254780626

254780626

30S ribosomal protein S20

GeneID in NCBI database:8209626Locus tag:CLIBASIA_02565
Protein GI in NCBI database:254780626Protein Accession:YP_003065039.1
Gene range:-(645443, 645715)Protein Length:90aa
Gene description:30S ribosomal protein S20
COG prediction:[J] Ribosomal protein S20
KEGG prediction:rpsT; 30S ribosomal protein S20; K02968 small subunit ribosomal protein S20
SEED prediction:SSU ribosomal protein S20p
Pathway involved in KEGG:Ribosome [PATH:las03010]
Subsystem involved in SEED:Ribosome SSU bacterial
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90
MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLSKRLKGILTSA
ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccc
ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHcc
MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSkgifhgnaASRKVSRLSKRLKGILTSA
MANKDSAKKMIRKiarrtlinksrrssvrSFMRHANeaitfgkieeATEACRKAESVIQKakskgifhgnaasrkvsrlskrlkgiltsa
MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLSKRLKGILTSA
*A*KDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLSKRLKGILT**
*********MIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLSKRLKGILTSA
********KMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLSKRLKGILTS*
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKxxxxxxxxxxxxxxxxxxxxxGIFHGNAASRKVSRLSKRLKGILTSA
MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLSKRLKGILTSA
MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLSKRLKGILTSA

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target90 30S ribosomal protein S20 [Candidatus Liberibacter asia
31512182790 30S ribosomal protein S20 [Candidatus Liberibacter sola 1 6e-30
1588767388 30S ribosomal protein S20 [Agrobacterium tumefaciens st 1 4e-19
32529175788 30S ribosomal protein S20 [Agrobacterium sp. H13-3] Len 1 5e-19
21798001888 30S ribosomal protein S20 [Methylocella silvestris BL2] 1 1e-17
11470665789 ribosomal protein S20 [Fulvimarina pelagi HTCC2506] Len 1 3e-17
22092740888 30S ribosomal protein S20 [Methylobacterium nodulans OR 1 1e-16
31989830888 30S ribosomal protein S20 [Bartonella clarridgeiae 73] 1 2e-16
32854594788 formamidopyrimidine-DNA glycosylase [polymorphum gilvum 1 2e-16
31940502788 30S ribosomal protein S20 [Bartonella sp. AR 15-3] Leng 1 3e-16
22208464991 ribosomal protein S20 [Agrobacterium radiobacter K84] L 1 3e-16
>gi|315121827|ref|YP_004062316.1| 30S ribosomal protein S20 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 90 Back     alignment and organism information
 Score =  133 bits (335), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 66/86 (76%), Positives = 76/86 (88%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKKM+RKIARRTL+NKSRRS VR+F+R ANEAI  GK+EEATEAC+KAES++QK
Sbjct: 1  MANTQSAKKMVRKIARRTLLNKSRRSFVRTFIRRANEAIAVGKVEEATEACKKAESLVQK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          AKSKG+FH N ASR VSRLSKRLK +
Sbjct: 61 AKSKGVFHRNTASRTVSRLSKRLKNM 86


