254780743

254780743

putative uracil-DNA glycosylase

GeneID in NCBI database:8209748Locus tag:CLIBASIA_03150
Protein GI in NCBI database:254780743Protein Accession:YP_003065156.1
Gene range:-(527692, 528477)Protein Length:261aa
Gene description:putative uracil-DNA glycosylase
COG prediction:[L] Uracil-DNA glycosylase
KEGG prediction:putative uracil-DNA glycosylase; K02334 DNA polymerase bacteriophage-type [EC:2.7.7.7]
SEED prediction:Uracil-DNA glycosylase, family 4
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Uracil-DNA glycosylase
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-
MTSKRILSQEQILTIALFYADSGVYWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKNL
ccccccccHHHHHHHHHHHHHcccHHHHccccccccccccccccccccccccccccccccccccccHHHHccccccHHHHHHHHHHcccccccccccccccccccccccEEEEEccccHHHHHcccccccHHHHHHHHHHHHccccHHHEEEEEEEEccccccccccHHHHHHHHHHHHHHHHHccccEEEEEcHHHHHHHccccccccHHHHHHHHHccccccccEEEEEccccHHHccHHHHHHHHHHHHHHHHHHHcc
ccccccccHHHHHHHHHHHHHcccccccccccHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHcccHHHHHHHHHHccccccHcccccEEEccccccccEEEEEccccccHHcccccccccHHHHHHHHHHHHccccccEEEEEEEEccccccccccHHHHHHHHHHHHHHHHHHcccEEEEEcHHHHHHHHcccccccccEccEEEEEEccccccEEEEEEcHHHHHcccHHHHHHHHHHHHHHHHHHcc
MTSKRILSQEQILTIALFYAdsgvywvfdepnneatyesqrkeksidsaiqpitnirhihsplvQQADSIAQKACSLHELKSLLRSFhdchlcstslsTICAtqtegqdlmiigytpsdsdnisgkpfsgktgNMLDKMLQSIEIMRTQIHismispwhppgnrnlsniemEICRPIIMRQIELISPKILLFIGnktknfffnndAQKTYQnlgkwsnlctphsiiptlatvhpqeliqyplikkNTWHALITLKKALKNL
mtskrilsqEQILTIALFYADSGVYWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKNL
MTSKRILSQEQILTIALFYADSGVYWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKNL
**********QILTIALFYADSGVYWVFDEPN*********************************************HELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKNL
********QEQILTIALFYADSGVYWVFDEPNNE**********SIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKNL
****RILSQEQILTIALFYADSGVYWVFDEPN*EATYE*******************HIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKNL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTSKRILSQEQILTIALFYADSGVYWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKNL
MTSKRILSQEQILTIALFYADSGVYWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKNL
MTSKRILSQEQILTIALFYADSGVYWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKNL

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target261 putative uracil-DNA glycosylase [Candidatus Liberibacte
315121906260 putative uracil-DNA glycosylase [Candidatus Liberibacte 1 1e-100
116251217299 uracil-DNA glycosylase [Rhizobium leguminosarum bv. vic 1 1e-44
209548539299 phage SPO1 DNA polymerase-related protein [Rhizobium le 1 5e-44
218682587299 phage SPO1 DNA polymerase-related protein [Rhizobium et 1 5e-43
327193963296 putative DNA-directed DNA polymerase protein (uracil-DN 1 3e-42
190891014296 DNA-directed DNA polymerase (uracil-DNA glycosylase) [R 1 3e-42
218675319296 probable DNA-directed DNA polymerase protein (uracil-DN 1 4e-42
86356942297 DNA polymerase bacteriophage-type (uracil-DNA glycosyla 1 7e-42
241203823299 phage SPO1 DNA polymerase-related protein [Rhizobium le 1 2e-41
15888330296 DNA polymerase [Agrobacterium tumefaciens str. C58] Len 1 9e-40
>gi|315121906|ref|YP_004062395.1| putative uracil-DNA glycosylase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 260 Back     alignment and organism information
 Score =  370 bits (949), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 183/260 (70%), Positives = 210/260 (80%), Gaps = 2/260 (0%)

Query: 1   MTSKRILSQEQILTIALFYADSGVYWVFDEPNNEATYESQRKEKSIDSAIQPITNIRHIH 60
           MT KR LSQE+IL  ALFYADSGVYWVFD  N + T++S  +EK   S+ QPI  I   +
Sbjct: 1   MTYKRTLSQEKILNTALFYADSGVYWVFDHSNGK-THKSWGEEKPPLSS-QPIKEIDQTN 58

Query: 61  SPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDS 120
           +PLV++A SIAQ A SLHELKSL+ SFHDC L +TS STICATQ  G+DLMIIGYTPSDS
Sbjct: 59  NPLVEKAYSIAQNARSLHELKSLISSFHDCALQNTSSSTICATQEGGKDLMIIGYTPSDS 118

Query: 121 DNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMR 180
           DNI+G PFSGKTG++LDKMLQSI +MR Q H SMISPWHPPGNR LS IEMEICRP+IM+
Sbjct: 119 DNINGNPFSGKTGDILDKMLQSIGVMRIQTHTSMISPWHPPGNRQLSKIEMEICRPLIMK 178

Query: 181 QIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQY 240
           QIEL+SP+IL F+GNKT NFFFNND +  YQNLGKW  +   +  IPTL+TVHPQEL+QY
Sbjct: 179 QIELVSPRILFFLGNKTINFFFNNDDKANYQNLGKWHKIQVQNRTIPTLSTVHPQELMQY 238

