254780650

254780650

hypothetical protein CLIBASIA_02685

GeneID in NCBI database:8209653Locus tag:CLIBASIA_02685
Protein GI in NCBI database:254780650Protein Accession:YP_003065063.1
Gene range:+(621139, 621651)Protein Length:170aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein; K13592 regulator of CtrA degradation
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170
MSNRVSGSISCLNRRLFSMRLKVLYKESIALVEETSCYFDREGHLLSKTLPRAISKLYTSESVLLTTRLMQMVSWLFLQRALEDGNMTLEQVMSEKEKIKFDYSGLDSTVPGWTELPCFFKNLVERSSQLQRRIVLLDQEIYRADFDEISRGPNHVQTQIKLLEACFENF
cccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHcc
ccHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHccccccccccccccccHHccHHHHHHHHHHHHHHHHHHHHHHHHccccccHcccccccHHHHHHHHHHHHHcc
msnrvsgsiSCLNRRLFSMRLKVLYKESIALVEetscyfdreghllsKTLPRAISKLYTSESVLLTTRLMQMVSWLFLQRALEDGNMTLEQVMSEKEKIkfdysgldstvpgwtelpcFFKNLVERSSQLQRRIVLLDQEIyradfdeisrgpnhVQTQIKLLEACFENF
msnrvsgsisclnrrLFSMRLKVLYKESIALVEETSCYFDREGHLLSKTLPRAISKLYTSESVLLTTRLMQMVSWLFLQRALEDGNMTLEQVMSEKEKIKFDYSGLDSTVPGWTELPCFFKNLVERSSQLQRRIVLLDQEIYRADfdeisrgpnHVQTQIKLLEACFENF
MSNRVSGSISCLNRRLFSMRLKVLYKESIALVEETSCYFDREGHLLSKTLPRAISKLYTSESVLLTTRLMQMVSWLFLQRALEDGNMTLEQVMSEKEKIKFDYSGLDSTVPGWTELPCFFKNLVERSSQLQRRIVLLDQEIYRADFDEISRGPNHVQTQIKLLEACFENF
************NRRLFSMRLKVLYKESIALVEETSCYFDRE*************KLYTSESVLLTTRLMQMVSWLFLQRALEDGNMT***********************GWTELPCFFKNLVERSSQLQRRIVLLDQE******************QIKLLEACFE**
*********SCLNRRLFSMRLKVLYKESIALVEETSCYFDREGHLLSKTLPRAISKLYTSESVLLTTRLMQMVSWLFLQRALEDGNMTLEQVMSEKEKIKFDYSGLDSTVPGWTELPCFFKNLVERSSQLQRRIVLLDQEIYRADFDEISRGPNHVQTQIKLLEACFENF
****VSGSISCLNRRLFSMRLKVLYKESIALVEETSCYFDREGHLLSKTLPRAISKLYTSESVLLTTRLMQMVSWLFLQRALEDGNMTLEQVMSEKEKIKFDYSGLDSTVPGWTELPCFFKNLVERSSQLQRRIVLLDQEIYRADFDEISRGPNHVQTQIKLLEACFENF
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSNRVSGSISCLNRRLFSMRLKVLYKESIALVEETSCYFDREGHLLSKTLPRAISKLYTSESVLLTTRLMQMVSWLFLQRALEDGNMTLEQVMSEKEKIKFDYSGLDSTVPGWTELPCFFKNLVERSSQLQRRIVLLDQEIYRADFDEISRGPNHVQTQIKLLEACFENF
MSNRVSGSISCLNRRLFSMRLKVLYKESIALVEETSCYFDREGHLLSKTLPRAISKLYTSESVLLTTRLMQMVSWLFLQRALEDGNMTLEQVMSEKEKIKFDYSGLDSTVPGWTELPCFFKNLVERSSQLQRRIVLLDQEIYRADFDEISRGPNHVQTQIKLLEACFENF
MSNRVSGSISCLNRRLFSMRLKVLYKESIALVEETSCYFDREGHLLSKTLPRAISKLYTSESVLLTTRLMQMVSWLFLQRALEDGNMTLEQVMSEKEKIKFDYSGLDSTVPGWTELPCFFKNLVERSSQLQRRIVLLDQEIYRADFDEISRGPNHVQTQIKLLEACFENF

