254780666

254780666

Fmu (Sun) domain protein

GeneID in NCBI database:8209670Locus tag:CLIBASIA_02765
Protein GI in NCBI database:254780666Protein Accession:YP_003065079.1
Gene range:+(601032, 602369)Protein Length:445aa
Gene description:Fmu (Sun) domain protein
COG prediction:[J] tRNA and rRNA cytosine-C5-methylases
KEGG prediction:Fmu (Sun) domain protein; K03500 ribosomal RNA small subunit methyltransferase B [EC:2.1.1.-]
SEED prediction:16S rRNA m(5)C 967 methyltransferase (EC 2.1.1.-)
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Conserved gene cluster associated with Met-tRNA formyltransferase
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-----
MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRLIQPK
ccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHcccccccccHHHHHHHHHHcccccccccccccccccHHHHHHHHHHccHHHHHHHHHHccccccEEEEEcccHHHHHHHHcccccccccEEEccccccccccHHHHccEEEEcccHHHHHHHHcccccccEEEEccccccHHHHHHHHcccEEEEEEccHHHHHHHHHHHHHcccccEEEEEcccHHccccccccEEEEcccccccccccccccHHHcccHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEccccHHHHHHHHHHHHHHccccEEEccccccccccccccccccccccEEEcHHHcccccccccccccEEEEEEEHHcccc
ccccccHHHHHHHHHHHHHHccccHHHHHHHHHccHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHccccHHHHHHHccccHHHHHHHHHHHccHHHHHHHHHHccccccEEEEccccHHHHHHHHHHcccccccEEEEcccccHHcccccccccEEEEcHHHHHHHHHHccccccEEEEccccccccEEEEEccccEEEEEEccHHHHHHHHHHHHHcccccEEEEEccHHHccccccccEEEEEccccccEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEccccHHHHHHHHHHHHHHcccccEEEcccccccccccccccccccccEEEccHHHccccccccccccEEEEEEEEccccc
MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDAVLDFVLIsslprkkysLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTVKFDIETWAHKLNAVmlptggirlkelpesivslpgfaegvwwvqdasasipvqlfgtlnnlsvldlcaapggktaQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIiemdafdycpkklfdavlvdapcsstgtirrhpdvlwtrdtDDIVKSACFQRKLLLQGisfvkpggivvfsncsldkqdsEEVVQKVLrsspipvelvplnsaYWKSIDMAMAlspegwiritpdmlekidgvssgmDGFFAVALRRLIQPK
MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEqakrdkenrhfaklvnsilrrvsrekIELLQriagisiipeWFKERLENFYGKERVLAISDACISPLYIDLTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYCPKKLFDAVLVDAPCsstgtirrhpdvlwtRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKvlrsspipvelvPLNSAYWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRLIQPK
MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQIlyldvadyavvdlavEQAKRDKENRHFAKLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRLIQPK
****MNARLVSSHLLSCVMRKRISLTCLLDL************RDQILVRAIVNVTLRFLPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRLIQ**
MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLD**********VLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRLIQPK
****MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRLI***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRLIQPK
MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRLIQPK
MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRLIQPK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target445 Fmu (Sun) domain protein [Candidatus Liberibacter asiat
254780634429 NOL1/NOP2/SUN family signature protein [Candidatus 6e-20
>gi|254780634|ref|YP_003065047.1| NOL1/NOP2/SUN family signature protein [Candidatus Liberibacter asiaticus str. psy62] Length = 429 Back     alignment
 Score = 90.1 bits (222), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 53/178 (29%), Positives = 89/178 (50%), Gaps = 17/178 (9%)

Query: 218 FAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKT---AQLIVSGAKVTALDVSKR 274
           F  G + +QD  + I   L    N+  +LD CA  GGKT   + L+ +  ++ A D +K 
Sbjct: 208 FQRGWFEIQDEGSQIVSNLTAITNSSQILDFCAGGGGKTLALSMLLNNKGQIHAWDNNKS 267

Query: 275 RLEKLRCNLDR-------LHLYAEDIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPD 327
           R+  +   + R       LH   E +  +       ++ F  VLVDAPCS TGT RR PD
Sbjct: 268 RMAPIVARIKRAGIHNVQLHSSWESLRNL-------QEHFTTVLVDAPCSGTGTWRRRPD 320

Query: 328 VLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSP 385
           + W     ++++    Q+K+L +   FV+P G +V+  CS+  +++ + +   L  +P
Sbjct: 321 IKWRLSQKNLIERTEEQKKILEESAQFVRPEGYLVYITCSILPEENIQQINYFLSKNP 378

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target445 Fmu (Sun) domain protein [Candidatus Liberibacter asiat
315122151443 Fmu (Sun) domain protein [Candidatus Liberibacter solan 1 0.0
209551488462 Fmu (Sun) domain protein [Rhizobium leguminosarum bv. t 1 1e-125
86359687464 RNA methyltransferase - sun protein [Rhizobium etli CFN 1 1e-124
116254448460 ribosomal RNA small subunit methyltransferase B [Rhizob 1 1e-124
218460752466 RNA methyltransferase - sun protein [Rhizobium etli Kim 1 1e-123
222087916469 tRNA and rRNA cytosine-C5-methylase (RNA methyltransfer 1 1e-123
241206925460 Fmu (Sun) domain protein [Rhizobium leguminosarum bv. t 1 1e-122
150398383470 Fmu (Sun) domain-containing protein [Sinorhizobium medi 1 1e-121
227823840473 Fmu (Sun) domain protein [Sinorhizobium fredii NGR234] 1 1e-120
325294195461 SUN protein [Agrobacterium sp. H13-3] Length = 461 1 1e-120
>gi|315122151|ref|YP_004062640.1| Fmu (Sun) domain protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 443 Back     alignment and organism information
 Score =  684 bits (1765), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/442 (78%), Positives = 393/442 (88%), Gaps = 2/442 (0%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MKSGMNARLV++HLLSCV RKRISLTCLLD E GD AFR LS +DQ LVRAI++ TLRFL
Sbjct: 1   MKSGMNARLVAAHLLSCVTRKRISLTCLLDPERGDIAFRKLSHKDQALVRAILSTTLRFL 60

