254780785

254780785

30S ribosomal protein S15

GeneID in NCBI database:8209791Locus tag:CLIBASIA_03380
Protein GI in NCBI database:254780785Protein Accession:YP_003065198.1
Gene range:+(476758, 477027)Protein Length:89aa
Gene description:30S ribosomal protein S15
COG prediction:[J] Ribosomal protein S15P/S13E
KEGG prediction:rpsO; 30S ribosomal protein S15; K02956 small subunit ribosomal protein S15
SEED prediction:SSU ribosomal protein S15p (S13e)
Pathway involved in KEGG:Ribosome [PATH:las03010]
Subsystem involved in SEED:Ribosome SSU bacterial
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------9
MSITLERKRELMKEYAVSPGDTGSPEVQVAVCTERIANLTEHFKSAKKDVNSKIGLGRLISLRSSLLKYLERKDVERYKRLVQSLKLRR
ccccHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHcccc
ccccHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHcccc
MSITLERKRELMKEyavspgdtgspeVQVAVCTERIANLTEHFKSAKkdvnskiglGRLISLRSSLLKYLERKDVERYKRLVQSLKLRR
MSITLERKRELMKeyavspgdtgspeVQVAVCTERIANLTEHfksakkdvnskiglgrlISLRSSLlkylerkdverykrlvqslklrr
MSITLERKRELMKEYAVSPGDTGSPEVQVAVCTERIANLTEHFKSAKKDVNSKiglgrlislrssllKYLERKDVERYKRLVQSLKLRR
*****ERKRELMKEYAVSPGDTGSPEVQVAVCTERIANLTEHFKSAKKDVNSKIGLGRLISLRSSLLKYLERKDVERYKRLVQSLKLR*
MSITLERKRELMKEYAVSPGDTGSPEVQVAVCTERIANLTEHFKSAKKDVNSKIGLGRLISLRSSLLKYLERKDVERYKRLVQSLKLRR
**ITLERKRELMKEYAVSPGDTGSPEVQVAVCTERIANLTEHFKSAKKDVNSKIGLGRLISLRSSLLKYLERKDVERYKRLVQSLKLR*
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooo
ooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSITLERKRELMKEYAVSPGDTGSPEVQVAVCTERIANLTEHFKSAKKDVNSKIGLGRLISLRSSLLKYLERKDVERYKRLVQSLKLRR
MSITLERKRELMKEYAVSPGDTGSPEVQVAVCTERIANLTEHFKSAKKDVNSKIGLGRLISLRSSLLKYLERKDVERYKRLVQSLKLRR
MSITLERKRELMKEYAVSPGDTGSPEVQVAVCTERIANLTEHFKSAKKDVNSKIGLGRLISLRSSLLKYLERKDVERYKRLVQSLKLRR

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target89 30S ribosomal protein S15 [Candidatus Liberibacter asia
31512200789 30S ribosomal protein S15 [Candidatus Liberibacter sola 1 7e-34
32854591389 30S ribosomal protein S15 [polymorphum gilvum SL003B-26 1 8e-24
22214715289 30S ribosomal protein S15 [Agrobacterium vitis S4] Leng 1 1e-23
26046197689 ribosomal protein S15 [Mesorhizobium opportunistum WSM2 1 2e-23
8635577289 30S ribosomal protein S15 [Rhizobium etli CFN 42] Lengt 1 3e-23
9042052089 30S ribosomal protein S15 [Aurantimonas manganoxydans S 1 3e-23
1347463389 30S ribosomal protein S15 [Mesorhizobium loti MAFF30309 1 3e-23
8394501489 ribosomal protein S15 [Oceanicaulis alexandrii HTCC2633 1 6e-23
20955163489 30S ribosomal protein S15 [Rhizobium leguminosarum bv. 1 9e-23
11624988789 30S ribosomal protein S15 [Rhizobium leguminosarum bv. 1 1e-22
>gi|315122007|ref|YP_004062496.1| 30S ribosomal protein S15 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 89 Back     alignment and organism information
 Score =  146 bits (369), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 70/89 (78%), Positives = 83/89 (93%)

Query: 1  MSITLERKRELMKEYAVSPGDTGSPEVQVAVCTERIANLTEHFKSAKKDVNSKIGLGRLI 60
          MSITLERK +L+KEYA+SPGDTGSPEVQV +CTERIANLT HFK+AKKDVNSK+GL  LI
Sbjct: 1  MSITLERKGQLIKEYAISPGDTGSPEVQVVICTERIANLTIHFKNAKKDVNSKMGLNGLI 60

