alignment and domain information
>COG4975 GlcU Putative glucose uptake permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2765 consensus Back     alignment and domain information
>pfam04142 Nuc_sug_transp Nucleotide-sugar transporter Back     alignment and domain information
>KOG1581 consensus Back     alignment and domain information
>KOG1444 consensus Back     alignment and domain information
>COG5070 VRG4 Nucleotide-sugar transporter [Carbohydrate transport and metabolism / Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] Back     alignment and domain information
>pfam06800 Sugar_transport Sugar transport protein Back     alignment and domain information
>KOG3912 consensus Back     alignment and domain information
>KOG4314 consensus Back     alignment and domain information
>KOG1580 consensus Back     alignment and domain information
>KOG1583 consensus Back     alignment and domain information
>KOG1442 consensus Back     alignment and domain information
>KOG1582 consensus Back     alignment and domain information
>TIGR00803 nst UDP-galactose transporter; InterPro: IPR004689 Nucleotide-sugar transporters (NSTs) are found in the Golgi apparatus and the endoplasmic reticulum of eukaryotic cells Back     alignment and domain information
>pfam05653 DUF803 Protein of unknown function (DUF803) Back     alignment and domain information
>pfam04142 Nuc_sug_transp Nucleotide-sugar transporter Back     alignment and domain information
>KOG2765 consensus Back     alignment and domain information
>KOG2234 consensus Back     alignment and domain information
>KOG4314 consensus Back     alignment and domain information
>pfam10639 UPF0546 Uncharacterized protein family UPF0546 Back     alignment and domain information
>COG3086 RseC Positive regulator of sigma E activity [Signal transduction mechanisms] Back     alignment and domain information
>pfam04246 RseC_MucC Positive regulator of sigma(E), RseC/MucC Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target316 hypothetical protein CLIBASIA_02310 [Candidatus Liberib
2i68_A137 Protein EMRE; transmembrane protein, small-multidrug re 98.55
3b5d_A110 Multidrug transporter EMRE; helical membrane protein, m 97.99
>2i68_A Protein EMRE; transmembrane protein, small-multidrug resistance, transporter, homodimer, dual topology, transport protein; NMR {Escherichia coli} Back     alignment and structure
Probab=98.55  E-value=1e-07  Score=57.78  Aligned_cols=72  Identities=11%  Similarity=0.070  Sum_probs=61.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCHHHHHHH-HHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             53344211579999999862586999999-9999999999999997888998999999999999999999999
Q gi|254780575|r  234 IGYGLLNSFVFCIFSYGIKRAKLSTVGIM-EYTAPLLMIVSSVFILKQPIDTVRTIVFGIVVIAMVVYLLPTV  305 (316)
Q Consensus       234 ~l~~~~t~i~~~~~~~a~~~~~a~~~s~~-~~l~Pv~a~i~~~~~l~E~~~~~~~iG~~lIi~gv~l~~~~~~  305 (316)
                      ...+++-.++++++..++|++|.+.+=.+ .-+..+.+++.|+++|||++++.+++|..+|++|+++..+.+.
T Consensus        34 i~~i~~y~~sf~~ls~alk~iplgvAYAiWsGlG~v~~~lig~~~f~E~ls~~~ilgi~LIi~GVv~Lnl~s~  106 (137)
T 2i68_A           34 VGTIICYCASFWLLAQTLAYIPTGIAYAIWSGVGIVLISLLSWGFFGQRLDLPAIIGMMLICAGVLIINLLSR  106 (137)
T ss_dssp             CHHHHHHHHHHHHHHHHHC-----CHHHHHHHHHHHHHHHHHHHHHC------CHHHHHHHHHHHHHHHHC--
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHEECCCC
T ss_conf             9999999999999999997398422799998899999999999994799989999999999999982220578



>3b5d_A Multidrug transporter EMRE; helical membrane protein, multidrug resistance transporter, SMR, antiport, inner membrane, transmembrane; HET: P4P; 3.80A {Escherichia coli K12} PDB: 3b61_A 3b62_A* Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 316 hypothetical protein CLIBASIA_02310 [Candidatus Li
2i68_A_137 (A:) Protein EMRE; transmembrane protein, small-mu 3e-04
>2i68_A (A:) Protein EMRE; transmembrane protein, small-multidrug resistance, transporter, homodimer, dual topology, transport protein; NMR {Escherichia coli}Length = 137 Back     alignment and structure
 Score = 40.6 bits (95), Expect = 3e-04
 Identities = 22/100 (22%), Positives = 36/100 (36%)