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           PRIDAVLD +L+SSL +KK SL+QL R+S+AQILYLDVADYAVVDLAVEQAKRD+ENRHF
Sbjct: 61  PRIDAVLDLLLVSSLSKKKQSLRQLFRISIAQILYLDVADYAVVDLAVEQAKRDQENRHF 120

Query: 121 AKLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDL 180
           + LVNSILRRVSREK ELLQR + IS+IP+WFK+RLE+FYGKE    IS AC++P Y+DL
Sbjct: 121 SNLVNSILRRVSREKTELLQRFSSISVIPQWFKKRLEDFYGKESTYCISQACLTPSYVDL 180

Query: 181 TVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTL 240
           TVK DIE WA+KLNAV+LPTGGIRL+E   S+ SLPGFAEGVWWVQDASASIPVQLFG L
Sbjct: 181 TVKSDIEIWANKLNAVVLPTGGIRLREFRGSVSSLPGFAEGVWWVQDASASIPVQLFGPL 240

Query: 241 NNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFD 300
           N LSVLDLCAAPGGKTAQLI+SGAKVTALD+S  RLEKL+ NL+RL L A++IIE DAFD
Sbjct: 241 NGLSVLDLCAAPGGKTAQLILSGAKVTALDISNNRLEKLQHNLNRLRLCADNIIEGDAFD 300

Query: 301 YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGI 360
           Y PKKLFDAVLVDAPCSSTGT+RRHPDVLWTRD +DIV+SACFQ +LLL G++ VKPGGI
Sbjct: 301 YRPKKLFDAVLVDAPCSSTGTMRRHPDVLWTRDAEDIVRSACFQERLLLHGLALVKPGGI 360

Query: 361 VVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDML 420
           VVFSNCSLDKQDSE+VV+KVLRSS IPVE++ LN+A W   +MAMA++PEGW+RITPDML
Sbjct: 361 VVFSNCSLDKQDSEDVVRKVLRSSLIPVEIMSLNNASWN--NMAMAITPEGWLRITPDML 418