Query: 61 SLRSSLLKYLERKDVERYKRLVQSLKLRR 89
          SLR+SLLK+L+ KDV+RYK+L++SLKLRR
Sbjct: 61 SLRNSLLKHLKMKDVKRYKKLIESLKLRR 89


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|328545913|ref|YP_004306022.1| 30S ribosomal protein S15 [polymorphum gilvum SL003B-26A1] Length = 89 Back     alignment and organism information
>gi|222147152|ref|YP_002548109.1| 30S ribosomal protein S15 [Agrobacterium vitis S4] Length = 89 Back     alignment and organism information
>gi|260461976|ref|ZP_05810221.1| ribosomal protein S15 [Mesorhizobium opportunistum WSM2075] Length = 89 Back     alignment and organism information
>gi|86355772|ref|YP_467664.1| 30S ribosomal protein S15 [Rhizobium etli CFN 42] Length = 89 Back     alignment and organism information
>gi|90420520|ref|ZP_01228427.1| 30S ribosomal protein S15 [Aurantimonas manganoxydans SI85-9A1] Length = 89 Back     alignment and organism information
>gi|13474633|ref|NP_106202.1| 30S ribosomal protein S15 [Mesorhizobium loti MAFF303099] Length = 89 Back     alignment and organism information
>gi|83945014|ref|ZP_00957380.1| ribosomal protein S15 [Oceanicaulis alexandrii HTCC2633] Length = 89 Back     alignment and organism information
>gi|209551634|ref|YP_002283551.1| 30S ribosomal protein S15 [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 89 Back     alignment and organism information
>gi|116249887|ref|YP_765725.1| 30S ribosomal protein S15 [Rhizobium leguminosarum bv. viciae 3841] Length = 89 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target89 30S ribosomal protein S15 [Candidatus Liberibacter asia
PRK0562689 PRK05626, rpsO, 30S ribosomal protein S15; Reviewed 9e-30
TIGR0095286 TIGR00952, S15_bact, ribosomal protein S15, bacterial/o 4e-22
cd0035380 cd00353, Ribosomal_S15p_S13e, Ribosomal protein S15 (pr 5e-16
pfam0031283 pfam00312, Ribosomal_S15, Ribosomal protein S15 4e-14
CHL0002790 CHL00027, rps15, ribosomal protein S15 3e-10
PTZ00119 302 PTZ00119, PTZ00119, 40S ribosomal protein S15; Provisio 5e-08
KOG2815256 KOG2815, KOG2815, KOG2815, Mitochondrial/choloroplast r 1e-06
cd0067746 cd00677, S15_NS1_EPRS_RNA-bind, S15/NS1/EPRS_RNA-bindin 9e-05
COG018489 COG0184, RpsO, Ribosomal protein S15P/S13E [Translation 1e-20
>gnl|CDD|180170 PRK05626, rpsO, 30S ribosomal protein S15; Reviewed Back     alignment and domain information
>gnl|CDD|130027 TIGR00952, S15_bact, ribosomal protein S15, bacterial/organelle Back     alignment and domain information
>gnl|CDD|48353 cd00353, Ribosomal_S15p_S13e, Ribosomal protein S15 (prokaryotic)_S13 (eukaryotic) binds the central domain of 16S rRNA and is required for assembly of the small ribosomal subunit and for intersubunit association, thus representing a key element in the assembly of the whole ribosome Back     alignment and domain information
>gnl|CDD|109373 pfam00312, Ribosomal_S15, Ribosomal protein S15 Back     alignment and domain information
>gnl|CDD|176968 CHL00027, rps15, ribosomal protein S15 Back     alignment and domain information
>gnl|CDD|173410 PTZ00119, PTZ00119, 40S ribosomal protein S15; Provisional Back     alignment and domain information
>gnl|CDD|38026 KOG2815, KOG2815, KOG2815, Mitochondrial/choloroplast ribosomal protein S15 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|48354 cd00677, S15_NS1_EPRS_RNA-bind, S15/NS1/EPRS_RNA-binding domain Back     alignment and domain information
>gnl|CDD|30533 COG0184, RpsO, Ribosomal protein S15P/S13E [Translation, ribosomal structure and biogenesis] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 89 30S ribosomal protein S15 [Candidatus Liberibacter asia
