254780679

254780679

hypothetical protein CLIBASIA_02830

GeneID in NCBI database:8209683Locus tag:CLIBASIA_02830
Protein GI in NCBI database:254780679Protein Accession:YP_003065092.1
Gene range:-(588688, 589077)Protein Length:129aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:not defined as a protein in SEED
Pathway involved in KEGG:not defined
Subsystem involved in KEGG:not defined
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNyes
COILScoiled coil
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------13
MSYLNWFDLLTIMLLCIIFTCTFKSILHLICSLKYFPRNIYKIFSNIYQQKHNTASFHRASLQKKDIGATPTKKGNSSQLISTNTNKDKKPRINLREKKQPQRKPITKQKKNPIPLASRSNPMQNNNDR
ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHccccccccccccEEEEccccccccccccHHHHccHHHcccHHHcccccccccccccccccccc
ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHccccccHHHHHHcHccccccccccccccEEEEccccccccccEccHccccccccccccccccccccccccccccccccc
MSYLNWFDLLTIMLLCIIFTCTFKSILHLICslkyfprnIYKIFSNIYqqkhntasfhraslqkkdigatptkkgnssqlistntnkdkkprinlrekkqpqrkpitkqkknpiplasrsnpmqnnndr
MSYLNWFDLLTIMLLCIIFTCTFKSILHLICSLKYFPRNIYKIFSNIYQQKHNTASFHRASLQKKDigatptkkgnssqlistntnkdkkprinlrekkqpqrkpitkqkknpiplasrsnpmqnnndr
MSYLNWFDLLTIMLLCIIFTCTFKSILHLICSLKYFPRNIYKIFSNIYQQKHNTASFHRASLQKKDIGATPTKKGNSSQLISTNTNKDKKPRINLREKKQPQRKPITKQKKNPIPLASRSNPMQNNNDR
*SYLNWFDLLTIMLLCIIFTCTFKSILHLICSLKYFPRNIYKIFSNIY*********************************************************************************
MSYLNWFDLLTIMLLCIIFTCTFKSILHLICSLKYFPRNIYKIFSNIYQQKHNTASFHRASLQKKDIGA*************TNTNKDKKPRINLRE*************KNPIPLASRS*********
*SYLNWFDLLTIMLLCIIFTCTFKSILHLICSLKYFPRNIYKIFSNIYQQKHN***********KDIGATP***GNSSQLIS***NKDKKPRINLR*KKQPQRKPITK*KK**IPLA************
oooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSiiHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
MSYLNWFDLLTIMLLCIIFTCTFKSILHLICSLKYFPRNIYKIFSNIYQQKHNTASFHRASLQKKDIGATPTKKGNSSQLISTNTNKDKKPRINLREKKQPQRKPITKQKKNPIPLASRSNPMQNNNDR

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target129 hypothetical protein CLIBASIA_02830 [Candidatus Liberib
31512221099 hypothetical protein CKC_02300 [Candidatus Liberibacter 1 6e-05
>gi|315122210|ref|YP_004062699.1| hypothetical protein CKC_02300 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 99 Back     alignment and organism information
 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 56/104 (53%), Gaps = 11/104 (10%)

Query: 1   MSYLNWFDLLTIMLLCIIFTCTFKSILHLICSLKYFPRNIY----KIFSNIYQQKHNTAS 56
           M  +N FD+LTI++LCII T  F    H   SL   P N Y    K FS IY+ + N + 
Sbjct: 1   MLNVNVFDILTIVVLCIILTLNF----HYFWSLIRNPINSYKRIRKAFSEIYKSQRNISP 56

Query: 57  FHRASLQKKDIGATPTKKGNSSQLISTNTNKDKKPRINLREKKQ 100
                L KKD+   PT+K  +S+  +T  NK K P INL  +K+
Sbjct: 57  NSSTPL-KKDLEIKPTRKKQTSK-DTTEENKKKHP-INLAMRKE 97


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00