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|15887673|ref|NP_353354.1| 30S ribosomal protein S20 [Agrobacterium tumefaciens str. C58] Length = 88 Back     alignment and organism information
>gi|325291757|ref|YP_004277621.1| 30S ribosomal protein S20 [Agrobacterium sp. H13-3] Length = 88 Back     alignment and organism information
>gi|217980018|ref|YP_002364165.1| 30S ribosomal protein S20 [Methylocella silvestris BL2] Length = 88 Back     alignment and organism information
>gi|114706657|ref|ZP_01439558.1| ribosomal protein S20 [Fulvimarina pelagi HTCC2506] Length = 89 Back     alignment and organism information
>gi|220927408|ref|YP_002502710.1| 30S ribosomal protein S20 [Methylobacterium nodulans ORS 2060] Length = 88 Back     alignment and organism information
>gi|319898308|ref|YP_004158401.1| 30S ribosomal protein S20 [Bartonella clarridgeiae 73] Length = 88 Back     alignment and organism information
>gi|328545947|ref|YP_004306056.1| formamidopyrimidine-DNA glycosylase [polymorphum gilvum SL003B-26A1] Length = 88 Back     alignment and organism information
>gi|319405027|emb|CBI78637.1| 30S ribosomal protein S20 [Bartonella sp. AR 15-3] Length = 88 Back     alignment and organism information
>gi|222084649|ref|YP_002543178.1| ribosomal protein S20 [Agrobacterium radiobacter K84] Length = 91 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target90 30S ribosomal protein S20 [Candidatus Liberibacter asia
PRK0023988 PRK00239, rpsT, 30S ribosomal protein S20; Reviewed 2e-16
pfam0164984 pfam01649, Ribosomal_S20p, Ribosomal protein S20 1e-08
TIGR0002987 TIGR00029, S20, ribosomal protein S20 5e-06
CHL0010293 CHL00102, rps20, ribosomal protein S20 1e-05
COG026888 COG0268, RpsT, Ribosomal protein S20 [Translation, ribo 1e-09
>gnl|CDD|178943 PRK00239, rpsT, 30S ribosomal protein S20; Reviewed Back     alignment and domain information
>gnl|CDD|145013 pfam01649, Ribosomal_S20p, Ribosomal protein S20 Back     alignment and domain information
>gnl|CDD|129140 TIGR00029, S20, ribosomal protein S20 Back     alignment and domain information
>gnl|CDD|177031 CHL00102, rps20, ribosomal protein S20 Back     alignment and domain information
>gnl|CDD|30617 COG0268, RpsT, Ribosomal protein S20 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 90 30S ribosomal protein S20 [Candidatus Liberibacter asia
PRK0023988 rpsT 30S ribosomal protein S20; Reviewed 99.95
COG026888 RpsT Ribosomal protein S20 [Translation, ribosomal stru 99.95
pfam0164984 Ribosomal_S20p Ribosomal protein S20. Bacterial ribosom 99.94
CHL0010293 rps20 ribosomal protein S20 99.93
TIGR0002994 S20 ribosomal protein S20; InterPro: IPR002583 Ribosome 99.93
>PRK00239 rpsT 30S ribosomal protein S20; Reviewed Back     alignment and domain information
>COG0268 RpsT Ribosomal protein S20 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>pfam01649 Ribosomal_S20p Ribosomal protein S20 Back     alignment and domain information
>CHL00102 rps20 ribosomal protein S20 Back     alignment and domain information
>TIGR00029 S20 ribosomal protein S20; InterPro: IPR002583 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target90 30S ribosomal protein S20 [Candidatus Liberibacter asia
1vs5_T87 Crystal Structure Of The Bacterial Ribosome From Es 3e-12
1p6g_T86 Real Space Refined Coordinates Of The 30s Subunit F 2e-11
3fih_T85 Ternary Complex-Bound E.Coli 70s Ribosome. This Ent 3e-11
3bbn_T202 Homology Model For The Spinach Chloroplast 30s Subu 9e-11
2gy9_T83 Structure Of The 30s Subunit Of A Pre-Translocation 3e-10
1pns_T99 Crystal Structure Of A Streptomycin Dependent Ribos 2e-09
3fic_T99 T. Thermophilus 70s Ribosome In Complex With Mrna, 3e-09
1fjg_T106 Structure Of The Thermus Thermophilus 30s Ribosomal 7e-09
1ibk_T106 Structure Of The Thermus Thermophilus 30s Ribosomal 7e-09
2e5l_T105 A Snapshot Of The 30s Ribosomal Subunit Capturing M 8e-09
1i94_T105 Crystal Structures Of The Small Ribosomal Subunit W 9e-09
gi|116666567|pdb|1VS5|T Chain T, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With The Antibiotic Kasugamyin At 3.5a Resolution. This File Contains The 30s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. Length = 87 Back     alignment and structure
 Score = 75.4 bits (185), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 26/87 (29%), Positives = 46/87 (52%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK   +  +    N SRRS +R+F++    AI  G    A +A  + + ++ +
Sbjct: 1  MANIKSAKKRAIQSEKARKHNASRRSMMRTFIKKVYAAIEAGDKAAAQKAFNEMQPIVDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGIL 87
            +KG+ H N A+R  + L+ ++  + 
Sbjct: 61 QAAKGLIHKNKAARHKANLTAQINKLA 87