TIGR0095286 S15_bact ribosomal protein S15; InterPro: IPR005290 Rib 100.0
PRK0562689 rpsO 30S ribosomal protein S15; Reviewed 100.0
pfam0031283 Ribosomal_S15 Ribosomal protein S15. 100.0
CHL0002790 rps15 ribosomal protein S15 100.0
COG018489 RpsO Ribosomal protein S15P/S13E [Translation, ribosoma 99.98
cd0035380 Ribosomal_S15p_S13e Ribosomal protein S15 (prokaryotic) 99.98
PTZ00119 302 40S ribosomal protein S15; Provisional 99.87
KOG2815256 consensus 99.7
cd0067746 S15_NS1_EPRS_RNA-bind S15/NS1/EPRS_RNA-binding domain. 99.41
PTZ00072148 40S ribosomal protein S13; Provisional 97.94
PRK08561151 rps15p 30S ribosomal protein S15P; Reviewed 97.93
KOG2815256 consensus 97.55
KOG0400151 consensus 90.71
>TIGR00952 S15_bact ribosomal protein S15; InterPro: IPR005290 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PRK05626 rpsO 30S ribosomal protein S15; Reviewed Back     alignment and domain information
>pfam00312 Ribosomal_S15 Ribosomal protein S15 Back     alignment and domain information
>CHL00027 rps15 ribosomal protein S15 Back     alignment and domain information
>COG0184 RpsO Ribosomal protein S15P/S13E [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd00353 Ribosomal_S15p_S13e Ribosomal protein S15 (prokaryotic)_S13 (eukaryotic) binds the central domain of 16S rRNA and is required for assembly of the small ribosomal subunit and for intersubunit association, thus representing a key element in the assembly of the whole ribosome Back     alignment and domain information
>PTZ00119 40S ribosomal protein S15; Provisional Back     alignment and domain information
>KOG2815 consensus Back     alignment and domain information
>cd00677 S15_NS1_EPRS_RNA-bind S15/NS1/EPRS_RNA-binding domain Back     alignment and domain information
>PTZ00072 40S ribosomal protein S13; Provisional Back     alignment and domain information
>PRK08561 rps15p 30S ribosomal protein S15P; Reviewed Back     alignment and domain information
>KOG2815 consensus Back     alignment and domain information
>KOG0400 consensus Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target89 30S ribosomal protein S15 [Candidatus Liberibacter asia
2qou_O89 Crystal Structure Of The Bacterial Ribosome From Es 6e-27
2avy_O89 Crystal Structure Of The Bacterial Ribosome From Es 2e-26
1p6g_O88 Real Space Refined Coordinates Of The 30s Subunit F 8e-26
1a32_A88 Ribosomal Protein S15 From Bacillus Stearothermophi 1e-25
2i2p_O88 Crystal Structure Of Ribosome With Messenger Rna An 2e-25
2gy9_O86 Structure Of The 30s Subunit Of A Pre-Translocation 4e-25
1qd7_H85 Partial Model For 30s Ribosomal Subunit Length = 85 2e-24
1fjg_O89 Fitting Of Components With Known Structure Into An 1e-22
1fka_O89 Structure Of Functionally Activated Small Ribosomal 4e-22
1i94_O88 Crystal Structures Of The Small Ribosomal Subunit W 1e-21
1kuq_A87 Crystal Structure Of T3c Mutant S15 Ribosomal Prote 2e-21
1g1x_B88 Structure Of Ribosomal Proteins S15, S6, S18, And 1 4e-21
1f7y_A89 The Crystal Structure Of Two Uucg Loops Highlights 1e-20
1dk1_A86 Detailed View Of A Key Element Of The Ribosome Asse 7e-19
3bbn_O90 Homology Model For The Spinach Chloroplast 30s Subu 4e-13
gi|157836043|pdb|2QOU|O Chain O, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Spectinomycin. This File Contains The 30s Subunit Of The First 70s Ribosome, With Spectinomycin Bound. The Entire Crystal Structure Contains Two 70s Ribosomes. Length = 89 Back     alignment and structure
 Score =  123 bits (311), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 42/89 (47%), Positives = 59/89 (66%)