Query: 421 EKIDGVSSGMDGFFAVALRRLI 442
            +I+GV SGMDGFFAVALRRLI
Sbjct: 419 GEIEGVPSGMDGFFAVALRRLI 440


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|209551488|ref|YP_002283405.1| Fmu (Sun) domain protein [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 462 Back     alignment and organism information
>gi|86359687|ref|YP_471579.1| RNA methyltransferase - sun protein [Rhizobium etli CFN 42] Length = 464 Back     alignment and organism information
>gi|116254448|ref|YP_770286.1| ribosomal RNA small subunit methyltransferase B [Rhizobium leguminosarum bv. viciae 3841] Length = 460 Back     alignment and organism information
>gi|218460752|ref|ZP_03500843.1| RNA methyltransferase - sun protein [Rhizobium etli Kim 5] Length = 466 Back     alignment and organism information
>gi|222087916|ref|YP_002546454.1| tRNA and rRNA cytosine-C5-methylase (RNA methyltransferase) protein [Agrobacterium radiobacter K84] Length = 469 Back     alignment and organism information
>gi|241206925|ref|YP_002978021.1| Fmu (Sun) domain protein [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 460 Back     alignment and organism information
>gi|150398383|ref|YP_001328850.1| Fmu (Sun) domain-containing protein [Sinorhizobium medicae WSM419] Length = 470 Back     alignment and organism information
>gi|227823840|ref|YP_002827813.1| Fmu (Sun) domain protein [Sinorhizobium fredii NGR234] Length = 473 Back     alignment and organism information
>gi|325294195|ref|YP_004280059.1| SUN protein [Agrobacterium sp. H13-3] Length = 461 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target445 Fmu (Sun) domain protein [Candidatus Liberibacter asiat
PRK10901427 PRK10901, PRK10901, 16S rRNA methyltransferase B; Provi 8e-65
TIGR00563426 TIGR00563, rsmB, ribosomal RNA small subunit methyltran 3e-54
PRK14903431 PRK14903, PRK14903, 16S rRNA methyltransferase B; Provi 7e-36
PRK14902444 PRK14902, PRK14902, 16S rRNA methyltransferase B; Provi 3e-59
PRK14904445 PRK14904, PRK14904, 16S rRNA methyltransferase B; Provi 1e-43
KOG2360413 KOG2360, KOG2360, KOG2360, Proliferation-associated nuc 1e-19
PRK14901434 PRK14901, PRK14901, 16S rRNA methyltransferase B; Provi 9e-50
COG0144355 COG0144, Sun, tRNA and rRNA cytosine-C5-methylases [Tra 3e-68
pfam01189277 pfam01189, Nol1_Nop2_Fmu, NOL1/NOP2/sun family 2e-41
KOG1122460 KOG1122, KOG1122, KOG1122, tRNA and rRNA cytosine-C5-me 5e-33
TIGR00446264 TIGR00446, nop2p, NOL1/NOP2/sun family putative RNA met 2e-32
PRK11933 470 PRK11933, yebU, rRNA (cytosine-C(5)-)-methyltransferase 2e-21
KOG2198375 KOG2198, KOG2198, KOG2198, tRNA cytosine-5-methylases a 3e-25
COG1092393 COG1092, COG1092, Predicted SAM-dependent methyltransfe 1e-09
cd02440107 cd02440, AdoMet_MTases, S-adenosylmethionine-dependent 4e-05
pfam01029126 pfam01029, NusB, NusB family 1e-14
cd00620126 cd00620, Methyltransferase_Sun, N-terminal RNA binding 1e-13
PRK09634207 PRK09634, nusB, transcription antitermination protein N 3e-06
cd00447129 cd00447, NusB_Sun, RNA binding domain of NusB (N protei 8e-06
TIGR01951129 TIGR01951, nusB, transcription antitermination factor N 0.003
>gnl|CDD|182822 PRK10901, PRK10901, 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>gnl|CDD|161931 TIGR00563, rsmB, ribosomal RNA small subunit methyltransferase RsmB Back     alignment and domain information
>gnl|CDD|184896 PRK14903, PRK14903, 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>gnl|CDD|184895 PRK14902, PRK14902, 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>gnl|CDD|184897 PRK14904, PRK14904, 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>gnl|CDD|37571 KOG2360, KOG2360, KOG2360, Proliferation-associated nucleolar protein (NOL1) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>gnl|CDD|184894 PRK14901, PRK14901, 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>gnl|CDD|30493 COG0144, Sun, tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|144689 pfam01189, Nol1_Nop2_Fmu, NOL1/NOP2/sun family Back     alignment and domain information
>gnl|CDD|36338 KOG1122, KOG1122, KOG1122, tRNA and rRNA cytosine-C5-methylase (nucleolar protein NOL1/NOP2) [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|129538 TIGR00446, nop2p, NOL1/NOP2/sun family putative RNA methylase Back     alignment and domain information
>gnl|CDD|183387 PRK11933, yebU, rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed Back     alignment and domain information
>gnl|CDD|37409 KOG2198, KOG2198, KOG2198, tRNA cytosine-5-methylases and related enzymes of the NOL1/NOP2/sun superfamily [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|31289 COG1092, COG1092, Predicted SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>gnl|CDD|100107 cd02440, AdoMet_MTases, S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>gnl|CDD|144570 pfam01029, NusB, NusB family Back     alignment and domain information
>gnl|CDD|29566 cd00620, Methyltransferase_Sun, N-terminal RNA binding domain of the methyltransferase Sun Back     alignment and domain information
>gnl|CDD|182007 PRK09634, nusB, transcription antitermination protein NusB; Provisional Back     alignment and domain information
>gnl|CDD|29564 cd00447, NusB_Sun, RNA binding domain of NusB (N protein-Utilization Substance B) and Sun (also known as RrmB or Fmu) proteins Back     alignment and domain information
>gnl|CDD|162621 TIGR01951, nusB, transcription antitermination factor NusB Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 445 Fmu (Sun) domain protein [Candidatus Liberibacter asiat
PRK10901428 16S rRNA methyltransferase B; Provisional 100.0
TIGR00563487 rsmB ribosomal RNA small subunit methyltransferase B; I 100.0
KOG2360413 consensus 100.0
COG0144355 Sun tRNA and rRNA cytosine-C5-methylases [Translation, 100.0
PRK11933 471 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Revi 100.0
pfam01189277 Nol1_Nop2_Fmu NOL1/NOP2/sun family. 100.0
TIGR00446284 nop2p NOL1/NOP2/sun family putative RNA methylase; Inte 100.0
KOG1122460 consensus 100.0
KOG2198375 consensus 100.0
pfam05175170 MTS Methyltransferase small domain. This domain is foun 99.22