>gi|33357897|pdb|1P6G|T Chain T, Real Space Refined Coordinates Of The 30s Subunit Fitted Into The Low Resolution Cryo-Em Map Of The Ef-G.Gtp State Of E. Coli 70s Ribosome Length = 86 Back     alignment and structure
>gi|224510721|pdb|3FIH|T Chain T, Ternary Complex-Bound E.Coli 70s Ribosome. This Entry Consists Of The 30s Subunit, Trnas And The Ternary Complex. Length = 85 Back     alignment and structure
gi|188036221|pdb|3BBN|T Chain T, Homology Model For The Spinach Chloroplast 30s Subunit Fitted To 9.4a Cryo-Em Map Of The 70s Chlororibosome. Length = 202 Back     alignment and structure
>gi|116667429|pdb|2GY9|T Chain T, Structure Of The 30s Subunit Of A Pre-Translocational E. Coli Ribosome Obtained By Fitting Atomic Models For Rna And Protein Components Into Cryo-Em Map Emd-1056 Length = 83 Back     alignment and structure
>gi|34811548|pdb|1PNS|T Chain T, Crystal Structure Of A Streptomycin Dependent Ribosome From E. Coli, 30s Subunit Of 70s Ribosome. This File, 1pns, Contains The 30s Subunit, Two Trnas, And One Mrna Molecule. The 50s Ribosomal Subunit Is In File 1pnu. Length = 99 Back     alignment and structure
>gi|224510696|pdb|3FIC|T Chain T, T. Thermophilus 70s Ribosome In Complex With Mrna, Trnas And Ef-Tu.Gdp.Kirromycin Ternary Complex, Fitted To A 6.4 A Cryo-Em Map. This File Contains The 30s Subunit And The Ligands Length = 99 Back     alignment and structure
gi|10835604|pdb|1FJG|T Chain T, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In Complex With The Antibiotics Streptomycin, Spectinomycin, And Paromomycin Length = 106 Back     alignment and structure
gi|14278075|pdb|1IBK|T Chain T, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In Complex With The Antibiotic Paromomycin Length = 106 Back     alignment and structure
>gi|149241294|pdb|2E5L|T Chain T, A Snapshot Of The 30s Ribosomal Subunit Capturing Mrna Via The Shine- Dalgarno Interaction Length = 105 Back     alignment and structure
>gi|14278549|pdb|1I94|T Chain T, Crystal Structures Of The Small Ribosomal Subunit With Tetracycline, Edeine And If3 Length = 105 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target90 30S ribosomal protein S20 [Candidatus Liberibacter asia
2vqe_T106 30S ribosomal protein S20; tRNA-binding, rRNA-binding, 1e-14
3ofo_T85 30S ribosomal protein S20; protein biosynthesis, riboso 4e-14
3bbn_T202 Ribosomal protein S20; small ribosomal subunit, spinach 4e-14
3i1m_T87 30S ribosomal protein S20; ribosome structure, protein- 4e-13
>2vqe_T 30S ribosomal protein S20; tRNA-binding, rRNA-binding, metal-binding, zinc-finger, translation; HET: TM2 PAR; 2.5A {Thermus thermophilus} SCOP: a.7.6.1 PDB: 1gix_W* 1hnw_T* 1hnx_T* 1hnz_T* 1hr0_T 1j5e_T 1jgo_W* 1jgp_W* 1jgq_W* 1ml5_W* 1yl4_W 2b64_T* 2b9m_T* 2b9o_T* 2f4v_T* 2ow8_u* 2qnh_u* 2uxb_T* 1fjg_T* 2uxd_T* ... Length = 106 Back     alignment and structure
 Score = 73.2 bits (180), Expect = 1e-14
 Identities = 33/90 (36%), Positives = 54/90 (60%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
               SA K  R+  +R L NK+++S++++  + A +    GK EEA +  RKAES+I K
Sbjct: 6  PKRNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDK 65

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
          A      H NAA+R+ SRL ++++ +L +A
Sbjct: 66 AAKGSTLHKNAAARRKSRLMRKVRQLLEAA 95