Query: 1  MSITLERKRELMKEYAVSPGDTGSPEVQVAVCTERIANLTEHFKSAKKDVNSKIGLGRLI 60
          MS++ E   +++ E+     DTGS EVQVA+ T +I +L  HF   KKD +S+ GL R++
Sbjct: 1  MSLSTEATAKIVSEFGRDANDTGSTEVQVALLTAQINHLQGHFAEHKKDHHSRRGLLRMV 60

Query: 61 SLRSSLLKYLERKDVERYKRLVQSLKLRR 89
          S R  LL YL+RKDV RY +L++ L LRR
Sbjct: 61 SQRRKLLDYLKRKDVARYTQLIERLGLRR 89


gi|83754053|pdb|2AVY|O Chain O, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli At 3.5 A Resolution. This File Contains The 30s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. Length = 89 Back     alignment and structure
>gi|33357892|pdb|1P6G|O Chain O, Real Space Refined Coordinates Of The 30s Subunit Fitted Into The Low Resolution Cryo-Em Map Of The Ef-G.Gtp State Of E. Coli 70s Ribosome Length = 88 Back     alignment and structure
>gi|157829661|pdb|1A32|A Chain A, Ribosomal Protein S15 From Bacillus Stearothermophilus Length = 88 Back     alignment and structure
>gi|118138067|pdb|2I2P|O Chain O, Crystal Structure Of Ribosome With Messenger Rna And The Anticodon Stem-Loop Of P-Site Trna. This File Contains The 30s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. Length = 88 Back     alignment and structure
>gi|116667424|pdb|2GY9|O Chain O, Structure Of The 30s Subunit Of A Pre-Translocational E. Coli Ribosome Obtained By Fitting Atomic Models For Rna And Protein Components Into Cryo-Em Map Emd-1056 Length = 86 Back     alignment and structure
>gi|6137692|pdb|1QD7|H Chain H, Partial Model For 30s Ribosomal Subunit Length = 85 Back     alignment and structure
>gi|10835599|pdb|1FJG|O Chain O, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In Complex With The Antibiotics Streptomycin, Spectinomycin, And Paromomycin Length = 89 Back     alignment and structure
>gi|10120578|pdb|1FKA|O Chain O, Structure Of Functionally Activated Small Ribosomal Subunit At 3.3 A Resolution Length = 89 Back     alignment and structure
>gi|14278544|pdb|1I94|O Chain O, Crystal Structures Of The Small Ribosomal Subunit With Tetracycline, Edeine And If3 Length = 88 Back     alignment and structure
>gi|33357249|pdb|1KUQ|A Chain A, Crystal Structure Of T3c Mutant S15 Ribosomal Protein In Complex With 16s Rrna Length = 87 Back     alignment and structure
>gi|11514243|pdb|1G1X|B Chain B, Structure Of Ribosomal Proteins S15, S6, S18, And 16s Ribosomal Rna Length = 88 Back     alignment and structure
>gi|11513521|pdb|1F7Y|A Chain A, The Crystal Structure Of Two Uucg Loops Highlights The Role Played By 2'-Hydroxyl Groups In Its Unusual Stability Length = 89 Back     alignment and structure
>gi|7546270|pdb|1DK1|A Chain A, Detailed View Of A Key Element Of The Ribosome Assembly: Crystal Structure Of The S15-Rrna Complex Length = 86 Back     alignment and structure
gi|188036216|pdb|3BBN|O Chain O, Homology Model For The Spinach Chloroplast 30s Subunit Fitted To 9.4a Cryo-Em Map Of The 70s Chlororibosome. Length = 90 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target89 30S ribosomal protein S15 [Candidatus Liberibacter asia
3ofo_O88 30S ribosomal protein S15; protein biosynthesis, riboso 7e-25
3i1m_O89 30S ribosomal protein S15; ribosome structure, protein- 2e-24
1a32_A88 Ribosomal protein S15; multiwavelength anomalous diffra 2e-23
2vqe_O89 30S ribosomal protein S15; tRNA-binding, rRNA-binding, 6e-23
3bbn_O90 Ribosomal protein S15; small ribosomal subunit, spinach 4e-19
>3ofo_O 30S ribosomal protein S15; protein biosynthesis, ribosomes, RNA, tRNA, transfer, eryThr ketolide, macrolide, antibiotic, EXIT, peptidyl; 3.10A {Escherichia coli} PDB: 1p6g_O 1p87_O 3ofp_O 3i1m_O 2qan_O* 2qb9_O* 2qbb_O* 2qbd_O 2qbf_O 2qbh_O* 2qbj_O* 2qou_O* 2qow_O* 2qoy_O* 2qp0_O* 2vaz_F 2z4k_O* 2z4m_O* 2qal_O 3i1o_O ... Length = 88 Back     alignment and structure
 Score =  107 bits (269), Expect = 7e-25
 Identities = 41/88 (46%), Positives = 58/88 (65%)

Query: 2  SITLERKRELMKEYAVSPGDTGSPEVQVAVCTERIANLTEHFKSAKKDVNSKIGLGRLIS 61
          S++ E   +++ E+     DTGS EVQVA+ T +I +L  HF   KKD +S+ GL R++S
Sbjct: 1  SLSTEATAKIVSEFGRDANDTGSTEVQVALLTAQINHLQGHFAEHKKDHHSRRGLLRMVS 60

Query: 62 LRSSLLKYLERKDVERYKRLVQSLKLRR 89
           R  LL YL+RKDV RY +L++ L LRR
Sbjct: 61 QRRKLLDYLKRKDVARYTQLIERLGLRR 88