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target170 hypothetical protein CLIBASIA_02685 [Candidatus Liberib
315122163170 hypothetical protein CKC_02065 [Candidatus Liberibacter 1 2e-69
159185883171 hypothetical protein Atu3742 [Agrobacterium tumefaciens 1 2e-39
332716475171 hypothetical protein AGROH133_12088 [Agrobacterium sp. 1 5e-39
86359096171 hypothetical protein RHE_CH03505 [Rhizobium etli CFN 42 1 1e-38
227823343172 hypothetical protein NGR_c28160 [Sinorhizobium fredii N 1 1e-38
190893322171 hypothetical protein RHECIAT_CH0003748 [Rhizobium etli 1 3e-38
209550823171 hypothetical protein Rleg2_3247 [Rhizobium leguminosaru 1 3e-38
116253755166 hypothetical protein RL4016 [Rhizobium leguminosarum bv 1 3e-38
307300437172 protein of unknown function DUF1465 [Sinorhizobium meli 1 1e-37
150397858172 hypothetical protein Smed_2660 [Sinorhizobium medicae W 1 3e-37
>gi|315122163|ref|YP_004062652.1| hypothetical protein CKC_02065 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 170 Back     alignment and organism information
 Score =  265 bits (676), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 126/170 (74%), Positives = 149/170 (87%)

Query: 1   MSNRVSGSISCLNRRLFSMRLKVLYKESIALVEETSCYFDREGHLLSKTLPRAISKLYTS 60
           MSNR+SG+IS ++R + S+RLKVLYKE ++LVEETSCYFD EG  LSKTL R +S LYTS
Sbjct: 1   MSNRISGAISFMDRTVSSIRLKVLYKECMSLVEETSCYFDEEGLSLSKTLSRVVSSLYTS 60

Query: 61  ESVLLTTRLMQMVSWLFLQRALEDGNMTLEQVMSEKEKIKFDYSGLDSTVPGWTELPCFF 120
           ESVLLTTRLMQMVSWL L+RALEDGNMTLEQV++EK+KIKFD S LD T+P W++LP FF
Sbjct: 61  ESVLLTTRLMQMVSWLLLRRALEDGNMTLEQVIAEKKKIKFDSSHLDYTIPEWSDLPSFF 120

Query: 121 KNLVERSSQLQRRIVLLDQEIYRADFDEISRGPNHVQTQIKLLEACFENF 170
           +NLVERS QLQ+R+VLLD+EIYR D +++S  PNHVQTQIKLLEACFENF
Sbjct: 121 RNLVERSLQLQKRVVLLDKEIYRTDLNDVSHKPNHVQTQIKLLEACFENF 170


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|159185883|ref|NP_356879.2| hypothetical protein Atu3742 [Agrobacterium tumefaciens str. C58] Length = 171 Back     alignment and organism information
>gi|332716475|ref|YP_004443941.1| hypothetical protein AGROH133_12088 [Agrobacterium sp. H13-3] Length = 171 Back     alignment and organism information
>gi|86359096|ref|YP_470988.1| hypothetical protein RHE_CH03505 [Rhizobium etli CFN 42] Length = 171 Back     alignment and organism information
>gi|227823343|ref|YP_002827315.1| hypothetical protein NGR_c28160 [Sinorhizobium fredii NGR234] Length = 172 Back     alignment and organism information
>gi|190893322|ref|YP_001979864.1| hypothetical protein RHECIAT_CH0003748 [Rhizobium etli CIAT 652] Length = 171 Back     alignment and organism information
>gi|209550823|ref|YP_002282740.1| hypothetical protein Rleg2_3247 [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 171 Back     alignment and organism information
>gi|116253755|ref|YP_769593.1| hypothetical protein RL4016 [Rhizobium leguminosarum bv. viciae 3841] Length = 166 Back     alignment and organism information
>gi|307300437|ref|ZP_07580217.1| protein of unknown function DUF1465 [Sinorhizobium meliloti BL225C] Length = 172 Back     alignment and organism information
>gi|150397858|ref|YP_001328325.1| hypothetical protein Smed_2660 [Sinorhizobium medicae WSM419] Length = 172 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target170 hypothetical protein CLIBASIA_02685 [Candidatus Liberib
pfam07323156 pfam07323, DUF1465, Protein of unknown function (DUF146 5e-32
COG5317175 COG5317, COG5317, Uncharacterized protein conserved in 2e-39
>gnl|CDD|148751 pfam07323, DUF1465, Protein of unknown function (DUF1465) Back     alignment and domain information
>gnl|CDD|34901 COG5317, COG5317, Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 170 hypothetical protein CLIBASIA_02685 [Candidatus Liberib
COG5317175 Uncharacterized protein conserved in bacteria [Function 100.0
pfam07323156 DUF1465 Protein of unknown function (DUF1465). This fam 100.0
>COG5317 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>pfam07323 DUF1465 Protein of unknown function (DUF1465) Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target170 hypothetical protein CLIBASIA_02685 [Candidatus Liberib
3ctw_B169 Crystal Structure Of Rcda From Caulobacter Crescent 2e-44
gi|254220906|pdb|3CTW|B Chain B, Crystal Structure Of Rcda From Caulobacter Crescentus Cb15 Length = 169 Back     alignment and structure
 Score =  181 bits (460), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 55/154 (35%), Positives = 79/154 (51%), Gaps = 5/154 (3%)