>3ofo_T 30S ribosomal protein S20; protein biosynthesis, ribosomes, RNA, tRNA, transfer, eryThr ketolide, macrolide, antibiotic, EXIT, peptidyl; 3.10A {Escherichia coli} PDB: 3fih_T* 2wwl_T 3ofp_T 2qal_T* 1p6g_T 1p87_T 2aw7_T 2avy_T 2i2u_T 2i2p_T* 2qan_T* 2qb9_T* 2qbb_T* 2qbd_T 2qbf_T 2qbh_T* 2qbj_T* 2qou_T* 2qow_T* 2qoy_T* ... Length = 85 Back     alignment and structure
>3bbn_T Ribosomal protein S20; small ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Arabidopsis thaliana} Length = 202 Back     alignment and structure
>3i1m_T 30S ribosomal protein S20; ribosome structure, protein-RNA complex, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA-binding, antibiotic resistance; 3.19A {Escherichia coli k-12} PDB: 1vs7_T* 3e1a_N 3e1c_N 1vs5_T 3i1o_T 3i1q_T 3i1s_T 3i1z_T 3i21_T 2qal_T* 1p6g_T 1p87_T 2aw7_T 2avy_T 2i2u_T 2i2p_T* 2qan_T* 2qb9_T* 2qbb_T* 2qbd_T ... Length = 87 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target90 30S ribosomal protein S20 [Candidatus Liberibacter asia
2vqe_T106 30S ribosomal protein S20; tRNA-binding, rRNA-binding, 99.95
3ofo_T85 30S ribosomal protein S20; protein biosynthesis, riboso 99.93
3bbn_T202 Ribosomal protein S20; small ribosomal subunit, spinach 99.91
>2vqe_T 30S ribosomal protein S20; tRNA-binding, rRNA-binding, metal-binding, zinc-finger, translation; HET: TM2 PAR; 2.5A {Thermus thermophilus} SCOP: a.7.6.1 PDB: 1gix_W* 1hnw_T* 1hnx_T* 1hnz_T* 1hr0_T 1j5e_T 1jgo_W* 1jgp_W* 1jgq_W* 1ml5_W* 1yl4_W 2b64_T* 2b9m_T* 2b9o_T* 2f4v_T* 2ow8_u* 2qnh_u* 2uxb_T* 1fjg_T* 2uxd_T* ... Back     alignment and structure
Probab=99.95  E-value=6e-28  Score=186.38  Aligned_cols=90  Identities=37%  Similarity=0.470  Sum_probs=88.5

Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHH
Q ss_conf             96898999999999999999999999999999999999960898999999999999999998658861669999999999
Q gi|254780626|r    1 MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLS   80 (90)
Q Consensus         1 Man~kSa~Kr~r~~~krr~~N~~~ks~~kt~iKk~~~ai~~~d~~~a~~~~~~~~s~lDka~kkgiihkn~AsRkKSrL~   80 (90)
                      |+||+||+||+||+++++++|++++|.+||++|+|+.+|++||.+++.++|+.+++.||+++++||||+|+|+|+||||+
T Consensus         6 ~an~~SA~KRiRq~~krr~rN~~~kS~~kT~iKk~~~Ai~~~d~~~a~~~l~~a~s~iDKAa~KgviHkN~AaRkKSRL~   85 (106)
T 2vqe_T            6 PKRNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLM   85 (106)
T ss_dssp             --CCCTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHHTTTTSSCTTHHHHHHHHHH
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHH
T ss_conf             67886289999999999999999999999999999999982789999999999999999998679876214889999999


Q ss_pred             HHHHHHHHCC
Q ss_conf             9999984269
Q gi|254780626|r   81 KRLKGILTSA   90 (90)
Q Consensus        81 ~~v~~~~~~A   90 (90)
                      ++|+++..++
T Consensus        86 k~vn~l~~~a   95 (106)
T 2vqe_T           86 RKVRQLLEAA   95 (106)
T ss_dssp             HHHHHHHTTT
T ss_pred             HHHHHHHHHH
T ss_conf             9999887400