Query: 241 PLIKKNTWHALITLKKALKN 260
           PLIKK  WH LITLKKALKN
Sbjct: 239 PLIKKTAWHTLITLKKALKN 258


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|116251217|ref|YP_767055.1| uracil-DNA glycosylase [Rhizobium leguminosarum bv. viciae 3841] Length = 299 Back     alignment and organism information
>gi|209548539|ref|YP_002280456.1| phage SPO1 DNA polymerase-related protein [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 299 Back     alignment and organism information
>gi|218682587|ref|ZP_03530188.1| phage SPO1 DNA polymerase-related protein [Rhizobium etli CIAT 894] Length = 299 Back     alignment and organism information
>gi|327193963|gb|EGE60838.1| putative DNA-directed DNA polymerase protein (uracil-DNA glycosylase) [Rhizobium etli CNPAF512] Length = 296 Back     alignment and organism information
>gi|190891014|ref|YP_001977556.1| DNA-directed DNA polymerase (uracil-DNA glycosylase) [Rhizobium etli CIAT 652] Length = 296 Back     alignment and organism information
>gi|218675319|ref|ZP_03524988.1| probable DNA-directed DNA polymerase protein (uracil-DNA glycosylase) [Rhizobium etli GR56] Length = 296 Back     alignment and organism information
>gi|86356942|ref|YP_468834.1| DNA polymerase bacteriophage-type (uracil-DNA glycosylase) protein [Rhizobium etli CFN 42] Length = 297 Back     alignment and organism information
>gi|241203823|ref|YP_002974919.1| phage SPO1 DNA polymerase-related protein [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 299 Back     alignment and organism information
>gi|15888330|ref|NP_354011.1| DNA polymerase [Agrobacterium tumefaciens str. C58] Length = 296 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target261 putative uracil-DNA glycosylase [Candidatus Liberibacte
TIGR00758173 TIGR00758, UDG_fam4, uracil-DNA glycosylase, family 4 1e-22
pfam03167147 pfam03167, UDG, Uracil DNA glycosylase superfamily 3e-20
COG1573202 COG1573, COG1573, Uracil-DNA glycosylase [DNA replicati 2e-22
>gnl|CDD|129841 TIGR00758, UDG_fam4, uracil-DNA glycosylase, family 4 Back     alignment and domain information
>gnl|CDD|146005 pfam03167, UDG, Uracil DNA glycosylase superfamily Back     alignment and domain information
>gnl|CDD|31761 COG1573, COG1573, Uracil-DNA glycosylase [DNA replication, recombination, and repair] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 261 putative uracil-DNA glycosylase [Candidatus Liberibacte
TIGR00758185 UDG_fam4 uracil-DNA glycosylase, family 4; InterPro: IP 100.0
COG1573202 Uracil-DNA glycosylase [DNA replication, recombination, 100.0
pfam03167147 UDG Uracil DNA glycosylase superfamily. 100.0
PRK10201168 G/U mismatch-specific DNA glycosylase; Provisional 98.67
KOG4120 426 consensus 97.19
COG3663169 Mug G:T/U mismatch-specific DNA glycosylase [DNA replic 93.64
TIGR00584347 mug mismatch-specific thymine-DNA glycosylate (mug); In 94.44
>TIGR00758 UDG_fam4 uracil-DNA glycosylase, family 4; InterPro: IPR005273 This well-conserved family of proteins is about 200 residues in length and homologous to the N-terminus of the DNA polymerase of phage SPO1 of Bacillus subtilis Back     alignment and domain information
>COG1573 Uracil-DNA glycosylase [DNA replication, recombination, and repair] Back     alignment and domain information
>pfam03167 UDG Uracil DNA glycosylase superfamily Back     alignment and domain information
>PRK10201 G/U mismatch-specific DNA glycosylase; Provisional Back     alignment and domain information
>KOG4120 consensus Back     alignment and domain information
>COG3663 Mug G:T/U mismatch-specific DNA glycosylase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00584 mug mismatch-specific thymine-DNA glycosylate (mug); InterPro: IPR003310 G:U mismatches resulting from deamination of cytosine are the most common promutagenic lesions occurring in DNA Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target261 putative uracil-DNA glycosylase [Candidatus Liberibacte
1ui0_A205 Crystal Structure Of Uracil-Dna Glycosylase From Th 2e-43
1ui1_A205 Crystal Structure Of Uracil-Dna Glycosylase From Th 7e-42
1vk2_A204 Crystal Structure Of Uracil-Dna Glycosylase (Tm0511 5e-38
1l9g_A192 Crystal Structure Of Uracil-Dna Glycosylase From T. 5e-38
2d3y_A219 Crystal Structure Of Uracil-Dna Glycosylase From Th 3e-09
3ikb_A198 The Structure Of A Conserved Protein From Streptoco 3e-04
gi|38493048|pdb|1UI0|A Chain A, Crystal Structure Of Uracil-Dna Glycosylase From Thermus Thermophilus Hb8 Length = 205 Back     alignment and structure
 Score =  180 bits (456), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 53/192 (27%), Positives = 90/192 (46%), Gaps = 11/192 (5%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           +L  L++  ++   C L       +         LMI+G  P + ++ +G+PF GK G +
Sbjct: 2   TLELLQAQAQNCTACRLMEGRTRVVFGEGNPDAKLMIVGEGPGEEEDKTGRPFVGKAGQL 61