Query: 15  RLFSMRLKVLYKESIALVEETSCYFDREGHLLSKTLPRAISKLYTSESVLLTTRLMQMVS 74
              S      ++E + LVEET+ Y D  G   SK L R  +  Y +ES+ LTTRLMQ+ S
Sbjct: 20  FARSELFDRTFEEGMQLVEETAAYLDGAGRHDSKVLSRNAALGYATESMRLTTRLMQVAS 79

Query: 75  WLFLQRALEDGNMTLEQVMSEKEKIKFDYSGLDSTVPGWTELPCFFKNLVERSSQLQRRI 134
           WL +QRA+ +G M  E   +E  ++  +     +  P   ELP    NL++RS +L  R+
Sbjct: 80  WLLVQRAVREGEMPPEAACAEAYRLAEEAP---ADGPAVEELPFGLMNLLQRSERLYERV 136

Query: 135 VLLDQEIYRADFDEISRGPNHVQTQIKLLEACFE 168
             LD+ +Y    +E    P  VQ Q+  L A F 
Sbjct: 137 RHLDRRMYVESPNE--EAPRPVQNQLDRLTAAFG 168


Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target170 hypothetical protein CLIBASIA_02685 [Candidatus Liberib
3ctw_B169 RCDA; protein binding; 2.90A {Caulobacter crescentus} L 4e-42
>3ctw_B RCDA; protein binding; 2.90A {Caulobacter crescentus} Length = 169 Back     alignment and structure
 Score =  165 bits (420), Expect = 4e-42
 Identities = 54/144 (37%), Positives = 78/144 (54%), Gaps = 5/144 (3%)

Query: 24  LYKESIALVEETSCYFDREGHLLSKTLPRAISKLYTSESVLLTTRLMQMVSWLFLQRALE 83
            ++E + LVEET+ Y D  G   SK L R  +  Y +ES+ LTTRLMQ+ SWL +QRA+ 
Sbjct: 29  TFEEGMQLVEETAAYLDGAGRHDSKVLSRNAALGYATESMRLTTRLMQVASWLLVQRAVR 88

Query: 84  DGNMTLEQVMSEKEKIKFDYSGLDSTVPGWTELPCFFKNLVERSSQLQRRIVLLDQEIYR 143
           +G M  E   +E  ++  +     +  P   ELP    NL++RS +L  R+  LD+ +Y 
Sbjct: 89  EGEMPPEAACAEAYRLAEEA---PADGPAVEELPFGLMNLLQRSERLYERVRHLDRRMYV 145