>3i1m_O 30S ribosomal protein S15; ribosome structure, protein-RNA complex, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA-binding, antibiotic resistance; 3.19A {Escherichia coli k-12} PDB: 2qan_O* 2qb9_O* 2qbb_O* 2qbd_O 2qbf_O 2qbh_O* 2qbj_O* 2qou_O* 2qow_O* 2qoy_O* 2qp0_O* 2vaz_F 2z4k_O* 2z4m_O* 2qal_O 3i1o_O 3i1q_O 3i1s_O 3i1z_O 3i21_O ... Length = 89 Back     alignment and structure
>1a32_A Ribosomal protein S15; multiwavelength anomalous diffraction, protein-RNA, ribosomal protein interactions, ribosome, RNA-binding; 2.10A {Bacillus stearothermophilus} SCOP: a.16.1.2 PDB: 1qd7_H Length = 88 Back     alignment and structure
>2vqe_O 30S ribosomal protein S15; tRNA-binding, rRNA-binding, metal-binding, zinc-finger, translation; HET: TM2 PAR; 2.5A {Thermus thermophilus} SCOP: i.1.1.1 PDB: 1eg0_F* 1gix_R* 1hnw_O* 1hnx_O* 1hnz_O* 1hr0_O 1ibk_O* 1ibl_O* 1ibm_O 1jgo_R* 1jgp_R* 1jgq_R* 1ml5_R* 1xmo_O* 1xmq_O* 1xnq_O* 1xnr_O* 1yl4_R 2b64_O* 2b9m_O* ... Length = 89 Back     alignment and structure
>3bbn_O Ribosomal protein S15; small ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} Length = 90 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target89 30S ribosomal protein S15 [Candidatus Liberibacter asia
2vqe_O89 30S ribosomal protein S15; tRNA-binding, rRNA-binding, 100.0
3ofo_O88 30S ribosomal protein S15; protein biosynthesis, riboso 100.0
1a32_A88 Ribosomal protein S15; multiwavelength anomalous diffra 100.0
3bbn_O90 Ribosomal protein S15; small ribosomal subunit, spinach 99.97
3jyv_O84 40S ribosomal protein S13; eukaryotic ribosome, RACK1 p 98.03
>2vqe_O 30S ribosomal protein S15; tRNA-binding, rRNA-binding, metal-binding, zinc-finger, translation; HET: TM2 PAR; 2.5A {Thermus thermophilus} SCOP: i.1.1.1 PDB: 1eg0_F* 1gix_R* 1hnw_O* 1hnx_O* 1hnz_O* 1hr0_O 1ibk_O* 1ibl_O* 1ibm_O 1jgo_R* 1jgp_R* 1jgq_R* 1ml5_R* 1xmo_O* 1xmq_O* 1xnq_O* 1xnr_O* 1yl4_R 2b64_O* 2b9m_O* ... Back     alignment and structure
Probab=100.00  E-value=4.1e-38  Score=230.28  Aligned_cols=88  Identities=50%  Similarity=0.753  Sum_probs=87.7

Q ss_pred             CCCCHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHCCHHHHHH
Q ss_conf             98888999999999545888788899999997799999999999778413527789999997899999998409999999
Q gi|254780785|r    1 MSITLERKRELMKEYAVSPGDTGSPEVQVAVCTERIANLTEHFKSAKKDVNSKIGLGRLISLRSSLLKYLERKDVERYKR   80 (89)
Q Consensus         1 m~~~~~~k~~~i~~f~~~~~DtGS~evQIA~lT~rI~~L~~Hl~~~kKD~~s~rgL~~lv~kRkklL~YLk~~d~~~Y~~   80 (89)
                      |++++++|+++|++||+||+||||||||||+||+||.+|++|++.||||++|+|||.+||++|++||+||+++|+++|.+
T Consensus         1 m~~~~~~k~~ii~~f~~~~~DtGS~evQIA~LT~rI~~Lt~Hlk~~kkD~~srrgL~~lv~kRrklL~YLr~~d~~~Y~~   80 (89)
T 2vqe_O            1 MPITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRA   80 (89)
T ss_dssp             -CCCHHHHHHHHHTTCSSTTCCSSHHHHHHHHHHHHHHHHHHTTSSTTCHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHH
T ss_pred             CCCCHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHCCHHHHHH
T ss_conf             99889999999999768999879899999999999999999998778751109999999999999999998659999999


