254780787

254780787

translation initiation factor IF-2

GeneID in NCBI database:8209793Locus tag:CLIBASIA_03390
Protein GI in NCBI database:254780787Protein Accession:YP_003065200.1
Gene range:+(473524, 476178)Protein Length:884aa
Gene description:translation initiation factor IF-2
COG prediction:[J] Translation initiation factor 2 (IF-2; GTPase)
KEGG prediction:infB; translation initiation factor IF-2; K02519 translation initiation factor IF-2
SEED prediction:Translation initiation factor 2
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Translation initiation factors bacterial;
NusA-TFII Cluster;
Universal GTPases;
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880----
MTDNKDNKKSNVVEKKTLTLKTSSLGVGHSSFQNQGANQGRARSVVVETRKRRSYVQGEEKVSVFRKSSRVIESSSDSSQDLSQAKAKGNFRRASRSDKVSSQKNDSSFAGLSQGEIESRRRALHEAQVREEELRKRLEQQSLEQPSQESSIDLPEVCDSQQVPEQVLEDPCKEKDLEIKDVDVGTEVESSVILSHDMGDSDSSSVVNNKFRESSSDASSNRGKSRGGAGKYASVNSSKPVTRNKVGDDDKKYKKVRIAVAADVDEEGGASRGRSLSAMRRRQEKFRRNQQQEKREKISREIVVPETITIQELSQRMSERSADVIKFLMKEGQIMKPGDVIDADLSEIIANEFGNTVKRVLESDIEVGIFDVADSESDLDIRPPVVTIMGHVDHGKTSLLDAIRKADVAKGEIGGITQHIGAYQVAYQGKNITFLDTPGHAAFYEMRARGARVTDIAVLVLAADEEIMPQAIESINHAKAADVSIIVAINKIDKLGADPQKVRMSLLKHDVFVESMGGDILDVEISAKNNLNLDKLLDAILLQAEMLDLKTSINRKAEGIVVEGKLDRGRGPVVTVLVQKGTLSKGNILVVGDQWGKIRALFNDRGQGISKAVPSMPIEVLGLQGMPMAGDKFGVVDSESRAREIAQYRQRVTRNKSMARRLGSHSALEKLVKNANISSKMKEFPVIIKGDVQGSVEAIVDSLGALKNSEVCLSIVHSSVGAINETDVSLAKASGAVIFGFNVRASSQARVLAIKDEIKILYYKIIYDLLDSIKDSMSELLSPEIRETFLGNAEVLEVFAVTKLGNVAGCKVSEGKVERGSGVRLIRNSTVIYEGKLKTLKRFKDEVSEVHAGQDCGMAFEKYDNIQAGDMIECFSIEHIKRSL
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHccccccccccHHcccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHccHHcccccEEccccccHHHHHHHHcccHHHHHHHHHHccccccccccccHHHHHHHHHHcccccccccHHHHHHHHHHHcccHHHHHccccEEEEEEcccccHHHHHHHHHcccccEEccccEEEEEEEEEEEEccEEEEEEEcccHHHHHHHHHHHHHHccEEEEEEEccccccHHHHHHHHHHHHccccEEEEEEccccccccHHHHHHHHHHHHHHHHHccccccEEEccccccccHHHHHHHHHHHcccccccccccccEEEEEEEEEEccccccEEEEEEEccEEccccEEEEEccccEEEEEEcccccEEEEEccccEEEEEccccccccccEEEEEccHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEccHHHHHHHHHHHHHcccccEEEEEEEcccccccHHHHHHHcccccEEEEEcccccHHHHHHHHHcccEEEEEEHHHHHHHHHHHHHHHHHcccEEEEEEEEEEEEEEEEccccccEEEEEEEEEEEEcccEEEEEEccEEEEccEEEEEEEccccHHHHccccEEEEEEEcccccccccEEEEEEEEEEEEcc
ccccccccccccccccccccccccccccEEEEEEcccccccccEEEEEEEEEEEEEccccccccccHHHcccHHHHcccHHHHHHHHHHHHHHHHcHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHcHcccccccccccccccccccccccccccccccccHHHccccccccccccHHHHHHccccccccccccccccccccccccccccccHHHHcccccccccccccEEEccEEEHHHHHHHHHHHHHHHHHHHHHccccccccHHccHHHHHHHHHHHccEEEEEEcccHHHHHHccccccHcccccccEEEEEccccccHHHHHHHHHHcccccccccccEEEEEEEEEEccccEEEEEccccHHHHHHHHHccccEcEEEEEEEEccccccHHHHHHHHHHHHccccEEEEEEccccccccHHHHHHHHHHcccccHHccccccEEEEEccccccHHHHHHHHHHHHHHHHHcccccccccEEEEEEEcccccccEEEEEEEccccccccEEEEEcccccEEEEEcccccEEEcccccccEEEEccccccccccEEEEEccHHHHHHHHHHHHccHHHHHHHHHHHccccHHHHHHHHcccccEEEEcEEEEEccccHHHHHHHHHHHcccccEEEEEEEcccccccHcHHHHHHHccEEEEEEcccccHHHHHHHHHccccEEHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccccccEEEEEEEEcEEEEccccEEEEEccEEEEEccHHHHHHHHHHHHHHHcccccEEEEEcccccccccEEEEEEEEEEEccc