Query: 144 ADFDEISRGPNHVQTQIKLLEACF 167
              +E    P  VQ Q+  L A F
Sbjct: 146 ESPNE--EAPRPVQNQLDRLTAAF 167


Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target170 hypothetical protein CLIBASIA_02685 [Candidatus Liberib
3ctw_B169 RCDA; protein binding; 2.90A {Caulobacter crescentus} 100.0
>3ctw_B RCDA; protein binding; 2.90A {Caulobacter crescentus} Back     alignment and structure
Probab=100.00  E-value=0  Score=409.14  Aligned_cols=159  Identities=34%  Similarity=0.479  Sum_probs=148.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             33799999985259999999999999999999853898312311699999999999999999999999999999997638
Q gi|254780650|r    6 SGSISCLNRRLFSMRLKVLYKESIALVEETSCYFDREGHLLSKTLPRAISKLYTSESVLLTTRLMQMVSWLFLQRALEDG   85 (170)
Q Consensus         6 ~~~~~~~~r~~~s~~F~~Ly~EgM~LveEtaaYlDg~GR~~ak~L~r~~~l~YA~ESMrlTTRLMQiaSWLLlqRAv~eG   85 (170)
                      ..++.+...+++|++|++||+|||+|||||++||||+||.++|.|++.++++||||||||||||||||||||+||||++|
T Consensus        11 ~~~~~~~~~fa~s~~F~~Ly~EgM~LveEtaaYlDg~Gr~~ak~L~r~~~l~yA~ESMrlTTRLMQvaSWLLlqRAv~eG   90 (169)
T 3ctw_B           11 PWRAGVIQDFARSELFDRTFEEGMQLVEETAAYLDGAGRHDSKVLSRNAALGYATESMRLTTRLMQVASWLLVQRAVREG   90 (169)
T ss_dssp             ------CCCCCCCTTHHHHHHHHHHHHHHHHHHHTTHHHHHHTTSCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTT
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             25888988611128889999999999999999874898054310689999999999999999999999999999999848


Q ss_pred             CCCHHHHHHHHHHCCCCCCCCCCCCCHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHH
Q ss_conf             99989974234422545578764585154223899999999999999999999983246621036588947999999999
Q gi|254780650|r   86 NMTLEQVMSEKEKIKFDYSGLDSTVPGWTELPCFFKNLVERSSQLQRRIVLLDQEIYRADFDEISRGPNHVQTQIKLLEA  165 (170)
Q Consensus        86 EMs~~qa~~ek~rv~l~~~~~~~~~~~~~~LP~~lr~Li~rS~~L~~RV~rLD~~~~~~~~~~~~~~~nPv~~ql~~L~~  165 (170)
                      |||.+|+++||+||+++.+   ..+|+|++||..||+||+||++||+||+|||++||.+.+.  .+++|||.+||++|++
T Consensus        91 EMt~eqa~~ek~rl~~~~~---~~~~~~~~LP~~lr~Li~rS~rL~~RV~rLD~~~~~~~~~--~~~~nPv~~ql~~L~~  165 (169)
T 3ctw_B           91 EMPPEAACAEAYRLAEEAP---ADGPAVEELPFGLMNLLQRSERLYERVRHLDRRMYVESPN--EEAPRPVQNQLDRLTA  165 (169)
T ss_dssp             SSCTTTTSSSCC--------------CCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHTCC--------------------
T ss_pred             CCCHHHHHHHHCCCCCCCC---CCCHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCC--CCCCCCHHHHHHHHHH
T ss_conf             9898988545224688899---9850465577999999999999999999999985057755--7799979999999999


Q ss_pred             HHHC
Q ss_conf             8522
Q gi|254780650|r  166 CFEN  169 (170)
Q Consensus       166 AF~~  169 (170)
                      ||+.
T Consensus       166 AF~g  169 (169)
T 3ctw_B          166 AFGG  169 (169)
T ss_dssp             ----
T ss_pred             HHCC
T ss_conf             7585




Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 170 hypothetical protein CLIBASIA_02685 [Candidatus Li
3ctw_B_169 (B:) RCDA; protein binding; 2.90A {Caulobacter cre 5e-47
>3ctw_B (B:) RCDA; protein binding; 2.90A {Caulobacter crescentus}Length = 169 Back     alignment and structure
 Score =  181 bits (460), Expect = 5e-47
 Identities = 55/162 (33%), Positives = 80/162 (49%), Gaps = 5/162 (3%)

Query: 6   SGSISCLNRRLFSMRLKVLYKESIALVEETSCYFDREGHLLSKTLPRAISKLYTSESVLL 65
                 +     S      ++E + LVEET+ Y D  G   SK L R  +  Y +ES+ L
Sbjct: 11  PWRAGVIQDFARSELFDRTFEEGMQLVEETAAYLDGAGRHDSKVLSRNAALGYATESMRL 70

Query: 66  TTRLMQMVSWLFLQRALEDGNMTLEQVMSEKEKIKFDYSGLDSTVPGWTELPCFFKNLVE 125
           TTRLMQ+ SWL +QRA+ +G M  E   +E  ++  +     +  P   ELP    NL++
Sbjct: 71  TTRLMQVASWLLVQRAVREGEMPPEAACAEAYRLAEEA---PADGPAVEELPFGLMNLLQ 127