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEIC-RPIIMRQIELISPKILLFIG 194
           L+++L++  I R +++I+ I    PP NR     E +IC    +++QIELI+P+I++ +G
Sbjct: 62  LNRILEAAGIPREEVYITNIVKCRPPQNRAPLPDEAKICTDKWLLKQIELIAPQIIVPLG 121

Query: 195 NKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYPLI-----KKNTWH 249
                FF         +  GKW         I      HP  L++ P       K  TW 
Sbjct: 122 AVAAEFFLGEK-VSITKVRGKWYEW----HGIKVFPMFHPAYLLRNPSRAPGSPKHLTWL 176

Query: 250 ALITLKKALKNL 261
            +  +K+AL  L
Sbjct: 177 DIQEVKRALDAL 188


>gi|38493049|pdb|1UI1|A Chain A, Crystal Structure Of Uracil-Dna Glycosylase From Thermus Thermophilus Hb8 Length = 205 Back     alignment and structure
>gi|48425936|pdb|1VK2|A Chain A, Crystal Structure Of Uracil-Dna Glycosylase (Tm0511) From Thermotoga Maritima At 1.90 A Resolution Length = 204 Back     alignment and structure
gi|31615491|pdb|1L9G|A Chain A, Crystal Structure Of Uracil-Dna Glycosylase From T. Maritima Length = 192 Back     alignment and structure
gi|118137482|pdb|2D3Y|A Chain A, Crystal Structure Of Uracil-Dna Glycosylase From Thermus Thermophilus Hb8 Length = 219 Back     alignment and structure
>gi|256032916|pdb|3IKB|A Chain A, The Structure Of A Conserved Protein From Streptococcus Mutans Ua159. Length = 198 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target261 putative uracil-DNA glycosylase [Candidatus Liberibacte
1vk2_A204 Uracil-DNA glycosylase TM0511; structural genomics, JCS 9e-18
1ui0_A205 Uracil-DNA glycosylase; base excision repair, iron/sulf 1e-17
3ikb_A198 Uncharacterized conserved protein; APC63946, streptococ 4e-17
2c2q_A199 G/U mismatch-specific DNA glycosylase; radiation resist 5e-10
1wyw_A230 TDG, G/T mismatch-specific thymine DNA glycosylase; hyd 1e-13
1mug_A168 Protein (G:T/U specific DNA glycosylase); hydrolase; 1. 1e-13
2d3y_A219 Uracil-DNA glycosylase; base excision repair, iron/sulf 3e-08
>1vk2_A Uracil-DNA glycosylase TM0511; structural genomics, JCSG, PSI, protein structure initiative, joint center for structural genomics, hydrolase; 1.90A {Thermotoga maritima} SCOP: c.18.1.2 PDB: 1l9g_A Length = 204 Back     alignment and structure
 Score = 85.8 bits (211), Expect = 9e-18
 Identities = 35/194 (18%), Positives = 80/194 (41%), Gaps = 5/194 (2%)

Query: 70  IAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFS 129
           +  +   +  +   ++    C L     + +         ++ +G  P + ++ +G+PF 
Sbjct: 13  MYTREELMEIVSERVKKCTACPLHLNRTNVVVGEGNLDTRIVFVGEGPGEEEDKTGRPFV 72

Query: 130 GKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKI 189
           G+ G +L ++L+   I R  ++I  +    PP NR  +  E   C   ++ QIE+I+P +
Sbjct: 73  GRAGMLLTELLRESGIRREDVYICNVVKCRPPNNRTPTPEEQAACGHFLLAQIEIINPDV 132

Query: 190 LLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYP--LIKKNT 247
           ++ +G    +FF +       +  G   +          + T HP  L++     +++  
Sbjct: 133 IVALGATALSFFVDGKKVSITKVRGNPIDW---LGGKKVIPTFHPSYLLRNRSNELRRIV 189

Query: 248 WHALITLKKALKNL 261
              +   K  +K  
Sbjct: 190 LEDIEKAKSFIKKE 203


>1ui0_A Uracil-DNA glycosylase; base excision repair, iron/sulfer cluster, thermophIle, riken structural genomics/proteomics initiative, RSGI; 1.50A {Thermus thermophilus} SCOP: c.18.1.2 PDB: 1ui1_A Length = 205 Back     alignment and structure
>3ikb_A Uncharacterized conserved protein; APC63946, streptococcus mutans UA159, structural genomics, PSI-2, protein structure initiative; HET: FLC; 1.67A {Streptococcus mutans} Length = 198 Back     alignment and structure
>2c2q_A G/U mismatch-specific DNA glycosylase; radiation resistance, DNA repair enzymes, uracil-DNA glycosylase, MUG, hydrolase; 1.7A {Deinococcus radiodurans} PDB: 2c2p_A Length = 199 Back     alignment and structure
>1wyw_A TDG, G/T mismatch-specific thymine DNA glycosylase; hydrolase; 2.10A {Homo sapiens} SCOP: c.18.1.2 PDB: 2d07_A 2rba_A* Length = 230 Back     alignment and structure
>1mug_A Protein (G:T/U specific DNA glycosylase); hydrolase; 1.80A {Escherichia coli} SCOP: c.18.1.2 PDB: 1mtl_A 1mwi_A* 1mwj_A Length = 168 Back     alignment and structure
>2d3y_A Uracil-DNA glycosylase; base excision repair, iron/sulfer cluster, thermophIle, structural genomics, NPPSFA; HET: DU; 1.55A {Thermus thermophilus HB8} PDB: 2ddg_A* 2dem_A* 2dp6_A* Length = 219 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target261 putative uracil-DNA glycosylase [Candidatus Liberibacte
1ui0_A205 Uracil-DNA glycosylase; base excision repair, iron/sulf 100.0
1vk2_A204 Uracil-DNA glycosylase TM0511; structural genomics, JCS 100.0
2d3y_A219 Uracil-DNA glycosylase; base excision repair, iron/sulf 100.0
3ikb_A198 Uncharacterized conserved protein; APC63946, streptococ 100.0
2c2q_A199 G/U mismatch-specific DNA glycosylase; radiation resist 99.96
1wyw_A230 TDG, G/T mismatch-specific thymine DNA glycosylase; hyd 99.92
2l3f_A166 Uncharacterized protein; structural genomics, northeast 96.15
1mug_A168 Protein (G:T/U specific DNA glycosylase); hydrolase; 1. 99.95
1oe4_A247 SMUG1, single-strand selective monofunctional uracil DN 98.85
>1ui0_A Uracil-DNA glycosylase; base excision repair, iron/sulfer cluster, thermophIle, riken structural genomics/proteomics initiative, RSGI; 1.50A {Thermus thermophilus} SCOP: c.18.1.2 PDB: 1ui1_A Back     alignment and structure
Probab=100.00  E-value=0  Score=372.81  Aligned_cols=181  Identities=29%  Similarity=0.552  Sum_probs=174.4