mtdnkdnkksnvvEKKTLTLktsslgvghssfqnqganqgrARSVVVETrkrrsyvqgeeKVSVFRKSsrviesssdssqDLSQAKAkgnfrrasrsdkvssqkndssfaglsQGEIESRRRALHEAQVREEELRKRLEQqsleqpsqessidlpevcdsqqvpeqvledpckekdleikdvdvgteVESSVILshdmgdsdsssvvnnkfresssdassnrgksrggagkyasvnsskpvtrnkvgdddkkYKKVRIAVAAdvdeeggasrgrSLSAMRRRQEKFRRNQQQEKREKISREIVVPETITIQELSQRMSERSADVIKFLMKegqimkpgdvidADLSEIIANEFGNTVKRVLESDIevgifdvadsesdldirppvvtimghvdhgkTSLLDAIRKADVAKGEIGGITQHIGAYQVAyqgknitfldtpghAAFYEMRARGARVTDIAVLVLAADEEIMPQAIESINHAKAADVSIIVAINKidklgadpqKVRMSLLKHDVFvesmggdildVEISAKNNLNLDKLLDAILLQAEMLDLKTSINrkaegivvegkldrgrgpVVTVLVQkgtlskgnilvVGDQWGKIRALFNDrgqgiskavpsmpievlglqgmpmagdkfgvvdSESRAREIAQYRQRVTRNKSMARRLGSHSALEKLVKNanisskmkefpviikgdvqGSVEAIVDSLGALKNSEVCLSIVHSSVGAINETDVSLAKASGAVIFGFNVRASSQARVLAIKDEIKILYYKIIYDLLDSIKDSMSELLSPEIRETFLGNAEVLEVFAVTKLgnvagckvsegkvergsgvrlirnstVIYEGKLKTLKRFKDEVsevhagqdcgmafekydniqagdmiecfsiehIKRSL
mtdnkdnkksnvvekktltlktsslgvghssfqnqganqgrarsvvvetrkrrsyvqgeekvsvfrkssrviesssdssqdlsqakakgnfrrasrsdkvssqkndssfaglsqgeieSRRRALHEAQVREEELRKrleqqsleqpsqessidlpeVCDSQQVPEqvledpckekdleikdvdvgTEVESSvilshdmgdsdsssvVNNKfresssdassnrgksrggagkyasvnsskpvtrnkvgdddkkykKVRIavaadvdeeggasrgrslsamrrrqekfrrnqqqekrekisreivvpetitiqelsqrmSERSADVIKFLMKEGQIMKPGDVIDADLSEIIANEFGNTVKRVLESDIEVGIfdvadsesdldirPPVVTIMGHVDHGKTSLLDAIRKADVAKGEIGGITQHIGAYQVAYQGKNITFLDTPGHAAFYEMRARGARVTDIAVLVLAADEEIMPQAIESINHAKAADVSIIVAINKIDKLGADPQKVRMSLLKHDVFVESMGGDILDVEISAKNNLNLDKLLDAILLQAEMLDLKtsinrkaegivvegkldrgrgpVVTVlvqkgtlskgnilvvgdQWGKIRALFNDRGQGISKAVPSMPIEVLGLQGMPMAGDKFGVVDSESRAREIAqyrqrvtrnksmarrlgshsaleKLVKnanisskmkefPVIIKGDVQGSVEAIVDSLGALKNSEVCLSIVHSSVGAINETDVSLAKASGAVIFGFnvrassqaRVLAIKDEIKILYYKIIYDLLDSIKDSMSELLSPEIRETFLGNAEVLEVFAVTKLgnvagckvsegkvergsgvrlirnstviyegklktlkrFKDEVSEVHAGQDCGMAFEKYDNIQAGDMIECFSIEHIKRSL
MTDNKDNKKSNVVEKKTLTLKTSSLGVGHSSFQNQGANQGRARSVVVETRKRRSYVQGEEKVSVFRKssrviesssdssqdlsQAKAKGNFRRASRSDKVSSQKNDSSFAGLSQGEIESRRRALHEAQVreeelrkrleqqsleqpsqessIDLPEVCDSQQVPEQVLEDPCKEKDLEIKDVDVGTEVESSVILSHDMGDSDSSSVVNNKFRESSSDASSNRGKSRGGAGKYASVNSSKPVTRNKVGdddkkykkVRIAVAADVDEEGGASRGRSLSAMRRRQEKFRRNQQQEKREKISREIVVPETITIQELSQRMSERSADVIKFLMKEGQIMKPGDVIDADLSEIIANEFGNTVKRVLESDIEVGIFDVADSESDLDIRPPVVTIMGHVDHGKTSLLDAIRKADVAKGEIGGITQHIGAYQVAYQGKNITFLDTPGHAAFYEMRARGARVTDIAVLVLAADEEIMPQAIESINHAKAADVSIIVAINKIDKLGADPQKVRMSLLKHDVFVESMGGDILDVEISaknnlnldklldaillQAEMLDLKTSINRKAEGIVVEGKLDRGRGPVVTVLVQKGTLSKGNILVVGDQWGKIRALFNDRGQGISKAVPSMPIEVLGLQGMPMAGDKFGVVDSESRAREIAQYRQRVTRNKSMARRLGSHSALEKLVKNANISSKMKEFPVIIKGDVQGSVEAIVDSLGALKNSEVCLSIVHSSVGAINETDVSLAKASGAVIFGFNVRASSQARVLAikdeikilyykiiydlldSIKDSMSELLSPEIRETFLGNAEVLEVFAVTKLGNVAGCKVSEGKVERGSGVRLIRNSTVIYEGKLKTLKRFKDEVSEVHAGQDCGMAFEKYDNIQAGDMIECFSIEHIKRSL