Q ss_pred             HHHHHCCC
Q ss_conf             99983689
Q gi|254780785|r   81 LVQSLKLR   88 (89)
Q Consensus        81 ~i~~LglR   88 (89)
                      +|++||||
T Consensus        81 vi~~LglR   88 (89)
T 2vqe_O           81 LIEKLGIR   88 (89)
T ss_dssp             HHHHHTCC
T ss_pred             HHHHHCCC
T ss_conf             99982899



>3ofo_O 30S ribosomal protein S15; protein biosynthesis, ribosomes, RNA, tRNA, transfer, eryThr ketolide, macrolide, antibiotic, EXIT, peptidyl; 3.10A {Escherichia coli} PDB: 1p6g_O 1p87_O 3ofp_O 3i1m_O 2qan_O* 2qb9_O* 2qbb_O* 2qbd_O 2qbf_O 2qbh_O* 2qbj_O* 2qou_O* 2qow_O* 2qoy_O* 2qp0_O* 2vaz_F 2z4k_O* 2z4m_O* 2qal_O 3i1o_O ... Back     alignment and structure
>1a32_A Ribosomal protein S15; multiwavelength anomalous diffraction, protein-RNA, ribosomal protein interactions, ribosome, RNA-binding; 2.10A {Geobacillus stearothermophilus} SCOP: a.16.1.2 PDB: 1qd7_H Back     alignment and structure
>3bbn_O Ribosomal protein S15; small ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} Back     alignment and structure
>3jyv_O 40S ribosomal protein S13; eukaryotic ribosome, RACK1 protein, flexible fitting; HET: 2MG H2U M2G OMC OMG YYG PSU 5MC 7MG 5MU 1MA; 8.90A {Thermomyces lanuginosus} PDB: 1ysh_E 1s1h_O Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 89 30S ribosomal protein S15 [Candidatus Liberibacter asia
d1vs5o188 a.16.1.2 (O:1-88) Ribosomal protein S15 {Escherichia co 1e-23
d1a32a_85 a.16.1.2 (A:) Ribosomal protein S15 {Bacillus stearothe 2e-22
d1kuqa_84 a.16.1.2 (A:) Ribosomal protein S15 {Thermus thermophil 4e-22
>d1vs5o1 a.16.1.2 (O:1-88) Ribosomal protein S15 {Escherichia coli [TaxId: 562]} Length = 88 Back     information, alignment and structure

class: All alpha proteins
fold: S15/NS1 RNA-binding domain
superfamily: S15/NS1 RNA-binding domain
family: Ribosomal protein S15
domain: Ribosomal protein S15
species: Escherichia coli [TaxId: 562]
 Score =  102 bits (255), Expect = 1e-23
 Identities = 42/88 (47%), Positives = 58/88 (65%)

Query: 2  SITLERKRELMKEYAVSPGDTGSPEVQVAVCTERIANLTEHFKSAKKDVNSKIGLGRLIS 61
          S++ E   +++ E+     DTGS EVQVA+ T +I +L  HF   KKD +S+ GL R++S
Sbjct: 1  SLSTEATAKIVSEFGRDANDTGSTEVQVALLTAQINHLQGHFAEHKKDHHSRRGLLRMVS 60

Query: 62 LRSSLLKYLERKDVERYKRLVQSLKLRR 89
           R  LL YL+RKDV RY RL++ L LRR
Sbjct: 61 QRRKLLDYLKRKDVARYTRLIERLGLRR 88


>d1a32a_ a.16.1.2 (A:) Ribosomal protein S15 {Bacillus stearothermophilus [TaxId: 1422]} Length = 85 Back     information, alignment and structure
>d1kuqa_ a.16.1.2 (A:) Ribosomal protein S15 {Thermus thermophilus [TaxId: 274]} Length = 84 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target89 30S ribosomal protein S15 [Candidatus Liberibacter asia
d1vs5o188 Ribosomal protein S15 {Escherichia coli [TaxId: 562]} 100.0
d1a32a_85 Ribosomal protein S15 {Bacillus stearothermophilus [Tax 100.0
d1kuqa_84 Ribosomal protein S15 {Thermus thermophilus [TaxId: 274 100.0
>d1vs5o1 a.16.1.2 (O:1-88) Ribosomal protein S15 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All alpha proteins
fold: S15/NS1 RNA-binding domain
superfamily: S15/NS1 RNA-binding domain
family: Ribosomal protein S15
domain: Ribosomal protein S15
species: Escherichia coli [TaxId: 562]
Probab=100.00  E-value=1.3e-37  Score=226.25  Aligned_cols=88  Identities=48%  Similarity=0.728  Sum_probs=87.1