Q ss_pred             CHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCEEEE
Q ss_conf             98999999960038852002877223678888848998578983001120012070048999999860986222100000
Q gi|254780743|r   76 SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMI  155 (261)
Q Consensus        76 ~l~~L~~~~~~~~~C~L~~~~~~~v~g~G~~~a~imiVgeaPg~~Ed~~G~pF~G~aG~lL~~mL~aigl~r~~vyitn~  155 (261)
                      ++++|+..+.+|+.|+|+++++++|+|.|+++|+||||||+||.+|+++|+||+|++|++|++||+++|+++++||+||+
T Consensus         2 ~l~~L~~~i~~C~~C~L~~~~~~~V~g~G~~~a~imiVg~aPg~~e~~~g~pf~G~aG~lL~~~L~~~gl~~~~vyitn~   81 (205)
T 1ui0_A            2 TLELLQAQAQNCTACRLMEGRTRVVFGEGNPDAKLMIVGEGPGEEEDKTGRPFVGKAGQLLNRILEAAGIPREEVYITNI   81 (205)
T ss_dssp             CHHHHHHHHTTCCSSGGGTTCSSCCCCEECTTCSEEEEESCCCHHHHHHSCSSCSHHHHHHHHHHHHHTCCGGGSEEEES
T ss_pred             CHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCEEEEECCCCHHHHHCCCCCCCCHHHHHHHHHHHCCCCHHHEEEECC
T ss_conf             88999999867888999889978554789999999999588760776208864675788999999983999899886600


Q ss_pred             EECCCCCCCCCCHHHHHHHH-HHHHHHHHHCCCCEEEEECHHHHHHHHCCCCCCCHHCCCEEEEEECCCCCEEEEEEECH
Q ss_conf             00122566667788999999-99999863229767995255999998446533101106505766428973789997080
Q gi|254780743|r  156 SPWHPPGNRNLSNIEMEICR-PIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHP  234 (261)
Q Consensus       156 vkcrPp~nr~p~~~ei~~c~-p~L~~ei~li~Pk~ii~lG~~a~~~ll~~~~~~i~~~rG~~~~~~~~~~~i~~~pt~HP  234 (261)
                      |||+|++++.|+..|++.|+ +||.+||++++|++||+||++|++++++.. ..+.+.||+||++    .++++||||||
T Consensus        82 vkc~p~~~~~~~~~ei~~C~~p~L~~ei~li~Pkiii~lG~~a~~~~l~~~-~~~~~~rG~~~~~----~~~~~~~tyHP  156 (205)
T 1ui0_A           82 VKCRPPQNRAPLPDEAKICTDKWLLKQIELIAPQIIVPLGAVAAEFFLGEK-VSITKVRGKWYEW----HGIKVFPMFHP  156 (205)
T ss_dssp             CSSCCGGGCCCCHHHHHHHHHHTHHHHHHHHCCSEEEEBSHHHHHHHHTSC-CCHHHHTTCCEEE----TTEEECCBCCH
T ss_pred             EEECCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCEEEEHHHHHHHHHHCCC-CCCCCCCCCEEEE----CCCEEEEECCC
T ss_conf             401377678998699999999999999985488367330899999986125-4412224713873----89669998597


Q ss_pred             HHHHCCHHH-----HHHHHHHHHHHHHHHHCC
Q ss_conf             388336598-----999999999999998609
Q gi|254780743|r  235 QELIQYPLI-----KKNTWHALITLKKALKNL  261 (261)
Q Consensus       235 s~LLr~P~~-----K~~aW~DL~~l~~~L~~l  261 (261)
                      |||+|||+.     |+.+|+||++++++|++|
T Consensus       157 s~LlrnP~~~~~~~K~~~w~Dl~~lk~~L~~l  188 (205)
T 1ui0_A          157 AYLLRNPSRAPGSPKHLTWLDIQEVKRALDAL  188 (205)
T ss_dssp             HHHHHSCCCSTTCHHHHHHHHHHHHHHHHHHC
T ss_pred             HHHHHCCCCCCHHHHHHHHHHHHHHHHHHHCC
T ss_conf             68865935343046889999999999999827