*************************************************************************************************************************************************************************************************************************************************************************************************************IVVPETITIQELSQRMSERSADVIKFLMKEGQIMKPGDVIDADLSEIIANEFGNTVKRVLESDIEVGI**********DIRPPVVTIMGHVDHGKTSLLDAIRKADVAKGEIGGITQHIGAYQVAYQGKNITFLDTPGHAAFYEMRARGARVTDIAVLVLAADEEIMPQAIESINHAKAADVSIIVAINKIDKLGADPQKVRMSLLKHDVFVESMGGDILDVEISAKNNLNLDKLLDAILLQAEMLDLKTSINRKAEGIVVEGKLDRGRGPVVTVLVQKGTLSKGNILVVGDQWGKIRALFNDRGQGISKAVPSMPIEVLGLQGMPMAGDKFGVVDSESRAREIAQY*Q********************LVKNANISSKMKEFPVIIKGDVQGSVEAIVDSLGALKNSEVCLSIVHSSVGAINETDVSLAKASGAVIFGFNVRASSQARVLAIKDEIKILYYKIIYDLLDSIKDSMSELLSPEIRETFLGNAEVLEVFAVTKLGNVAGCKVSEGKVERGSGVRLIRNSTVIYEGKLKTLKRFKDEVSEVHAGQDCGMAFEKYDNIQAGDMIECFSIEHIKRS*
**********NVVEKKTLTLKTSSLGVGHSSFQ*************************************************************************************************************************PEVCDSQQVPEQVLEDPCKEKDLEIKDVDVGTEVESSVILSHD*****************************************************KKYKKVRIAVAADVD********************************ISREIVVPETITIQELSQRMSERSADVIKFLMKEGQIMKPGDVIDADLSEIIANEFGNTVKRVLESDIEVGIFDVADSESDLDIRPPVVTIMGHVDHGKTSLLDAIRKADVAKGEIGGITQHIGAYQVAYQGKNITFLDTPGHAAFYEMRARGARVTDIAVLVLAADEEIMPQAIESINHAKAADVSIIVAINKIDKLGADPQKVRMSLLKHDVFVESMGGDILDVEISAKNNLNLDKLLDAILLQAEMLDLKTSINRKAEGIVVEGKLDRGRGPVVTVLVQKGTLSKGNILVVGDQWGKIRALFNDRGQGISKAVPSMPIEVLGLQGMPMAGDKFGVVDSESRAREIAQYRQRVTRNKSMARRLGSHSALEKLVKNANISSKMKEFPVIIKGDVQGSVEAIVDSLGALKNSEVCLSIVHSSVGAINETDVSLAKASGAVIFGFNVRASSQARVLAIKDEIKILYYKIIYDLLDSIKDSMSELLSPEIRETFLGNAEVLEVFAVTKLGNVAGCKVSEGKVERGSGVRLIRNSTVIYEGKLKTLKRFKDEVSEVHAGQDCGMAFEKYDNIQAGDMIECFSIEHIKRSL
*********SNVVEKKTLTLKTSSLGVGHSSFQNQGANQGRARSVVVETRKRRSYVQGEE***********************************************************RR*ALHEAQVREEELRKR**********************************************VGTEVESSVILSHD***************************************************************************************************KISREIVVPETITIQELSQRMSERSADVIKFLMKEGQIMKPGDVIDADLSEIIANEFGNTVKRVLESDIEVGIFDVADSESDLDIRPPVVTIMGHVDHGKTSLLDAIRKADVAKGEIGGITQHIGAYQVAYQGKNITFLDTPGHAAFYEMRARGARVTDIAVLVLAADEEIMPQAIESINHAKAADVSIIVAINKIDKLGADPQKVRMSLLKHDVFVESMGGDILDVEISAKNNLNLDKLLDAILLQAEMLDLKTSINRKAEGIVVEGKLDRGRGPVVTVLVQKGTLSKGNILVVGDQWGKIRALFNDRGQGISKAVPSMPIEVLGLQGMPMAGDKFGVVDSESRAREIAQYRQRVTRNKSMARRLGSHSALEKLVKNANISSKMKEFPVIIKGDVQGSVEAIVDSLGALKNSEVCLSIVHSSVGAINETDVSLAKASGAVIFGFNVRASSQARVLAIKDEIKILYYKIIYDLLDSIKDSMSELLSPEIRETFLGNAEVLEVFAVTKLGNVAGCKVSEGKVERGSGVRLIRNSTVIYEGKLKTLKRFKDEVSEVHAGQDCGMAFEKYDNIQAGDMIECFSIEHIKRS*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTDNKDNKKSNVVEKKTLTLKTSSLGVGHSSFQNQGANQGRARSVVVETRKRRSYVQGEEKVSVFRKSSRVIESSSDSSQDLSQAKAKGNFRRASRSDKVSSQKNDSSFAGLSQGExxxxxxxxxxxxxxxxxxxxxxxxxxxxQPSQESSIDLPEVCDSQQVPEQVLEDPCKEKDLEIKDVDVGTEVESSVILSHDMGDSDSSSVVNNKFRESSSDASSNRGKSRGGAGKYASVNSSKPVTRNKVGDDDKKYKKVRIAVAADVDEEGGASRGRSxxxxxxxxxxxxxxxxxxxxxKISREIVVPETITIQELSQRMSERSADVIKFLMKEGQIMKPGDVIDADLSEIIANEFGNTVKRVLESDIEVGIFDVADSESDLDIRPPVVTIMGHVDHGKTSLLDAIRKADVAKGEIGGITQHIGAYQVAYQGKNITFLDTPGHAAFYEMRARGARVTDIAVLVLAADEEIMPQAIESINHAKAADVSIIVAINKIDKLGADPQKVRMSLLKHDVFVESMGGDILDVEISAKNNLNLDKLLDAILLQAEMLDLKTSINRKAEGIVVEGKLDRGRGPVVTVLVQKGTLSKGNILVVGDQWGKIRALFNDRGQGISKAVPSMPIEVLGLQGMPMAGDKFGVVDSESRAREIAQYRQRVTRNKSMARRLGSHSALEKLVKNANISSKMKEFPVIIKGDVQGSVEAIVDSLGALKNSEVCLSIVHSSVGAINETDVSLAKASGAVIFGFNVRASSQARVLAIKDEIKILYYKIIYDLLDSIKDSMSELLSPEIRETFLGNAEVLEVFAVTKLGNVAGCKVSEGKVERGSGVRLIRNSTVIYEGKLKTLKRFKDEVSEVHAGQDCGMAFEKYDNIQAGDMIECFSIEHIKRSL
MTDNKDNKKSNVVEKKTLTLKTSSLGVGHSSFQNQGANQGRARSVVVETRKRRSYVQGEEKVSVFRKSSRVIESSSDSSQDLSQAKAKGNFRRASRSDKVSSQKNDSSFAGLSQGEIESRRRALHEAQVREEELRKRLEQQSLEQPSQESSIDLPEVCDSQQVPEQVLEDPCKEKDLEIKDVDVGTEVESSVILSHDMGDSDSSSVVNNKFRESSSDASSNRGKSRGGAGKYASVNSSKPVTRNKVGDDDKKYKKVRIAVAADVDEEGGASRGRSLSAMRRRQEKFRRNQQQEKREKISREIVVPETITIQELSQRMSERSADVIKFLMKEGQIMKPGDVIDADLSEIIANEFGNTVKRVLESDIEVGIFDVADSESDLDIRPPVVTIMGHVDHGKTSLLDAIRKADVAKGEIGGITQHIGAYQVAYQGKNITFLDTPGHAAFYEMRARGARVTDIAVLVLAADEEIMPQAIESINHAKAADVSIIVAINKIDKLGADPQKVRMSLLKHDVFVESMGGDILDVEISAKNNLNLDKLLDAILLQAEMLDLKTSINRKAEGIVVEGKLDRGRGPVVTVLVQKGTLSKGNILVVGDQWGKIRALFNDRGQGISKAVPSMPIEVLGLQGMPMAGDKFGVVDSESRAREIAQYRQRVTRNKSMARRLGSHSALEKLVKNANISSKMKEFPVIIKGDVQGSVEAIVDSLGALKNSEVCLSIVHSSVGAINETDVSLAKASGAVIFGFNVRASSQARVLAIKDEIKILYYKIIYDLLDSIKDSMSELLSPEIRETFLGNAEVLEVFAVTKLGNVAGCKVSEGKVERGSGVRLIRNSTVIYEGKLKTLKRFKDEVSEVHAGQDCGMAFEKYDNIQAGDMIECFSIEHIKRSL
MTDNKDNKKSNVVEKKTLTLKTSSLGVGHSSFQNQGANQGRARSVVVETRKRRSYVQGEEKVSVFRKSSRVIESSSDSSQDLSQAKAKGNFRRASRSDKVSSQKNDSSFAGLSQGEIESRRRALHEAQVREEELRKRLEQQSLEQPSQESSIDLPEVCDSQQVPEQVLEDPCKEKDLEIKDVDVGTEVESSVILSHDMGDSDSSSVVNNKFRESSSDASSNRGKSRGGAGKYASVNSSKPVTRNKVGDDDKKYKKVRIAVAADVDEEGGASRGRSLSAMRRRQEKFRRNQQQEKREKISREIVVPETITIQELSQRMSERSADVIKFLMKEGQIMKPGDVIDADLSEIIANEFGNTVKRVLESDIEVGIFDVADSESDLDIRPPVVTIMGHVDHGKTSLLDAIRKADVAKGEIGGITQHIGAYQVAYQGKNITFLDTPGHAAFYEMRARGARVTDIAVLVLAADEEIMPQAIESINHAKAADVSIIVAINKIDKLGADPQKVRMSLLKHDVFVESMGGDILDVEISAKNNLNLDKLLDAILLQAEMLDLKTSINRKAEGIVVEGKLDRGRGPVVTVLVQKGTLSKGNILVVGDQWGKIRALFNDRGQGISKAVPSMPIEVLGLQGMPMAGDKFGVVDSESRAREIAQYRQRVTRNKSMARRLGSHSALEKLVKNANISSKMKEFPVIIKGDVQGSVEAIVDSLGALKNSEVCLSIVHSSVGAINETDVSLAKASGAVIFGFNVRASSQARVLAIKDEIKILYYKIIYDLLDSIKDSMSELLSPEIRETFLGNAEVLEVFAVTKLGNVAGCKVSEGKVERGSGVRLIRNSTVIYEGKLKTLKRFKDEVSEVHAGQDCGMAFEKYDNIQAGDMIECFSIEHIKRSL