COG1092393 Predicted SAM-dependent methyltransferases [General fun 99.13
pfam10672286 Methyltrans_SAM S-adenosylmethionine-dependent methyltr 99.08
COG2242187 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] 98.97
PRK08317241 hypothetical protein; Provisional 98.93
PRK08287186 cobalt-precorrin-6Y C(15)-methyltransferase; Validated 98.87
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provi 98.87
pfam01209233 Ubie_methyltran ubiE/COQ5 methyltransferase family. 98.82
PRK07402196 precorrin-6B methylase; Provisional 98.78
PRK00216239 ubiE ubiquinone/menaquinone biosynthesis methyltransfer 98.78
PTZ00098263 phosphoethanolamine N-methyltransferase; Provisional 98.69
COG2226238 UbiE Methylase involved in ubiquinone/menaquinone biosy 98.69
PRK09328277 N5-glutamine S-adenosyl-L-methionine-dependent methyltr 98.64
pfam08704309 GCD14 tRNA methyltransferase complex GCD14 subunit. GCD 98.64
TIGR03534251 RF_mod_HemK protein-(glutamine-N5) methyltransferase, r 98.61
PRK01544 503 bifunctional N5-glutamine S-adenosyl-L-methionine-depen 98.59
COG2813300 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosom 98.58
pfam01170171 UPF0020 Putative RNA methylase family UPF0020. This dom 98.57
COG2520341 Predicted methyltransferase [General function predictio 98.56
PRK09489342 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provi 98.55
COG4123248 Predicted O-methyltransferase [General function predict 98.49
PRK11188209 rrmJ 23S rRNA methyltransferase J; Provisional 98.43
pfam02384312 N6_Mtase N-6 DNA Methylase. Restriction-modification (R 98.3
COG2263198 Predicted RNA methylase [Translation, ribosomal structu 98.28
KOG1540296 consensus 98.23
PRK11036256 putative metallothionein SmtA; Provisional 98.19
TIGR00438192 rrmJ ribosomal RNA large subunit methyltransferase J; I 98.04
KOG2904328 consensus 98.03
pfam01728176 FtsJ FtsJ-like methyltransferase. This family consists 98.0
COG2230283 Cfa Cyclopropane fatty acid synthase and related methyl 98.0
COG0293205 FtsJ 23S rRNA methylase [Translation, ribosomal structu 97.99
COG2264300 PrmA Ribosomal protein L11 methylase [Translation, ribo 97.98
TIGR01934242 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis meth 97.9
PRK00517298 prmA ribosomal protein L11 methyltransferase; Reviewed 97.88
pfam01269229 Fibrillarin Fibrillarin. 97.75
KOG2187534 consensus 97.75
pfam06325294 PrmA Ribosomal protein L11 methyltransferase (PrmA). Th 97.66
TIGR02752231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methylt 97.62
) (PCMT) (which is also known as L-isoaspartyl protein carboxyl methyltransferase) is an enzyme that catalyzes the transfer of a methyl group from S- adenosylmethionine to the free carboxyl groups of D-aspartyl or L-isoaspartyl residues in a variety of peptides and proteins. The enzyme does not act on normal L-aspartyl residues L-isoaspartyl and D-aspartyl are the products of the spontaneous deamidation and/or isomerization of normal L-aspartyl and L- asparaginyl residues in proteins. PCMT plays a role in the repair and/or degradation of these damaged proteins; the enzymatic methyl esterification of the abnormal residues can lead to their conversion to normal L-aspartyl residues. The SAM domain is present in most of these proteins.; GO: 0004719 protein-L-isoaspartate (D-aspartate) O-methyltransferase activity, 0006464 protein modification process." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR00080">TIGR00080228 pimt protein-L-isoaspartate O-methyltransferase; InterP 97.58
COG2521287 Predicted archaeal methyltransferase [General function 97.56
TIGR02072272 BioC biotin biosynthesis protein BioC; InterPro: IPR011 97.53
PRK00107216 gidB glucose-inhibited division protein B; Reviewed 97.47
PRK11705383 cyclopropane fatty acyl phospholipid synthase; Provisio 97.47
KOG2915314 consensus 97.44
TIGR02143361 trmA_only tRNA (uracil-5-)-methyltransferase; InterPro: 97.41
KOG2671421 consensus 97.28
PRK06922679 hypothetical protein; Provisional 97.28
pfam02390199 Methyltransf_4 Putative methyltransferase. This is a fa 97.26
PRK00121229 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed 97.25
PTZ00146296 fibrillarin; Provisional 97.18
pfam02527184 GidB rRNA small subunit methyltransferase G. This is a 97.0
TIGR00537183 hemK_rel_arch methylase, putative; InterPro: IPR004557 96.99
KOG1099294 consensus 96.86
COG4106257 Tam Trans-aconitate methyltransferase [General function 96.74
TIGR00406330 prmA ribosomal protein L11 methyltransferase; InterPro: 96.54
COG0286489 HsdM Type I restriction-modification system methyltrans 96.42
TIGR01177358 TIGR01177 conserved hypothetical protein TIGR01177; Int 96.31
PRK03612516 spermidine synthase; Provisional 96.19
PRK04457262 spermidine synthase; Provisional 96.18
pfam08003315 Methyltransf_9 Protein of unknown function (DUF1698). T 95.98
COG1889231 NOP1 Fibrillarin-like rRNA methylase [Translation, ribo 95.97
KOG1596317 consensus 95.92
pfam12147311 Hydrolase_5 Putative lysophospholipase. This domain is 95.91
TIGR00536311 hemK_fam methyltransferase, HemK family; InterPro: IPR0 95.83
TIGR00138197 gidB methyltransferase GidB; InterPro: IPR003682 GidB ( 95.8
pfam01564240 Spermine_synth Spermine/spermidine synthase. Spermine a 95.65
TIGR00006323 TIGR00006 S-adenosyl-methyltransferase MraW; InterPro: 95.6
TIGR00477239 tehB tellurite resistance protein TehB; InterPro: IPR00 95.43
COG0275314 Predicted S-adenosylmethionine-dependent methyltransfer 95.15
KOG4589232 consensus 94.93
PRK01581363 speE spermidine synthase; Validated 94.88
COG0357215 GidB Predicted S-adenosylmethionine-dependent methyltra 94.87
COG0421282 SpeE Spermidine synthase [Amino acid transport and meta 94.63
pfam10294171 Methyltransf_16 Putative methyltransferase. 94.56
pfam04989202 CmcI Cephalosporin hydroxylase. Members of this family 94.38
KOG2899288 consensus 93.97
KOG1541270 consensus 93.79
KOG1975389 consensus 93.75
pfam05724203 TPMT Thiopurine S-methyltransferase (TPMT). This family 93.27
KOG2078495 consensus 93.01
TIGR00091216 TIGR00091 tRNA (guanine-N(7)-)-methyltransferase; Inter 92.88