Q ss_pred             CCCHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHCCHHHHHHH
Q ss_conf             88889999999995458887888999999977999999999997784135277899999978999999984099999999
Q gi|254780785|r    2 SITLERKRELMKEYAVSPGDTGSPEVQVAVCTERIANLTEHFKSAKKDVNSKIGLGRLISLRSSLLKYLERKDVERYKRL   81 (89)
Q Consensus         2 ~~~~~~k~~~i~~f~~~~~DtGS~evQIA~lT~rI~~L~~Hl~~~kKD~~s~rgL~~lv~kRkklL~YLk~~d~~~Y~~~   81 (89)
                      |+++++|+++|++||+||+||||||||||+||+||.+|++||+.||||++|+|||.+||++|++||+||+++|+++|.++
T Consensus         1 ~l~~~~k~~ii~~~~~~~~DtGS~evQiA~lT~rI~~Lt~Hl~~~kKD~~s~rgL~~lv~kRkklL~YL~~~d~~~Y~~v   80 (88)
T d1vs5o1           1 SLSTEATAKIVSEFGRDANDTGSTEVQVALLTAQINHLQGHFAEHKKDHHSRRGLLRMVSQRRKLLDYLKRKDVARYTRL   80 (88)
T ss_dssp             CCCHHHHHHHHHHHCSSSSCTTCHHHHHHHHHHHHHHHHHHHHSSCCCCTTHHHHHHHHHHHHHHHHHHHTTCHHHHHHH
T ss_pred             CCCHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHCCHHHHHHH
T ss_conf             98779999999998689998788579898779999999999987665410399999999999999999986599999999


Q ss_pred             HHHHCCCC
Q ss_conf             99836899
Q gi|254780785|r   82 VQSLKLRR   89 (89)
Q Consensus        82 i~~LglRk   89 (89)
                      |++|||||
T Consensus        81 i~~LgLrk   88 (88)
T d1vs5o1          81 IERLGLRR   88 (88)
T ss_dssp             HTTTTCCC
T ss_pred             HHHHCCCC
T ss_conf             99958999



>d1a32a_ a.16.1.2 (A:) Ribosomal protein S15 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1kuqa_ a.16.1.2 (A:) Ribosomal protein S15 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 89 30S ribosomal protein S15 [Candidatus Liberibacter
2vqe_O_89 (O:) 30S ribosomal protein S15; tRNA-binding, rRNA 1e-23
3i1m_O_89 (O:) 30S ribosomal protein S15; ribosome structure 2e-23
3bbn_O_90 (O:) Ribosomal protein S15; small ribosomal subuni 4e-20
1a32_A_20-8869 (A:20-88) Ribosomal protein S15; multiwavelength a 3e-18
3jyv_O_84 (O:) 40S ribosomal protein S13; eukaryotic ribosom 7e-16
>2vqe_O (O:) 30S ribosomal protein S15; tRNA-binding, rRNA-binding, metal-binding, zinc-finger, translation; HET: TM2 PAR; 2.5A {Thermus thermophilus}Length = 89 Back     alignment and structure
 Score =  103 bits (258), Expect = 1e-23
 Identities = 44/88 (50%), Positives = 62/88 (70%)

Query: 1  MSITLERKRELMKEYAVSPGDTGSPEVQVAVCTERIANLTEHFKSAKKDVNSKIGLGRLI 60
          M IT E K+++++E+A  PGDTGS EVQVA+ T RI  L+EH K  KKD +S  GL  ++
Sbjct: 1  MPITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMV 60

Query: 61 SLRSSLLKYLERKDVERYKRLVQSLKLR 88
            R  LL+YL+R+D ERY+ L++ L +R
Sbjct: 61 GQRRRLLRYLQREDPERYRALIEKLGIR 88