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target884 translation initiation factor IF-2 [Candidatus Liberiba
254780263392 translation elongation factor Tu [Candidatus Liber 6e-10
254780150392 translation elongation factor Tu [Candidatus Liber 6e-10
254780264 701 elongation factor G [Candidatus Liberibacter asiat 1e-09
254780321606 GTP-binding protein LepA [Candidatus Liberibacter 3e-08
254780233624 GTP-binding protein [Candidatus Liberibacter asiat 3e-07
254780809440 tRNA modification GTPase TrmE [Candidatus Liberiba 0.011
>gi|254780263|ref|YP_003064676.1| translation elongation factor Tu [Candidatus Liberibacter asiaticus str. psy62] Length = 392 Back     alignment
 Score = 58.2 bits (139), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 46/128 (35%), Positives = 67/128 (52%), Gaps = 17/128 (13%)

Query: 386 VTIMGHVDHGKTSLLDAIRKA-----------DVAKGE-IGGITQHIGAYQVAYQG--KN 431
           ++ +GHVDHGKT+L  AI K            D A  E + GIT  I    V+Y+   + 
Sbjct: 15  LSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGIT--IATAHVSYETDKRF 72

Query: 432 ITFLDTPGHAAFYEMRARGARVTDIAVLVLAADEEIMPQAIESINHAKAADV-SIIVAIN 490
            + +D PGHA + +    GA   D A+LV AA++   PQ  E I  A+   + SI+V +N
Sbjct: 73  YSHIDCPGHADYVKNMITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMN 132

Query: 491 KIDKLGAD 498
           K+D +  D
Sbjct: 133 KVDAVDDD 140

>gi|254780150|ref|YP_003064563.1| translation elongation factor Tu [Candidatus Liberibacter asiaticus str. psy62] Length = 392 Back     alignment
 Score = 58.2 bits (139), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 46/128 (35%), Positives = 67/128 (52%), Gaps = 17/128 (13%)

Query: 386 VTIMGHVDHGKTSLLDAIRKA-----------DVAKGE-IGGITQHIGAYQVAYQG--KN 431
           ++ +GHVDHGKT+L  AI K            D A  E + GIT  I    V+Y+   + 
Sbjct: 15  LSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGIT--IATAHVSYETDKRF 72

Query: 432 ITFLDTPGHAAFYEMRARGARVTDIAVLVLAADEEIMPQAIESINHAKAADV-SIIVAIN 490
            + +D PGHA + +    GA   D A+LV AA++   PQ  E I  A+   + SI+V +N
Sbjct: 73  YSHIDCPGHADYVKNMITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMN 132