>1vk2_A Uracil-DNA glycosylase TM0511; structural genomics, JCSG, PSI, protein structure initiative, joint center for structural genomics, hydrolase; 1.90A {Thermotoga maritima} SCOP: c.18.1.2 PDB: 1l9g_A Back     alignment and structure
>2d3y_A Uracil-DNA glycosylase; base excision repair, iron/sulfer cluster, thermophIle, structural genomics, NPPSFA; HET: DU; 1.55A {Thermus thermophilus HB8} PDB: 2ddg_A* 2dem_A* 2dp6_A* Back     alignment and structure
>3ikb_A Uncharacterized conserved protein; APC63946, streptococcus mutans UA159, structural genomics, PSI-2, protein structure initiative; HET: FLC; 1.67A {Streptococcus mutans} Back     alignment and structure
>2c2q_A G/U mismatch-specific DNA glycosylase; radiation resistance, DNA repair enzymes, uracil-DNA glycosylase, MUG, hydrolase; 1.7A {Deinococcus radiodurans} PDB: 2c2p_A Back     alignment and structure
>1wyw_A TDG, G/T mismatch-specific thymine DNA glycosylase; hydrolase; 2.10A {Homo sapiens} SCOP: c.18.1.2 PDB: 2d07_A 2rba_A* Back     alignment and structure
>2l3f_A Uncharacterized protein; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Methanosarcina acetivorans} Back     alignment and structure
>1mug_A Protein (G:T/U specific DNA glycosylase); hydrolase; 1.80A {Escherichia coli} SCOP: c.18.1.2 PDB: 1mtl_A 1mwi_A* 1mwj_A Back     alignment and structure
>1oe4_A SMUG1, single-strand selective monofunctional uracil DNA glycosylase; hydrolase, hydrolase/complex, SMUG1; HET: 3DR; 2.0A {Xenopus laevis} SCOP: c.18.1.3 PDB: 1oe5_A* 1oe6_A* Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 261 putative uracil-DNA glycosylase [Candidatus Liberibacte
d1ui0a_192 c.18.1.2 (A:) Thermophilic uracil-DNA glycosylase {Ther 6e-16
d1vk2a_191 c.18.1.2 (A:) Thermophilic uracil-DNA glycosylase {Ther 7e-15
d1muga_165 c.18.1.2 (A:) G:T/U mismatch-specific DNA glycosylase, 4e-14
>d1ui0a_ c.18.1.2 (A:) Thermophilic uracil-DNA glycosylase {Thermus thermophilus [TaxId: 274]} Length = 192 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Uracil-DNA glycosylase-like
superfamily: Uracil-DNA glycosylase-like
family: Mug-like
domain: Thermophilic uracil-DNA glycosylase
species: Thermus thermophilus [TaxId: 274]
 Score = 78.3 bits (192), Expect = 6e-16
 Identities = 54/192 (28%), Positives = 90/192 (46%), Gaps = 11/192 (5%)

Query: 76  SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNM 135
           +L  L++  ++   C L       +         LMI+G  P + ++ +G+PF GK G +
Sbjct: 1   TLELLQAQAQNCTACRLMEGRTRVVFGEGNPDAKLMIVGEGPGEEEDKTGRPFVGKAGQL 60

Query: 136 LDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICR-PIIMRQIELISPKILLFIG 194
           L+++L++  I R +++I+ I    PP NR     E +IC    +++QIELI+P+I++ +G
Sbjct: 61  LNRILEAAGIPREEVYITNIVKCRPPQNRAPLPDEAKICTDKWLLKQIELIAPQIIVPLG 120

Query: 195 NKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQYP-----LIKKNTWH 249
                FF       T    GKW         I      HP  L++ P       K  TW 
Sbjct: 121 AVAAEFFLGEKVSITKVR-GKWYEWHG----IKVFPMFHPAYLLRNPSRAPGSPKHLTWL 175

Query: 250 ALITLKKALKNL 261
            +  +K+AL  L
Sbjct: 176 DIQEVKRALDAL 187


>d1vk2a_ c.18.1.2 (A:) Thermophilic uracil-DNA glycosylase {Thermotoga maritima [TaxId: 2336]} Length = 191 Back     information, alignment and structure
>d1muga_ c.18.1.2 (A:) G:T/U mismatch-specific DNA glycosylase, Mug {Escherichia coli [TaxId: 562]} Length = 165 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target261 putative uracil-DNA glycosylase [Candidatus Liberibacte
d1ui0a_192 Thermophilic uracil-DNA glycosylase {Thermus thermophil 100.0
d1vk2a_191 Thermophilic uracil-DNA glycosylase {Thermotoga maritim 100.0
d1muga_165 G:T/U mismatch-specific DNA glycosylase, Mug {Escherich 99.95
d1oe4a_245 Single-strand selective monofunctional uracil-DNA glyco 98.93
>d1ui0a_ c.18.1.2 (A:) Thermophilic uracil-DNA glycosylase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Uracil-DNA glycosylase-like
superfamily: Uracil-DNA glycosylase-like
family: Mug-like
domain: Thermophilic uracil-DNA glycosylase
species: Thermus thermophilus [TaxId: 274]
Probab=100.00  E-value=0  Score=370.85  Aligned_cols=181  Identities=29%  Similarity=0.552  Sum_probs=174.3