>3i1m_O (O:) 30S ribosomal protein S15; ribosome structure, protein-RNA complex, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA-binding, antibiotic resistance; 3.19A {Escherichia coli k-12} PDB: 2qan_O* 2qb9_O* 2qbb_O* 2qbd_O 2qbf_O 2qbh_O* 2qbj_O* 2qou_O* 2qow_O* 2qoy_O* 2qp0_O* 2vaz_F 2z4k_O* 2z4m_O* 2qal_O 3i1o_O 3i1q_O 3i1s_O 3i1z_O 3i21_O ...Length = 89 Back     alignment and structure
>3bbn_O (O:) Ribosomal protein S15; small ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea}Length = 90 Back     alignment and structure
>1a32_A (A:20-88) Ribosomal protein S15; multiwavelength anomalous diffraction, protein-RNA, ribosomal protein interactions, ribosome, RNA-binding; 2.10A {Bacillus stearothermophilus}Length = 69 Back     alignment and structure
>3jyv_O (O:) 40S ribosomal protein S13; eukaryotic ribosome, RACK1 protein, flexible fitting; HET: 2MG H2U M2G OMC OMG YYG PSU 5MC 7MG 5MU 1MA; 8.90A {Thermomyces lanuginosus} PDB: 1ysh_E 1s1h_OLength = 84 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target89 30S ribosomal protein S15 [Candidatus Liberibacter asia
3i1m_O_89 30S ribosomal protein S15; ribosome structure, pro 100.0
2vqe_O_89 30S ribosomal protein S15; tRNA-binding, rRNA-bind 100.0
3bbn_O_90 Ribosomal protein S15; small ribosomal subunit, sp 100.0
1a32_A_20-8869 Ribosomal protein S15; multiwavelength anomalous d 99.97
3jyv_O_84 40S ribosomal protein S13; eukaryotic ribosome, RA 99.91
>3i1m_O (O:) 30S ribosomal protein S15; ribosome structure, protein-RNA complex, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA-binding, antibiotic resistance; 3.19A {Escherichia coli k-12} PDB: 2qan_O* 2qb9_O* 2qbb_O* 2qbd_O 2qbf_O 2qbh_O* 2qbj_O* 2qou_O* 2qow_O* 2qoy_O* 2qp0_O* 2vaz_F 2z4k_O* 2z4m_O* 2qal_O 3i1o_O 3i1q_O 3i1s_O 3i1z_O 3i21_O ... Back     alignment and structure
Probab=100.00  E-value=2e-37  Score=227.29  Aligned_cols=89  Identities=47%  Similarity=0.724  Sum_probs=88.5

Q ss_pred             CCCCHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHCCHHHHHH
Q ss_conf             98888999999999545888788899999997799999999999778413527789999997899999998409999999
Q gi|254780785|r    1 MSITLERKRELMKEYAVSPGDTGSPEVQVAVCTERIANLTEHFKSAKKDVNSKIGLGRLISLRSSLLKYLERKDVERYKR   80 (89)
Q Consensus         1 m~~~~~~k~~~i~~f~~~~~DtGS~evQIA~lT~rI~~L~~Hl~~~kKD~~s~rgL~~lv~kRkklL~YLk~~d~~~Y~~   80 (89)
                      ||+++++|+++|++|++||+||||||||||+||+||.+|++||+.||||++|+|||.++|++|++||+||+++|+++|.+
T Consensus         1 M~i~~~~k~~~i~~~~~~~~DtGS~evQIA~LT~rI~~L~~Hl~~~kkD~~s~rgL~~lv~kRrklL~YLr~~d~~~Y~~   80 (89)
T 3i1m_O            1 MSLSTEATAKIVSEFGRDANDTGSTEVQVALLTAQINHLQGHFAEHKKDHHSRRGLLRMVSQRRKLLDYLKRKDVARYTQ   80 (89)
T ss_dssp             -CCCHHHHHHHHHHHSSSTTCTTCHHHHHHHHHHHHHHHHHHTTSCCCCHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHH
T ss_pred             CCCCHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHCCHHHHHH
T ss_conf             99878999999999768999878889999988999999999998774440009999999999999999998669999999


Q ss_pred             HHHHHCCCC
Q ss_conf             999836899
Q gi|254780785|r   81 LVQSLKLRR   89 (89)
Q Consensus        81 ~i~~LglRk   89 (89)
                      +|++|||||
T Consensus        81 ~i~~Lglrk   89 (89)
T 3i1m_O           81 LIERLGLRR   89 (89)
T ss_dssp             HHHHHTCCC
T ss_pred             HHHHHCCCC
T ss_conf             999958999



>2vqe_O (O:) 30S ribosomal protein S15; tRNA-binding, rRNA-binding, metal-binding, zinc-finger, translation; HET: TM2 PAR; 2.5A {Thermus thermophilus} Back     alignment and structure
>3bbn_O (O:) Ribosomal protein S15; small ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} Back     alignment and structure
>1a32_A (A:20-88) Ribosomal protein S15; multiwavelength anomalous diffraction, protein-RNA, ribosomal protein interactions, ribosome, RNA-binding; 2.10A {Bacillus stearothermophilus} Back     alignment and structure
>3jyv_O (O:) 40S ribosomal protein S13; eukaryotic ribosome, RACK1 protein, flexible fitting; HET: 2MG H2U M2G OMC OMG YYG PSU 5MC 7MG 5MU 1MA; 8.90A {Thermomyces lanuginosus} PDB: 1ysh_E 1s1h_O Back     alignment and structure