Query: 491 KIDKLGAD 498
           K+D +  D
Sbjct: 133 KVDAVDDD 140

>gi|254780264|ref|YP_003064677.1| elongation factor G [Candidatus Liberibacter asiaticus str. psy62] Length = 701 Back     alignment
 Score = 57.0 bits (136), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 49/193 (25%), Positives = 83/193 (43%), Gaps = 32/193 (16%)

Query: 388 IMGHVDHGKTSLLDAIRKADVAKGEIG------------------GITQHIGAYQVAYQG 429
           IM H+D GKT+  + I        +IG                  GIT    +  V + G
Sbjct: 15  IMAHIDAGKTTTTERILYYAGKSHKIGEVHDGSATMDWMEQEQERGITITSASTTVFWPG 74

Query: 430 -----KNITFLDTPGHAAFYEMRARGARVTDIAVLVLAADEEIMPQAIESINHAKAADVS 484
                K +T +DTPGH  F     R  RVTD A+ +L ++  + PQ       A    V 
Sbjct: 75  RDGGQKKLTIIDTPGHVDFTMEVERSIRVTDGAIALLDSNAGVEPQTETVWRQADKYSVP 134

Query: 485 IIVAINKIDKLGADPQKVRMSLLKHDVFVESMGGDILDVEISAKNNLNLDKLLDAILLQA 544
            ++  NK+DK+GAD  +        ++    +G + L +++   +  N   ++D + ++A
Sbjct: 135 RVIFCNKMDKMGADFYR------SVEMISSRLGANPLVIQLPVGSESNFQGVIDLVEMKA 188

Query: 545 EML---DLKTSIN 554
            +    DL +S +
Sbjct: 189 LLWKNEDLGSSWD 201

>gi|254780321|ref|YP_003064734.1| GTP-binding protein LepA [Candidatus Liberibacter asiaticus str. psy62] Length = 606 Back     alignment
 Score = 52.8 bits (125), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 52/223 (23%), Positives = 96/223 (43%), Gaps = 31/223 (13%)

Query: 387 TIMGHVDHGKTSLLD-----------------AIRKADVAKGEIGGITQHIGAYQVAYQG 429
           +I+ H+DHGK++L D                  +   D+ +    GIT      ++ Y  
Sbjct: 15  SIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERER--GITIKAQTVRLNYTS 72

Query: 430 KN-----ITFLDTPGHAAFYEMRARGARVTDIAVLVLAADEEIMPQAIESINHAKAADVS 484
            +     +  +DTPGH  F    +R     + ++LV+ A + +  Q + ++  A   +  
Sbjct: 73  TDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNHE 132

Query: 485 IIVAINKIDKLGADPQKVRMSLLKHDVFVESMGGDILD-VEISAKNNLNLDKLLDAILLQ 543
           II  +NK D   ADP +V+  +       E++G    D + +SAK    +  LL+ I+ Q
Sbjct: 133 IITVLNKADLPSADPDRVKKQI------EETIGISTEDALLVSAKTGEGIPLLLERIVQQ 186

Query: 544 AEMLDLKTSINRKAEGIVVEGKLDRGRGPVVTVLVQKGTLSKG 586
                     N   + ++++   +   G +V V +  G L+KG
Sbjct: 187 LPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKG 229

>gi|254780233|ref|YP_003064646.1| GTP-binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 624 Back     alignment
 Score = 49.3 bits (116), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 41/145 (28%), Positives = 63/145 (43%), Gaps = 22/145 (15%)

Query: 368 GIFDVADSESDLDIRPPVVTIMGHVDHGKTSLLDAIRKA------------------DVA 409
           G+F +      + IR   + I+ HVDHGKT+L+D + K                   D+ 
Sbjct: 6   GLFFIYGRLGYMQIRN--IAIIAHVDHGKTTLVDELLKQSGVFRDNQRVSERVMDCNDLE 63

Query: 410 KGEIGGITQHIGAYQVAYQGKNITFLDTPGHAAFYEMRARGARVTDIAVLVLAADEEIMP 469
           K    GIT       + +    I  +DTPGHA F     R   + +  V+++ A E  MP
Sbjct: 64  KER--GITILAKVTSIVWNDVRINIVDTPGHADFGGEVERILCMVESVVVLVDAAEGPMP 121

Query: 470 QAIESINHAKAADVSIIVAINKIDK 494
           Q    +  A    +  IV +NK+D+
Sbjct: 122 QTKFVVGKALKIGLRPIVVVNKVDR 146

>gi|254780809|ref|YP_003065222.1| tRNA modification GTPase TrmE [Candidatus Liberibacter asiaticus str. psy62] Length = 440 Back     alignment
 Score = 33.9 bits (76), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 31/55 (56%), Gaps = 1/55 (1%)