Q ss_pred             CHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCEEEE
Q ss_conf             98999999960038852002877223678888848998578983001120012070048999999860986222100000
Q gi|254780743|r   76 SLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMI  155 (261)
Q Consensus        76 ~l~~L~~~~~~~~~C~L~~~~~~~v~g~G~~~a~imiVgeaPg~~Ed~~G~pF~G~aG~lL~~mL~aigl~r~~vyitn~  155 (261)
                      +|++|+..+.+|+.|+|+++++++|+|.|+.+|+||||||+||.+|+++|+||+|++|++|++||.++||++++|||||+
T Consensus         1 tl~~L~~~i~~C~~C~L~~~~~~~V~g~G~~~a~imiVgeaPg~~e~~~g~pf~G~aG~lL~~~l~~~gl~~~~vyitn~   80 (192)
T d1ui0a_           1 TLELLQAQAQNCTACRLMEGRTRVVFGEGNPDAKLMIVGEGPGEEEDKTGRPFVGKAGQLLNRILEAAGIPREEVYITNI   80 (192)
T ss_dssp             CHHHHHHHHTTCCSSGGGTTCSSCCCCEECTTCSEEEEESCCCHHHHHHSCSSCSHHHHHHHHHHHHHTCCGGGSEEEES
T ss_pred             CHHHHHHHHHCCCCCCCCCCCCCCEECCCCCCCCEEEEECHHHHHHHHHHHHHCCCHHHHHHHHHHHHCCCHHHEEEEEE
T ss_conf             98999999866888989889988471789999889999632455566453010022688999999971888889688602


Q ss_pred             EECCCCCCCCCCHHHHHHHH-HHHHHHHHHCCCCEEEEECHHHHHHHHCCCCCCCHHCCCEEEEEECCCCCEEEEEEECH
Q ss_conf             00122566667788999999-99999863229767995255999998446533101106505766428973789997080
Q gi|254780743|r  156 SPWHPPGNRNLSNIEMEICR-PIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHP  234 (261)
Q Consensus       156 vkcrPp~nr~p~~~ei~~c~-p~L~~ei~li~Pk~ii~lG~~a~~~ll~~~~~~i~~~rG~~~~~~~~~~~i~~~pt~HP  234 (261)
                      +||+||+++.|+..|+++|+ +||.+||++++|++||+||++|.+++++.. ..+.+.||+||++    .+++++|||||
T Consensus        81 vkc~p~~~~~~~~~e~~~C~~~~L~~ei~li~P~iii~lG~~a~~~~l~~~-~~~~~~rG~~~~~----~~~~~~~t~HP  155 (192)
T d1ui0a_          81 VKCRPPQNRAPLPDEAKICTDKWLLKQIELIAPQIIVPLGAVAAEFFLGEK-VSITKVRGKWYEW----HGIKVFPMFHP  155 (192)
T ss_dssp             CSSCCGGGCCCCHHHHHHHHHHTHHHHHHHHCCSEEEEBSHHHHHHHHTSC-CCHHHHTTCCEEE----TTEEECCBCCH
T ss_pred             EEECCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEECCCEEEEEECCCC-CCCHHCCCCEEEC----CCCEEEEECCC
T ss_conf             657134455678179999999999999974306599951310123320113-5301005825871----89779998094


Q ss_pred             HHHHCCHHH-----HHHHHHHHHHHHHHHHCC
Q ss_conf             388336598-----999999999999998609
Q gi|254780743|r  235 QELIQYPLI-----KKNTWHALITLKKALKNL  261 (261)
Q Consensus       235 s~LLr~P~~-----K~~aW~DL~~l~~~L~~l  261 (261)
                      |||+|||+.     |+.+|+||+++|++|++|
T Consensus       156 s~llrnp~~~~~~~K~~~w~DL~~ik~~L~~l  187 (192)
T d1ui0a_         156 AYLLRNPSRAPGSPKHLTWLDIQEVKRALDAL  187 (192)
T ss_dssp             HHHHHSCCCSTTCHHHHHHHHHHHHHHHHHHC
T ss_pred             HHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHC
T ss_conf             78766914223045789999999999999833



>d1vk2a_ c.18.1.2 (A:) Thermophilic uracil-DNA glycosylase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1muga_ c.18.1.2 (A:) G:T/U mismatch-specific DNA glycosylase, Mug {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oe4a_ c.18.1.3 (A:) Single-strand selective monofunctional uracil-DNA glycosylase SMUG1 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 261 putative uracil-DNA glycosylase [Candidatus Liberi
1vk2_A_204 (A:) Uracil-DNA glycosylase TM0511; structural gen 2e-29
1ui0_A_205 (A:) Uracil-DNA glycosylase; base excision repair, 5e-25
1oe4_A_247 (A:) SMUG1, single-strand selective monofunctional 2e-21
2d3y_A_219 (A:) Uracil-DNA glycosylase; base excision repair, 6e-20
1wyw_A_1-199199 (A:1-199) TDG, G/T mismatch-specific thymine DNA g 6e-19
2c2q_A_199 (A:) G/U mismatch-specific DNA glycosylase; radiat 2e-14
3ikb_A_34-198165 (A:34-198) Uncharacterized conserved protein; APC6 4e-20
1mug_A_168 (A:) Protein (G:T/U specific DNA glycosylase); hyd 9e-16
>1vk2_A (A:) Uracil-DNA glycosylase TM0511; structural genomics, JCSG, PSI, protein structure initiative, joint center for structural genomics, hydrolase; 1.90A {Thermotoga maritima}Length = 204 Back     alignment and structure
 Score =  123 bits (310), Expect = 2e-29
 Identities = 35/204 (17%), Positives = 78/204 (38%), Gaps = 5/204 (2%)