KOG0820315 consensus 90.36
cd00620126 Methyltransferase_Sun N-terminal RNA binding domain of 99.94
pfam01029126 NusB NusB family. The NusB protein is involved in the r 99.86
cd00447129 NusB_Sun RNA binding domain of NusB (N protein-Utilizat 99.85
PRK00202132 nusB transcription antitermination protein NusB; Review 99.84
cd00619130 Terminator_NusB Transcription termination factor NusB ( 99.79
TIGR01951140 nusB transcription antitermination factor NusB; InterPr 99.77
COG0781151 NusB Transcription termination factor [Transcription] 99.68
PRK09634206 nusB transcription antitermination protein NusB; Provis 99.46
pfam02475199 Met_10 Met-10+ like-protein. The methionine-10 mutant a 98.96
PRK11805307 N5-glutamine S-adenosyl-L-methionine-dependent methyltr 98.89
PRK11873258 arsM arsenite S-adenosylmethyltransferase; Reviewed 98.86
TIGR03533284 L3_gln_methyl protein-(glutamine-N5) methyltransferase, 98.85
PRK05134233 3-demethylubiquinone-9 3-methyltransferase; Provisional 98.81
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methyltran 98.8
PRK03522375 rumB 23S rRNA methyluridine methyltransferase; Reviewed 98.7
COG2519256 GCD14 tRNA(1-methyladenosine) methyltransferase and rel 98.67
COG1041347 Predicted DNA modification methylase [DNA replication, 98.67
pfam09445165 Methyltransf_15 RNA cap guanine-N2 methyltransferase. R 98.62
smart00828224 PKS_MT Methyltransferase in polyketide synthase (PKS) e 98.6
PRK11207198 tellurite resistance protein TehB; Provisional 98.58
PRK10909198 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional 98.48
PRK01683252 trans-aconitate 2-methyltransferase; Provisional 98.46
TIGR02469135 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylat 98.46
PRK13942214 protein-L-isoaspartate O-methyltransferase; Provisional 98.41
PRK00312213 pcm protein-L-isoaspartate O-methyltransferase; Reviewe 98.36
COG2890280 HemK Methylase of polypeptide chain release factors [Tr 98.36
PRK09329285 N5-glutamine S-adenosyl-L-methionine-dependent methyltr 98.33
PRK10258251 biotin biosynthesis protein BioC; Provisional 98.29
PRK11783716 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional 98.28
pfam02353273 CMAS Cyclopropane-fatty-acyl-phospholipid synthase. Thi 98.22
pfam01135205 PCMT Protein-L-isoaspartate(D-aspartate) O-methyltransf 98.21
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzo 98.16
TIGR01983275 UbiG ubiquinone biosynthesis O-methyltransferase; Inter 98.16
pfam03848192 TehB Tellurite resistance protein TehB. 98.16
COG2518209 Pcm Protein-L-isoaspartate carboxylmethyltransferase [P 98.04
COG0742187 N6-adenine-specific methylase [DNA replication, recombi 98.03
pfam05401201 NodS Nodulation protein S (NodS). This family consists 97.97
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provisional 97.9
pfam01596204 Methyltransf_3 O-methyltransferase. Members of this fam 97.88
TIGR00095210 TIGR00095 putative methyltransferase; InterPro: IPR0043 97.86
pfam03602181 Cons_hypoth95 Conserved hypothetical protein 95. 97.85
pfam0824195 Methyltransf_11 Methyltransferase domain. Members of th 97.8
COG4122219 Predicted O-methyltransferase [General function predict 97.75
PRK07580230 Mg-protoporphyrin IX methyl transferase; Validated 97.75
PRK04338 376 N(2),N(2)-dimethylguanosine tRNA methyltransferase; Pro 97.74
pfam0824298 Methyltransf_12 Methyltransferase domain. Members of th 97.74
TIGR02021224 BchM-ChlM magnesium protoporphyrin O-methyltransferase; 97.51
KOG1270282 consensus 97.51
KOG1271227 consensus 97.36
PRK04266226 fibrillarin; Provisional 97.29
PRK12335289 tellurite resistance protein TehB; Provisional 97.22
COG0220227 Predicted S-adenosylmethionine-dependent methyltransfer 97.17
pfam03291327 Pox_MCEL mRNA capping enzyme. This family of enzymes ar 96.8
COG4076252 Predicted RNA methylase [General function prediction on 96.75
COG0030259 KsgA Dimethyladenosine transferase (rRNA methylation) [ 96.49
pfam01861243 DUF43 Protein of unknown function DUF43. This family in 96.37
pfam05219265 DREV DREV methyltransferase. This family contains DREV 96.34
KOG1663237 consensus 96.3
PRK00811283 spermidine synthase; Provisional 96.28
pfam00398258 RrnaAD Ribosomal RNA adenine dimethylase. 95.93
KOG2361264 consensus 95.86
KOG4300252 consensus 95.62
TIGR02085386 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase R 94.96
COG1568354 Predicted methyltransferases [General function predicti 93.61
KOG1661237 consensus 93.12
pfam05891217 Hydroxy-O-Methy Putative hydroxyindole-O-methyltransfer 92.3
COG3963194 Phospholipid N-methyltransferase [Lipid metabolism] 90.88
pfam05185447 PRMT5 PRMT5 arginine-N-methyltransferase. The human hom 90.36
PRK09880343 L-idonate 5-dehydrogenase; Provisional 90.2
COG2265432 TrmA SAM-dependent methyltransferases related to tRNA ( 98.67
PRK05031363 tRNA (uracil-5-)-methyltransferase; Validated 98.56
PRK13168440 rumA 23S rRNA 5-methyluridine methyltransferase; Review 98.55
pfam05958353 tRNA_U5-meth_tr tRNA (Uracil-5-)-methyltransferase. Thi 98.44
PRK13943317 protein-L-isoaspartate O-methyltransferase; Provisional 98.42
TIGR00479434 rumA 23S rRNA (uracil-5-)-methyltransferase RumA; Inter 98.03
KOG2730263 consensus 97.51
pfam02005 375 TRM N2,N2-dimethylguanosine tRNA methyltransferase. Thi 97.15
pfam04445235 DUF548 Protein of unknown function (DUF548). Protein of 96.82
PRK00050309 mraW S-adenosyl-methyltransferase MraW; Provisional 96.65
PRK11760356 putative RNA 2'-O-ribose methyltransferase; Provisional 96.58
pfam01795310 Methyltransf_5 MraW methylase family. Members of this f 96.44
PRK05785225 hypothetical protein; Provisional 96.27
KOG1253 525 consensus 96.25
smart00650169 rADc Ribosomal RNA adenine dimethylases. 96.24
COG3897218 Predicted methyltransferase [General function predictio 96.17
PHA02056279 putative methyltransferase 95.96
KOG3420185 consensus 95.91
PRK10742250 putative methyltransferase; Provisional 95.61
PRK11088272 rrmA 23S rRNA methyltransferase A; Provisional 95.43
PRK06202233 hypothetical protein; Provisional 95.23
cd00315275 Cyt_C5_DNA_methylase Cytosine-C5 specific DNA methylase 95.11