Query: 386 VTIMGHVDHGKTSLLDAIRKADVA-KGEIGGITQHIGAYQVAYQGKNITFLDTPG 439
           + I+GH + GK+SL +A+ K DVA   +I G T+ +    +  +G  +   DT G
Sbjct: 222 IVILGHSNAGKSSLFNALAKKDVAIVTDIPGTTRDVLTIDLDLEGYLVKISDTAG 276

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target884 translation initiation factor IF-2 [Candidatus Liberiba
315122009895 translation initiation factor IF-2 [Candidatus Liberiba 1 0.0
222147149926 translation initiation factor IF-2 [Agrobacterium vitis 1 0.0
325291531915 translation initiation factor IF-2 [Agrobacterium sp. H 1 0.0
49473870845 translation initiation factor IF-2 [Bartonella quintana 1 0.0
15887441913 translation initiation factor IF-2 [Agrobacterium tumef 1 0.0
319898337847 translation initiation factor IF-2 [Bartonella clarridg 1 0.0
163757750870 translation initiation factor IF-2 [Hoeflea phototrophi 1 0.0
15963992889 translation initiation factor IF-2 [Sinorhizobium melil 1 0.0
163867511842 translation initiation factor IF-2 [Bartonella tribocor 1 0.0
150398627885 translation initiation factor IF-2 [Sinorhizobium medic 1 0.0
>gi|315122009|ref|YP_004062498.1| translation initiation factor IF-2 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 895 Back     alignment and organism information
 Score = 1328 bits (3437), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 685/895 (76%), Positives = 776/895 (86%), Gaps = 11/895 (1%)

Query: 1   MTDNKDNKKSNVVEKKTLTLKTSSLGVGHSSFQNQGANQ-GRARSVVVETRKRRSYVQGE 59
           MTDNKDNK SNV EKK LTLK SS  V HSSF NQGANQ GRARSVVVETRKRRSY+QG+
Sbjct: 1   MTDNKDNKTSNVTEKKILTLKASSSSVSHSSFPNQGANQQGRARSVVVETRKRRSYIQGD 60

Query: 60  EKVSVFRKSSRVIESSSDSSQDLSQAKAKGNFRRASRSDKVSSQKNDSSFAGLSQGEIES 119
           EKVSVFRKSSRVIESSSD+SQDLSQ+KAK N RR SRS+K S  KNDS+F GLSQ EIES
Sbjct: 61  EKVSVFRKSSRVIESSSDNSQDLSQSKAKDNLRRTSRSEKGSLPKNDSAFGGLSQSEIES 120

Query: 120 RRRALHEAQVREEELRKRLEQQSLEQPSQESSIDLPEVCDSQQVPEQVLE--DPCKEKDL 177
           RRRAL EAQVR+EE R + EQ+SLEQ  QE +I L +  D  Q  E V +  +   +K  
Sbjct: 121 RRRALQEAQVRDEESRIKREQESLEQRYQEKNIILSDSGDENQDFENVFDKKEVFSKKQT 180

Query: 178 EIKDVDVGTE--VESSVILSHDMGDS-----DSSSVVNNKFRESSSDASSNRGKSRGGAG 230
           ++ D DV  E   E+SV+ SH + +      + S +V+NK R+SS D+S +RGKSRGG+ 
Sbjct: 181 DLSDADVAIEAGTEASVLSSHGVNERGFSVVEGSELVSNKSRKSSDDSSGSRGKSRGGSS 240

Query: 231 KYASVNSSKPVTRNKVGDDDKKYKKVRIAVAADVDEEGGASRGRSLSAMRRRQEKFRRNQ 290
           K+ SVN SK   RNK GDD+K+ KK++I  +AD+DEEG +SRGRSLSAMRRRQEKFRR++
Sbjct: 241 KHPSVNPSKLAVRNKAGDDEKRCKKIKIVASADIDEEGDSSRGRSLSAMRRRQEKFRRSK 300

Query: 291 QQEKREKISREIVVPETITIQELSQRMSERSADVIKFLMKEG-QIMKPGDVIDADLSEII 349
           +QEKREKISR+IVV ETITIQELSQRMSERSADVIKFLMKEG Q+MKPGDVIDADLSEII
Sbjct: 301 RQEKREKISRDIVVSETITIQELSQRMSERSADVIKFLMKEGGQMMKPGDVIDADLSEII 360

Query: 350 ANEFGNTVKRVLESDIEVGIFDVADSESDLDIRPPVVTIMGHVDHGKTSLLDAIRKADVA 409
           ANEFG+ VKRVLESD+E+GIFDV DSE  L++RPPVVTIMGHVDHGKTSLLDAIR A+V 
Sbjct: 361 ANEFGHVVKRVLESDVELGIFDVVDSEEHLEVRPPVVTIMGHVDHGKTSLLDAIRNANVV 420