Query: 60  HSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSD 119
              +         +      +   ++    C L     + +         ++ +G  P +
Sbjct: 3   SDKIHHHHHHXYTREELXEIVSERVKKCTACPLHLNRTNVVVGEGNLDTRIVFVGEGPGE 62

Query: 120 SDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSNIEMEICRPIIM 179
            ++ +G+PF G+ G +L ++L+   I R  ++I  +    PP NR  +  E   C   ++
Sbjct: 63  EEDKTGRPFVGRAGXLLTELLRESGIRREDVYICNVVKCRPPNNRTPTPEEQAACGHFLL 122

Query: 180 RQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVHPQELIQ 239
            QIE+I+P +++ +G    +FF +       +  G   +          + T HP  L++
Sbjct: 123 AQIEIINPDVIVALGATALSFFVDGKKVSITKVRGNPIDWLGG---KKVIPTFHPSYLLR 179

Query: 240 YPLI--KKNTWHALITLKKALKNL 261
                 ++     +   K  +K  
Sbjct: 180 NRSNELRRIVLEDIEKAKSFIKKE 203


>1ui0_A (A:) Uracil-DNA glycosylase; base excision repair, iron/sulfer cluster, thermophIle, riken structural genomics/proteomics initiative, RSGI; 1.50A {Thermus thermophilus}Length = 205 Back     alignment and structure
>1oe4_A (A:) SMUG1, single-strand selective monofunctional uracil DNA glycosylase; hydrolase, hydrolase/complex, SMUG1; HET: 3DR; 2.0A {Xenopus laevis}Length = 247 Back     alignment and structure
>2d3y_A (A:) Uracil-DNA glycosylase; base excision repair, iron/sulfer cluster, thermophIle, structural genomics, NPPSFA; HET: DU; 1.55A {Thermus thermophilus HB8} PDB: 2ddg_A* 2dem_A* 2dp6_A*Length = 219 Back     alignment and structure
>1wyw_A (A:1-199) TDG, G/T mismatch-specific thymine DNA glycosylase; hydrolase; 2.10A {Homo sapiens}Length = 199 Back     alignment and structure
>2c2q_A (A:) G/U mismatch-specific DNA glycosylase; radiation resistance, DNA repair enzymes, uracil-DNA glycosylase, MUG, hydrolase; 1.7A {Deinococcus radiodurans} PDB: 2c2p_ALength = 199 Back     alignment and structure
>3ikb_A (A:34-198) Uncharacterized conserved protein; APC63946, streptococcus mutans UA159, structural genomics, PSI-2, protein structure initiative; HET: FLC; 1.67A {Streptococcus mutans}Length = 165 Back     alignment and structure
>1mug_A (A:) Protein (G:T/U specific DNA glycosylase); hydrolase; 1.80A {Escherichia coli}Length = 168 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target261 putative uracil-DNA glycosylase [Candidatus Liberibacte
1ui0_A_205 Uracil-DNA glycosylase; base excision repair, iron 100.0
1vk2_A_204 Uracil-DNA glycosylase TM0511; structural genomics 100.0
2d3y_A_219 Uracil-DNA glycosylase; base excision repair, iron 100.0
1wyw_A_1-199199 TDG, G/T mismatch-specific thymine DNA glycosylase 100.0
1oe4_A_247 SMUG1, single-strand selective monofunctional urac 100.0
2c2q_A_199 G/U mismatch-specific DNA glycosylase; radiation r 100.0
1mug_A_168 Protein (G:T/U specific DNA glycosylase); hydrolas 100.0
3ikb_A_34-198165 Uncharacterized conserved protein; APC63946, strep 100.0
3fci_A_223 UDG, uracil-DNA glycosylase; DNA repair, alternati 93.57
2j8x_A_48-231184 Uracil-DNA glycosylase; hydrolase/inhibitor, hydro 93.33
4eug_A_45-229185 UDG, UNG, protein (glycosylase); 1.40A {Escherichi 90.66
>1ui0_A (A:) Uracil-DNA glycosylase; base excision repair, iron/sulfer cluster, thermophIle, riken structural genomics/proteomics initiative, RSGI; 1.50A {Thermus thermophilus} Back     alignment and structure
Probab=100.00  E-value=0  Score=315.64  Aligned_cols=182  Identities=29%  Similarity=0.530  Sum_probs=173.5

Q ss_pred             CCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCEEE
Q ss_conf             99899999996003885200287722367888884899857898300112001207004899999986098622210000
Q gi|254780743|r   75 CSLHELKSLLRSFHDCHLCSTSLSTICATQTEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISM  154 (261)
Q Consensus        75 ~~l~~L~~~~~~~~~C~L~~~~~~~v~g~G~~~a~imiVgeaPg~~Ed~~G~pF~G~aG~lL~~mL~aigl~r~~vyitn  154 (261)
                      .+|++|++.+.+|..|+++..+.++|+|.|+++|+|||||++||.+|+++|.||+|++|++|++||.++||++++||+||
T Consensus         1 ~~l~~L~~~i~~C~~C~~~~~~~~~v~~~g~~~a~iliIg~~P~~~~~~~G~~f~g~aG~~L~~~l~~~gl~~~~vyit~   80 (205)
T 1ui0_A            1 MTLELLQAQAQNCTACRLMEGRTRVVFGEGNPDAKLMIVGEGPGEEEDKTGRPFVGKAGQLLNRILEAAGIPREEVYITN   80 (205)
T ss_dssp             -CHHHHHHHHTTCCSSGGGTTCSSCCCCEECTTCSEEEEESCCCHHHHHHSCSSCSHHHHHHHHHHHHHTCCGGGSEEEE
T ss_pred             CCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCEEEEECCHHHHHHHHHHCCCCCHHHHHHHHHHHHCCCHHHEEEEE
T ss_conf             98899999986688898987898855578999999999978214544444411153504368888998398899958861