Query: 67  VFFAIVYFSGGLSLLKDTLKNPKAVGMLVFSATILAVHWGFFIYALLTRQGFLTSFSYFV 126
           +  AI+    G +L+K +    +    +       A  W           G   +    V
Sbjct: 7   LGGAILAEVIGTTLMKFSEGFTRLWPSVGTIICYCASFWLLAQTLAYIPTGIAYAIWSGV 66

Query: 127 TPVISVFLGSVFLKERLNHLQIIAALLIILSLLIMTLHSG 166
             V+   L   F  +RL+   II  +LI   +LI+ L S 
Sbjct: 67  GIVLISLLSWGFFGQRLDLPAIIGMMLICAGVLIINLLSR 106


Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target316 hypothetical protein CLIBASIA_02310 [Candidatus Liberib
2i68_A_137 Protein EMRE; transmembrane protein, small-multidr 99.36
3b5d_A_110 Multidrug transporter EMRE; helical membrane prote 97.99
2i68_A_137 Protein EMRE; transmembrane protein, small-multidr 96.69
>2i68_A (A:) Protein EMRE; transmembrane protein, small-multidrug resistance, transporter, homodimer, dual topology, transport protein; NMR {Escherichia coli} Back     alignment and structure
Probab=99.36  E-value=8.7e-13  Score=86.27  Aligned_cols=88  Identities=10%  Similarity=0.026  Sum_probs=75.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHH-HHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             66788653344211579999999862586999-99999999999999999978889989999999999999999999999
Q gi|254780575|r  228 PDTLFLIGYGLLNSFVFCIFSYGIKRAKLSTV-GIMEYTAPLLMIVSSVFILKQPIDTVRTIVFGIVVIAMVVYLLPTVI  306 (316)
Q Consensus       228 ~~~~~l~l~~~~t~i~~~~~~~a~~~~~a~~~-s~~~~l~Pv~a~i~~~~~l~E~~~~~~~iG~~lIi~gv~l~~~~~~~  306 (316)
                      ..+..+...+++..+.+.++.+++++.+.+.+ +++..++|++++++|+++|||++++.+++|.++|++|++++++.+.+
T Consensus        28 ~~~~~~~~~~~~~~~~~~~~~~al~~~~~~~~~~i~~~~~~v~~~i~a~~~l~E~lt~~~~lG~~lii~Gv~li~~~~~~  107 (137)
T 2i68_A           28 TRLWPSVGTIICYCASFWLLAQTLAYIPTGIAYAIWSGVGIVLISLLSWGFFGQRLDLPAIIGMMLICAGVLIINLLSRS  107 (137)
T ss_dssp             ------CHHHHHHHHHHHHHHHHHC-----CHHHHHHHHHHHHHHHHHHHHHC------CHHHHHHHHHHHHHHHHC---
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHEECCCCC
T ss_conf             63889999999999999999999965884239999998999999999999937989899999999999999930015788


Q ss_pred             HHHHHHHHC
Q ss_conf             987755621
Q gi|254780575|r  307 NSGKNKTKK  315 (316)
Q Consensus       307 ~~~k~~~~k  315 (316)
                      +.++++.++
T Consensus       108 ~~~~~~~~~  116 (137)
T 2i68_A          108 TPHEFEAYV  116 (137)
T ss_dssp             ---------
T ss_pred             CCCCCHHHH
T ss_conf             888765555



>3b5d_A (A:) Multidrug transporter EMRE; helical membrane protein, multidrug resistance transporter, SMR, antiport, inner membrane, transmembrane; HET: P4P; 3.80A {Escherichia coli K12} PDB: 3b61_A 3b62_A* Back     alignment and structure
>2i68_A (A:) Protein EMRE; transmembrane protein, small-multidrug resistance, transporter, homodimer, dual topology, transport protein; NMR {Escherichia coli} Back     alignment and structure