>3ofo_T 30S ribosomal protein S20; protein biosynthesis, ribosomes, RNA, tRNA, transfer, eryThr ketolide, macrolide, antibiotic, EXIT, peptidyl; 3.10A {Escherichia coli} PDB: 3fih_T* 2wwl_T 3ofp_T 2qal_T* 1p6g_T 1p87_T 2aw7_T 2avy_T 2i2u_T 2i2p_T* 2qan_T* 2qb9_T* 2qbb_T* 2qbd_T 2qbf_T 2qbh_T* 2qbj_T* 2qou_T* 2qow_T* 2qoy_T* ... Back     alignment and structure
>3bbn_T Ribosomal protein S20; small ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Arabidopsis thaliana} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 90 30S ribosomal protein S20 [Candidatus Liberibacter asia
d2uubt199 a.7.6.1 (T:8-106) Ribosomal protein S20 {Thermus thermo 8e-14
d2gy9t183 a.7.6.1 (T:4-86) Ribosomal protein S20 {Escherichia col 2e-12
>d2uubt1 a.7.6.1 (T:8-106) Ribosomal protein S20 {Thermus thermophilus [TaxId: 274]} Length = 99 Back     information, alignment and structure

class: All alpha proteins
fold: Spectrin repeat-like
superfamily: Ribosomal protein S20
family: Ribosomal protein S20
domain: Ribosomal protein S20
species: Thermus thermophilus [TaxId: 274]
 Score = 69.3 bits (170), Expect = 8e-14
 Identities = 33/85 (38%), Positives = 54/85 (63%)

Query: 6  SAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKG 65
          SA K  R+  +R L NK+++S++++  + A +    GK EEA +  RKAES+I KA    
Sbjct: 4  SALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGS 63

Query: 66 IFHGNAASRKVSRLSKRLKGILTSA 90
            H NAA+R+ SRL ++++ +L +A
Sbjct: 64 TLHKNAAARRKSRLMRKVRQLLEAA 88


>d2gy9t1 a.7.6.1 (T:4-86) Ribosomal protein S20 {Escherichia coli [TaxId: 562]} Length = 83 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target90 30S ribosomal protein S20 [Candidatus Liberibacter asia
d2uubt199 Ribosomal protein S20 {Thermus thermophilus [TaxId: 274 99.93
d2gy9t183 Ribosomal protein S20 {Escherichia coli [TaxId: 562]} 99.92
>d2uubt1 a.7.6.1 (T:8-106) Ribosomal protein S20 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
class: All alpha proteins
fold: Spectrin repeat-like
superfamily: Ribosomal protein S20
family: Ribosomal protein S20
domain: Ribosomal protein S20
species: Thermus thermophilus [TaxId: 274]
Probab=99.93  E-value=4e-26  Score=174.00  Aligned_cols=87  Identities=38%  Similarity=0.493  Sum_probs=85.3

Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHH
Q ss_conf             98999999999999999999999999999999999960898999999999999999998658861669999999999999
Q gi|254780626|r    4 KDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLSKRL   83 (90)
Q Consensus         4 ~kSa~Kr~r~~~krr~~N~~~ks~~kt~iKk~~~ai~~~d~~~a~~~~~~~~s~lDka~kkgiihkn~AsRkKSrL~~~v   83 (90)
                      |+||+||+||+++++++|++++|.|||++|+|+.+|++||.+++.++|+.+++.||+++++||||+|+|+|++|||+++|
T Consensus         2 ~~SA~KRiRq~~krr~rN~~~kS~~kT~iKk~~~ai~~~d~e~A~~~l~~a~s~iDKAakKgiiHkN~AaRkKSRL~k~v   81 (99)
T d2uubt1           2 NLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKV   81 (99)
T ss_dssp             CCSTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHHHHHTTSSTTCSHHHHHHHHHHHHHH
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHH
T ss_conf             76279999999999999999999999999999999872688999999999999999998679877114889999999999


Q ss_pred             HHHHHCC
Q ss_conf             9984269
Q gi|254780626|r   84 KGILTSA   90 (90)
Q Consensus        84 ~~~~~~A   90 (90)
                      +++.++|
T Consensus        82 ~~l~~~a   88 (99)
T d2uubt1          82 RQLLEAA   88 (99)
T ss_dssp             HHHHHTS
T ss_pred             HHHHHHH
T ss_conf             9987521



>d2gy9t1 a.7.6.1 (T:4-86) Ribosomal protein S20 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 90 30S ribosomal protein S20 [Candidatus Liberibacter
2vqe_T_106 (T:) 30S ribosomal protein S20; tRNA-binding, rRNA 8e-16
3i1m_T_87 (T:) 30S ribosomal protein S20; ribosome structure 2e-14
3bbn_T_202 (T:) Ribosomal protein S20; small ribosomal subuni 2e-12
>2vqe_T (T:) 30S ribosomal protein S20; tRNA-binding, rRNA-binding, metal-binding, zinc-finger, translation; HET: TM2 PAR; 2.5A {Thermus thermophilus}Length = 106 Back     alignment and structure
 Score = 77.0 bits (190), Expect = 8e-16
 Identities = 33/90 (36%), Positives = 54/90 (60%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
               SA K  R+  +R L NK+++S++++  + A +    GK EEA +  RKAES+I K
Sbjct: 6  PKRNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDK 65