Q ss_pred             EEECCCCCCCCCCHHHHHHHHH-HHHHHHHHCCCCEEEEECHHHHHHHHCCCCCCCHHCCCEEEEEECCCCCEEEEEEEC
Q ss_conf             0001225666677889999999-999986322976799525599999844653310110650576642897378999708
Q gi|254780743|r  155 ISPWHPPGNRNLSNIEMEICRP-IIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSIIPTLATVH  233 (261)
Q Consensus       155 ~vkcrPp~nr~p~~~ei~~c~p-~L~~ei~li~Pk~ii~lG~~a~~~ll~~~~~~i~~~rG~~~~~~~~~~~i~~~pt~H  233 (261)
                      ++||+|++|+.|+..|+..|++ ||.+||++++|++||++|+.|.+++++.. .++.+.+|+|+++    .+++++++||
T Consensus        81 lvkc~p~~~~~~~~~ei~~c~~~~L~~ei~l~~P~~ii~lG~~a~~~ll~~~-~~~~~~~g~~~~~----~~~~~~~~~h  155 (205)
T 1ui0_A           81 IVKCRPPQNRAPLPDEAKICTDKWLLKQIELIAPQIIVPLGAVAAEFFLGEK-VSITKVRGKWYEW----HGIKVFPMFH  155 (205)
T ss_dssp             SCSSCCGGGCCCCHHHHHHHHHHTHHHHHHHHCCSEEEEBSHHHHHHHHTSC-CCHHHHTTCCEEE----TTEEECCBCC
T ss_pred             EEEECCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCEEEECCCHHEEHHHHCC-CCHHHHCCCEEEC----CCCEEEEECC
T ss_conf             4646033456798599999999999999985488489952501000113103-5201214834862----8977999828


Q ss_pred             HHHHHCC-----HHHHHHHHHHHHHHHHHHHCC
Q ss_conf             0388336-----598999999999999998609
Q gi|254780743|r  234 PQELIQY-----PLIKKNTWHALITLKKALKNL  261 (261)
Q Consensus       234 Ps~LLr~-----P~~K~~aW~DL~~l~~~L~~l  261 (261)
                      ||+|++|     |+.|+.+|+||+.+++.|+++
T Consensus       156 PS~l~~~~~~~~p~~~~~~~~~L~~~~~~l~~~  188 (205)
T 1ui0_A          156 PAYLLRNPSRAPGSPKHLTWLDIQEVKRALDAL  188 (205)
T ss_dssp             HHHHHHSCCCSTTCHHHHHHHHHHHHHHHHHHC
T ss_pred             CHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHCC
T ss_conf             689876925343046789999999999999726



>1vk2_A (A:) Uracil-DNA glycosylase TM0511; structural genomics, JCSG, PSI, protein structure initiative, joint center for structural genomics, hydrolase; 1.90A {Thermotoga maritima} Back     alignment and structure
>2d3y_A (A:) Uracil-DNA glycosylase; base excision repair, iron/sulfer cluster, thermophIle, structural genomics, NPPSFA; HET: DU; 1.55A {Thermus thermophilus HB8} PDB: 2ddg_A* 2dem_A* 2dp6_A* Back     alignment and structure
>1wyw_A (A:1-199) TDG, G/T mismatch-specific thymine DNA glycosylase; hydrolase; 2.10A {Homo sapiens} Back     alignment and structure
>1oe4_A (A:) SMUG1, single-strand selective monofunctional uracil DNA glycosylase; hydrolase, hydrolase/complex, SMUG1; HET: 3DR; 2.0A {Xenopus laevis} Back     alignment and structure
>2c2q_A (A:) G/U mismatch-specific DNA glycosylase; radiation resistance, DNA repair enzymes, uracil-DNA glycosylase, MUG, hydrolase; 1.7A {Deinococcus radiodurans} PDB: 2c2p_A Back     alignment and structure
>1mug_A (A:) Protein (G:T/U specific DNA glycosylase); hydrolase; 1.80A {Escherichia coli} Back     alignment and structure
>3ikb_A (A:34-198) Uncharacterized conserved protein; APC63946, streptococcus mutans UA159, structural genomics, PSI-2, protein structure initiative; HET: FLC; 1.67A {Streptococcus mutans} Back     alignment and structure
>3fci_A (A:) UDG, uracil-DNA glycosylase; DNA repair, alternative splicing, disease mutation, DNA damage, glycosidase, HOST- virus interaction, hydrolase; HET: 3FI; 1.27A {Homo sapiens} PDB: 1emh_A* 1emj_A* 1q3f_A* 1ssp_E* 1ugh_E 1akz_A* 2oxm_A* 2oyt_A* 3fcf_A* 2hxm_A* 3fck_B* 3fcl_A* 2ssp_E* 1yuo_A 4skn_E* 1okb_A Back     alignment and structure
>2j8x_A (A:48-231) Uracil-DNA glycosylase; hydrolase/inhibitor, hydrolase/inhibitor complex, EBV, DNA repair, lytic protein, epstein-BARR virus; 2.3A {Epstein-barr virus} Back     alignment and structure
>4eug_A (A:45-229) UDG, UNG, protein (glycosylase); 1.40A {Escherichia coli} Back     alignment and structure