PTZ00338296 dimethyladenosine transferase; Provisional 95.08
pfam07021193 MetW Methionine biosynthesis protein MetW. This family 95.06
COG1867 380 TRM1 N2,N2-dimethylguanosine tRNA methyltransferase [Tr 94.74
pfam00145 319 DNA_methylase C-5 cytosine-specific DNA methylase. 94.6
COG2933358 Predicted SAM-dependent methyltransferase [General func 94.48
PRK00274267 ksgA dimethyladenosine transferase; Reviewed 94.03
COG0270 328 Dcm Site-specific DNA methylase [DNA replication, recom 92.19
COG0116381 Predicted N6-adenine-specific DNA methylase [DNA replic 97.23
KOG1098780 consensus 96.31
pfam01234261 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family. 90.62
pfam04816204 DUF633 Family of unknown function (DUF633). This family 95.56
pfam10354166 DUF2431 Domain of unknown function (DUF2431). This is t 94.66
pfam10237161 N6-adenineMlase Probable N6-adenine methyltransferase. 91.87
KOG3115249 consensus 91.44
>PRK10901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase B; InterPro: IPR004573 This family consists of bacterial sequences related to Escherichia coli rsmB, an rRNA SAM-dependent methyltransferase Back     alignment and domain information
>KOG2360 consensus Back     alignment and domain information
>COG0144 Sun tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed Back     alignment and domain information
>pfam01189 Nol1_Nop2_Fmu NOL1/NOP2/sun family Back     alignment and domain information
>TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase; InterPro: IPR011023 This domain is found in archaeal, bacterial and eukaryotic proteins Back     alignment and domain information
>KOG1122 consensus Back     alignment and domain information
>KOG2198 consensus Back     alignment and domain information
>pfam05175 MTS Methyltransferase small domain Back     alignment and domain information
>COG1092 Predicted SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>pfam10672 Methyltrans_SAM S-adenosylmethionine-dependent methyltransferase Back     alignment and domain information
>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>pfam01209 Ubie_methyltran ubiE/COQ5 methyltransferase family Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>pfam08704 GCD14 tRNA methyltransferase complex GCD14 subunit Back     alignment and domain information
>TIGR03534 RF_mod_HemK protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>pfam01170 UPF0020 Putative RNA methylase family UPF0020 Back     alignment and domain information
>COG2520 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional Back     alignment and domain information
>COG4123 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>pfam02384 N6_Mtase N-6 DNA Methylase Back     alignment and domain information
>COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1540 consensus Back     alignment and domain information
>PRK11036 putative metallothionein SmtA; Provisional Back     alignment and domain information
>TIGR00438 rrmJ ribosomal RNA large subunit methyltransferase J; InterPro: IPR004512 The ribosomal RNA large subunit methyltransferase J 2 Back     alignment and domain information
>KOG2904 consensus Back     alignment and domain information
>pfam01728 FtsJ FtsJ-like methyltransferase Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG0293 FtsJ 23S rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>pfam01269 Fibrillarin Fibrillarin Back     alignment and domain information
>KOG2187 consensus Back     alignment and domain information
>pfam06325 PrmA Ribosomal protein L11 methyltransferase (PrmA) Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase; InterPro: IPR014122 MenG is a generic term for a methyltransferase that catalyses the last step in menaquinone biosynthesis; the exact enzymatic activity differs for different MenG because the menaquinone differ in their prenoid side chains in different species Back     alignment and domain information
>TIGR00080 pimt protein-L-isoaspartate O-methyltransferase; InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (Back     alignment and domain information
>COG2521 Predicted archaeal methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR02072 BioC biotin biosynthesis protein BioC; InterPro: IPR011814 This enzyme, which is found in biotin biosynthetic gene clusters in proteobacteria, firmicutes, green-sulphur bacteria, fusobacterium and bacteroides, is believed to carry out an enzymatic step prior to the formation of pimeloyl-CoA (although attribution of this annotation is not traceable) Back     alignment and domain information
>PRK00107 gidB glucose-inhibited division protein B; Reviewed Back     alignment and domain information
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>KOG2915 consensus Back     alignment and domain information
>TIGR02143 trmA_only tRNA (uracil-5-)-methyltransferase; InterPro: IPR011869 This family consists exclusively of proteins believed to act as tRNA (uracil-5-)-methyltransferase Back     alignment and domain information
>KOG2671 consensus Back     alignment and domain information
>PRK06922 hypothetical protein; Provisional Back     alignment and domain information
>pfam02390 Methyltransf_4 Putative methyltransferase Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>PTZ00146 fibrillarin; Provisional Back     alignment and domain information
>pfam02527 GidB rRNA small subunit methyltransferase G Back     alignment and domain information
>TIGR00537 hemK_rel_arch methylase, putative; InterPro: IPR004557 These proteins exhibit homology to the Saccharomyces cerevisiae (yeast) ORF YDR140w (FYV9) Back     alignment and domain information
>KOG1099 consensus Back     alignment and domain information
>COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase; InterPro: IPR004498 Ribosomal protein L11 methyltransferase (2 Back     alignment and domain information
>COG0286 HsdM Type I restriction-modification system methyltransferase subunit [Defense mechanisms] Back     alignment and domain information