Query: 126 RSSQLQRRIVLLDQEIYRADFDEISRGPNHVQTQIKLLEACF 167
           RS +L  R+  LD+ +Y    +E    P  VQ Q+  L A F
Sbjct: 128 RSERLYERVRHLDRRMYVESPNE--EAPRPVQNQLDRLTAAF 167


Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target170 hypothetical protein CLIBASIA_02685 [Candidatus Liberib
3ctw_B_169 RCDA; protein binding; 2.90A {Caulobacter crescent 100.0
>3ctw_B (B:) RCDA; protein binding; 2.90A {Caulobacter crescentus} Back     alignment and structure
Probab=100.00  E-value=0  Score=425.76  Aligned_cols=160  Identities=34%  Similarity=0.476  Sum_probs=150.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             43379999998525999999999999999999985389831231169999999999999999999999999999999763
Q gi|254780650|r    5 VSGSISCLNRRLFSMRLKVLYKESIALVEETSCYFDREGHLLSKTLPRAISKLYTSESVLLTTRLMQMVSWLFLQRALED   84 (170)
Q Consensus         5 ~~~~~~~~~r~~~s~~F~~Ly~EgM~LveEtaaYlDg~GR~~ak~L~r~~~l~YA~ESMrlTTRLMQiaSWLLlqRAv~e   84 (170)
                      ..++|+|++|+++|.+|++||+|||+||||||+||||+||.++|.|++.++++||||||||||||||||||||+||||++
T Consensus        10 ~~~~~~~~~~~~~s~~F~~Ly~EgM~LveEtaaYlDg~Gr~~ak~L~r~~~l~yA~ESMrlTTRLMQiaSWLL~qRAv~e   89 (169)
T 3ctw_B           10 TPWRAGVIQDFARSELFDRTFEEGMQLVEETAAYLDGAGRHDSKVLSRNAALGYATESMRLTTRLMQVASWLLVQRAVRE   89 (169)
T ss_dssp             -------CCCCCCCTTHHHHHHHHHHHHHHHHHHHTTHHHHHHTTSCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHT
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             42588898872205889999999999999999997489805442058999999999999999999999999999999984


Q ss_pred             CCCCHHHHHHHHHHCCCCCCCCCCCCCHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHH
Q ss_conf             89998997423442254557876458515422389999999999999999999998324662103658894799999999
Q gi|254780650|r   85 GNMTLEQVMSEKEKIKFDYSGLDSTVPGWTELPCFFKNLVERSSQLQRRIVLLDQEIYRADFDEISRGPNHVQTQIKLLE  164 (170)
Q Consensus        85 GEMs~~qa~~ek~rv~l~~~~~~~~~~~~~~LP~~lr~Li~rS~~L~~RV~rLD~~~~~~~~~~~~~~~nPv~~ql~~L~  164 (170)
                      ||||++|+++||+||+++.+   ..+|+|++||+.||+||+||++||+||+|||++||.+.+.  .+++|||++||++|+
T Consensus        90 GEMs~~qa~~ek~rl~~~~~---~~~~~~~~LP~~lr~Li~rS~rL~~RV~rLD~~~~~~~~~--~~~~nPv~~ql~~L~  164 (169)
T 3ctw_B           90 GEMPPEAACAEAYRLAEEAP---ADGPAVEELPFGLMNLLQRSERLYERVRHLDRRMYVESPN--EEAPRPVQNQLDRLT  164 (169)
T ss_dssp             TSSCTTTTSSSCC--------------CCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHTCC-------------------
T ss_pred             CCCCHHHHHHHHCCCCCCCC---CCCCHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCC--CCCCCCHHHHHHHHH
T ss_conf             89898888536415688889---9850154476999999999999999999999984157765--779997999999999


Q ss_pred             HHHHC
Q ss_conf             98522
Q gi|254780650|r  165 ACFEN  169 (170)
Q Consensus       165 ~AF~~  169 (170)
                      +||++
T Consensus       165 ~AF~~  169 (169)
T 3ctw_B          165 AAFGG  169 (169)
T ss_dssp             -----
T ss_pred             HHHCC
T ss_conf             97585