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
          A      H NAA+R+ SRL ++++ +L +A
Sbjct: 66 AAKGSTLHKNAAARRKSRLMRKVRQLLEAA 95


>3i1m_T (T:) 30S ribosomal protein S20; ribosome structure, protein-RNA complex, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA-binding, antibiotic resistance; 3.19A {Escherichia coli k-12} PDB: 1vs7_T* 3e1a_N 3e1c_N 1vs5_T 3i1o_T 3i1q_T 3i1s_T 3i1z_T 3i21_T 2qal_T* 1p6g_T 1p87_T 2aw7_T 2avy_T 2i2u_T 2i2p_T* 2qan_T* 2qb9_T* 2qbb_T* 2qbd_T ...Length = 87 Back     alignment and structure
>3bbn_T (T:) Ribosomal protein S20; small ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Arabidopsis thaliana}Length = 202 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target90 30S ribosomal protein S20 [Candidatus Liberibacter asia
2vqe_T_106 30S ribosomal protein S20; tRNA-binding, rRNA-bind 99.96
3i1m_T_87 30S ribosomal protein S20; ribosome structure, pro 99.95
3bbn_T_202 Ribosomal protein S20; small ribosomal subunit, sp 99.94
>2vqe_T (T:) 30S ribosomal protein S20; tRNA-binding, rRNA-binding, metal-binding, zinc-finger, translation; HET: TM2 PAR; 2.5A {Thermus thermophilus} Back     alignment and structure
Probab=99.96  E-value=1.8e-28  Score=190.48  Aligned_cols=90  Identities=37%  Similarity=0.470  Sum_probs=88.6

Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHH
Q ss_conf             96898999999999999999999999999999999999960898999999999999999998658861669999999999
Q gi|254780626|r    1 MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLS   80 (90)
Q Consensus         1 Man~kSa~Kr~r~~~krr~~N~~~ks~~kt~iKk~~~ai~~~d~~~a~~~~~~~~s~lDka~kkgiihkn~AsRkKSrL~   80 (90)
                      ||||+|++||+||++++|++|++++|++||++|+|+.+|++||.+++.++|+.+++.||+++++||||+|+|+|+||||+
T Consensus         6 MaN~kSA~KRir~~~krr~rNr~~kS~ikT~iKk~~~Ai~~~d~~~a~~~l~~a~s~iDkaa~KGiiHkN~AaRkKSRL~   85 (106)
T 2vqe_T            6 PKRNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLM   85 (106)
T ss_dssp             --CCCTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHHTTTTSSCTTHHHHHHHHHH
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHH
T ss_conf             78986189999999999999999999999999999999872789999999999999999998679876013889999999


Q ss_pred             HHHHHHHHCC
Q ss_conf             9999984269
Q gi|254780626|r   81 KRLKGILTSA   90 (90)
Q Consensus        81 ~~v~~~~~~A   90 (90)
                      ..|+++..+|
T Consensus        86 ~~in~~~~~a   95 (106)
T 2vqe_T           86 RKVRQLLEAA   95 (106)
T ss_dssp             HHHHHHHTTT
T ss_pred             HHHHHHHHHH
T ss_conf             9999998631



>3i1m_T (T:) 30S ribosomal protein S20; ribosome structure, protein-RNA complex, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA-binding, antibiotic resistance; 3.19A {Escherichia coli k-12} PDB: 1vs7_T* 3e1a_N 3e1c_N 1vs5_T 3i1o_T 3i1q_T 3i1s_T 3i1z_T 3i21_T 2qal_T* 1p6g_T 1p87_T 2aw7_T 2avy_T 2i2u_T 2i2p_T* 2qan_T* 2qb9_T* 2qbb_T* 2qbd_T ... Back     alignment and structure
>3bbn_T (T:) Ribosomal protein S20; small ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Arabidopsis thaliana} Back     alignment and structure