>TIGR01177 TIGR01177 conserved hypothetical protein TIGR01177; InterPro: IPR005885 This family of largely hypothetical proteins is found exclusively in the Archaea and contain a putative RNA methylase domain Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>PRK04457 spermidine synthase; Provisional Back     alignment and domain information
>pfam08003 Methyltransf_9 Protein of unknown function (DUF1698) Back     alignment and domain information
>COG1889 NOP1 Fibrillarin-like rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1596 consensus Back     alignment and domain information
>pfam12147 Hydrolase_5 Putative lysophospholipase Back     alignment and domain information
>TIGR00536 hemK_fam methyltransferase, HemK family; InterPro: IPR004556 The gene hemK from Escherichia coli was found to contribute to heme biosynthesis and originally suggested to be protoporphyrinogen oxidase Back     alignment and domain information
>TIGR00138 gidB methyltransferase GidB; InterPro: IPR003682 GidB (glucose-inhibited division protein B) appears to be present and in a single copy in all complete eubacterial genomes so far Back     alignment and domain information
>pfam01564 Spermine_synth Spermine/spermidine synthase Back     alignment and domain information
>TIGR00006 TIGR00006 S-adenosyl-methyltransferase MraW; InterPro: IPR002903 This is a family of methyltransferases Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB; InterPro: IPR004537 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB Back     alignment and domain information
>COG0275 Predicted S-adenosylmethionine-dependent methyltransferase involved in cell envelope biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG4589 consensus Back     alignment and domain information
>PRK01581 speE spermidine synthase; Validated Back     alignment and domain information
>COG0357 GidB Predicted S-adenosylmethionine-dependent methyltransferase involved in bacterial cell division [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>pfam10294 Methyltransf_16 Putative methyltransferase Back     alignment and domain information
>pfam04989 CmcI Cephalosporin hydroxylase Back     alignment and domain information
>KOG2899 consensus Back     alignment and domain information
>KOG1541 consensus Back     alignment and domain information
>KOG1975 consensus Back     alignment and domain information
>pfam05724 TPMT Thiopurine S-methyltransferase (TPMT) Back     alignment and domain information
>KOG2078 consensus Back     alignment and domain information
>TIGR00091 TIGR00091 tRNA (guanine-N(7)-)-methyltransferase; InterPro: IPR004395 This predicted S-adenosylmethionine-dependent methyltransferase is found in a single copy in most Bacteria Back     alignment and domain information
>KOG0820 consensus Back     alignment and domain information
>cd00620 Methyltransferase_Sun N-terminal RNA binding domain of the methyltransferase Sun Back     alignment and domain information
>pfam01029 NusB NusB family Back     alignment and domain information
>cd00447 NusB_Sun RNA binding domain of NusB (N protein-Utilization Substance B) and Sun (also known as RrmB or Fmu) proteins Back     alignment and domain information
>PRK00202 nusB transcription antitermination protein NusB; Reviewed Back     alignment and domain information
>cd00619 Terminator_NusB Transcription termination factor NusB (N protein-Utilization Substance B) Back     alignment and domain information
>TIGR01951 nusB transcription antitermination factor NusB; InterPro: IPR011605 The NusB protein is involved in the regulation of rRNA biosynthesis by transcriptional antitermination Back     alignment and domain information
>COG0781 NusB Transcription termination factor [Transcription] Back     alignment and domain information
>PRK09634 nusB transcription antitermination protein NusB; Provisional Back     alignment and domain information
>pfam02475 Met_10 Met-10+ like-protein Back     alignment and domain information
>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>PRK05134 3-demethylubiquinone-9 3-methyltransferase; Provisional Back     alignment and domain information
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed Back     alignment and domain information
>COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG1041 Predicted DNA modification methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>pfam09445 Methyltransf_15 RNA cap guanine-N2 methyltransferase Back     alignment and domain information
>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit; InterPro: IPR014008 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt Back     alignment and domain information
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK09329 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>pfam02353 CMAS Cyclopropane-fatty-acyl-phospholipid synthase Back     alignment and domain information
>pfam01135 PCMT Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT) Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase; InterPro: IPR010233 This entry represents an O-methyltransferase, which is believed to act at two points in the ubiquinone biosynthetic pathway in bacteria (UbiG) and mitochondria (COQ3) , Back     alignment and domain information
>pfam03848 TehB Tellurite resistance protein TehB Back     alignment and domain information
>COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0742 N6-adenine-specific methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>pfam05401 NodS Nodulation protein S (NodS) Back     alignment and domain information
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>pfam01596 Methyltransf_3 O-methyltransferase Back     alignment and domain information
>TIGR00095 TIGR00095 putative methyltransferase; InterPro: IPR004398 This is a family of conserved hypothetical proteins, which includes a putative methylase Back     alignment and domain information
>pfam03602 Cons_hypoth95 Conserved hypothetical protein 95 Back     alignment and domain information
>pfam08241 Methyltransf_11 Methyltransferase domain Back     alignment and domain information
>COG4122 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated Back     alignment and domain information
>PRK04338 N(2),N(2)-dimethylguanosine tRNA methyltransferase; Provisional Back     alignment and domain information
>pfam08242 Methyltransf_12 Methyltransferase domain Back     alignment and domain information
>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase; InterPro: IPR010251 Chlorophyll and bacteriochlorophyll are essential photosynthetic pigments involved in oxygenic and non-oxygenic photosythesis respectively Back     alignment and domain information
>KOG1270 consensus Back     alignment and domain information
>KOG1271 consensus Back     alignment and domain information
>PRK04266 fibrillarin; Provisional Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>COG0220 Predicted S-adenosylmethionine-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>pfam03291 Pox_MCEL mRNA capping enzyme Back     alignment and domain information
>COG4076 Predicted RNA methylase [General function prediction only] Back     alignment and domain information
>COG0030 KsgA Dimethyladenosine transferase (rRNA methylation) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>pfam01861 DUF43 Protein of unknown function DUF43 Back     alignment and domain information
>pfam05219 DREV DREV methyltransferase Back     alignment and domain information
>KOG1663 consensus Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>pfam00398 RrnaAD Ribosomal RNA adenine dimethylase Back     alignment and domain information
>KOG2361 consensus Back     alignment and domain information
>KOG4300 consensus Back     alignment and domain information
>TIGR02085 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase RumB; InterPro: IPR011825 This family consists of RNA methyltransferases designated RumB, formerly YbjF Back     alignment and domain information
>COG1568 Predicted methyltransferases [General function prediction only] Back     alignment and domain information
>KOG1661 consensus Back     alignment and domain information
>pfam05891 Hydroxy-O-Methy Putative hydroxyindole-O-methyltransferase Back     alignment and domain information
>COG3963 Phospholipid N-methyltransferase [Lipid metabolism] Back     alignment and domain information
>pfam05185 PRMT5 PRMT5 arginine-N-methyltransferase Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>COG2265 TrmA SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK05031 tRNA (uracil-5-)-methyltransferase; Validated Back     alignment and domain information
>PRK13168 rumA 23S rRNA 5-methyluridine methyltransferase; Reviewed Back     alignment and domain information
>pfam05958 tRNA_U5-meth_tr tRNA (Uracil-5-)-methyltransferase Back     alignment and domain information
>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA; InterPro: IPR001566 This protein family was first proposed to be RNA methyltransferases by homology to the TrmA family Back     alignment and domain information
>KOG2730 consensus Back     alignment and domain information
>pfam02005 TRM N2,N2-dimethylguanosine tRNA methyltransferase Back     alignment and domain information
>pfam04445 DUF548 Protein of unknown function (DUF548) Back     alignment and domain information
>PRK00050 mraW S-adenosyl-methyltransferase MraW; Provisional Back     alignment and domain information
>PRK11760 putative RNA 2'-O-ribose methyltransferase; Provisional Back     alignment and domain information
>pfam01795 Methyltransf_5 MraW methylase family Back     alignment and domain information
>PRK05785 hypothetical protein; Provisional Back     alignment and domain information
>KOG1253 consensus Back     alignment and domain information
>smart00650 rADc Ribosomal RNA adenine dimethylases Back     alignment and domain information
>COG3897 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PHA02056 putative methyltransferase Back     alignment and domain information
>KOG3420 consensus Back     alignment and domain information
>PRK10742 putative methyltransferase; Provisional Back     alignment and domain information
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional Back     alignment and domain information
>PRK06202 hypothetical protein; Provisional Back     alignment and domain information
>cd00315 Cyt_C5_DNA_methylase Cytosine-C5 specific DNA methylases; Methyl transfer reactions play an important role in many aspects of biology Back     alignment and domain information
>PTZ00338 dimethyladenosine transferase; Provisional Back     alignment and domain information
>pfam07021 MetW Methionine biosynthesis protein MetW Back     alignment and domain information
>COG1867 TRM1 N2,N2-dimethylguanosine tRNA methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>pfam00145 DNA_methylase C-5 cytosine-specific DNA methylase Back     alignment and domain information
>COG2933 Predicted SAM-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>PRK00274 ksgA dimethyladenosine transferase; Reviewed Back     alignment and domain information
>COG0270 Dcm Site-specific DNA methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG0116 Predicted N6-adenine-specific DNA methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1098 consensus Back     alignment and domain information
>pfam01234 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family Back     alignment and domain information
>pfam04816 DUF633 Family of unknown function (DUF633) Back     alignment and domain information
>pfam10354 DUF2431 Domain of unknown function (DUF2431) Back     alignment and domain information
>pfam10237 N6-adenineMlase Probable N6-adenine methyltransferase Back     alignment and domain information
>KOG3115 consensus Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target445 Fmu (Sun) domain protein [Candidatus Liberibacter asiat
1sqf_A429 The Crystal Structure Of E. Coli Fmu Binary Complex 3e-69
2yxl_A450 Crystal Structure Of Ph0851 Length = 450 2e-44
1ixk_A315 Crystal Structure Analysis Of Methyltransferase Hom 7e-36
2frx_A 479 Crystal Structure Of Yebu, A M5c Rna Methyltransfer 1e-31
3m6w_A