Query: 410 KGEIGGITQHIGAYQVAYQGKNITFLDTPGHAAFYEMRARGARVTDIAVLVLAADEEIMP 469
           KGE+GGITQHIGAYQ  Y+GK ITF+DTPGHAAF EMRARGAR+TD+AVLVLAADEEIMP
Sbjct: 421 KGEVGGITQHIGAYQADYRGKKITFIDTPGHAAFSEMRARGARITDVAVLVLAADEEIMP 480

Query: 470 QAIESINHAKAADVSIIVAINKIDKLGADPQKVRMSLLKHDVFVESMGGDILDVEISAKN 529
           QAIESI HAK+ADVSI+VAINKIDK GA+ QKVRM LL HDVFVESMGG+ILDVEISAK+
Sbjct: 481 QAIESIKHAKSADVSIVVAINKIDKAGANAQKVRMDLLNHDVFVESMGGEILDVEISAKD 540

Query: 530 NLNLDKLLDAILLQAEMLDLKTSINRKAEGIVVEGKLDRGRGPVVTVLVQKGTLSKGNIL 589
           NL+LDKLLD+ILLQAE+L+L+ S NRKAEG+VVEG+LDRG+GPVVTVLVQKGTL  GNIL
Sbjct: 541 NLHLDKLLDSILLQAEILNLRASTNRKAEGVVVEGQLDRGKGPVVTVLVQKGTLRIGNIL 600

Query: 590 VVGDQWGKIRALFNDRGQGISKAVPSMPIEVLGLQGMPMAGDKFGVVDSESRAREIAQYR 649
           VVGD WGKIRALFNDRGQ IS+A+PSMP+E+LGLQG+PMAGD+FGVVDSESRAREI QYR
Sbjct: 601 VVGDHWGKIRALFNDRGQNISEALPSMPVEILGLQGLPMAGDRFGVVDSESRAREITQYR 660

Query: 650 QRVTRNKSMARRLGSHSALEKLVKNANISSKMKEFPVIIKGDVQGSVEAIVDSLGALKNS 709
           +RVTRNKSMARRLGS S LE  ++NA+ISSK+KEF VIIKGDVQGSVEAIV+SL  LK  
Sbjct: 661 KRVTRNKSMARRLGSRSFLENFMRNADISSKVKEFSVIIKGDVQGSVEAIVNSLSELKTD 720

Query: 710 EVCLSIVHSSVGAINETDVSLAKASGAVIFGFNVRASSQARVLAIKDEIKILYYKIIYDL 769
           EVC+SIVHSSVGAINETDVSLAKAS AVIF FNV ASSQAR L+ +D +KILYYKIIYDL
Sbjct: 721 EVCVSIVHSSVGAINETDVSLAKASDAVIFAFNVNASSQARALSTRDGVKILYYKIIYDL 780

Query: 770 LDSIKDSMSELLSPEIRETFLGNAEVLEVFAVTKLGNVAGCKVSEGKVERGSGVRLIRNS 829
           +DSIKD MS+LL PE+RETFLGNAEVLEVF+VTKLGNVAGCKV EGKV RGSGVRL+R+ 
Sbjct: 781 IDSIKDFMSDLLLPEVRETFLGNAEVLEVFSVTKLGNVAGCKVLEGKVARGSGVRLMRDG 840

Query: 830 TVIYEGKLKTLKRFKDEVSEVHAGQDCGMAFEKYDNIQAGDMIECFSIEHIKRSL 884
            V+YEGKLKTLKRFKDEVSEV+ GQDCGMAFEKYDN+QAGDMI+CFSIEH+KRSL
Sbjct: 841 KVMYEGKLKTLKRFKDEVSEVYMGQDCGMAFEKYDNMQAGDMIDCFSIEHVKRSL 895


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222147149|ref|YP_002548106.1| translation initiation factor IF-2 [Agrobacterium vitis S4] Length = 926 Back     alignment and organism information
>gi|325291531|ref|YP_004277395.1| translation initiation factor IF-2 [Agrobacterium sp. H13-3] Length = 915 Back     alignment and organism information
>gi|49473870|ref|YP_031912.1| translation initiation factor IF-2 [Bartonella quintana str. Toulouse] Length = 845 Back     alignment and organism information
>gi|15887441|ref|NP_353122.1| translation initiation factor IF-2 [Agrobacterium tumefaciens str. C58] Length = 913 Back     alignment and organism information
>gi|319898337|ref|YP_004158430.1| translation initiation factor IF-2 [Bartonella clarridgeiae 73] Length = 847 Back     alignment and organism information
>gi|163757750|ref|ZP_02164839.1| translation initiation factor IF-2 [Hoeflea phototrophica DFL-43] Length = 870 Back     alignment and organism information
>gi|15963992|ref|NP_384345.1| translation initiation factor IF-2 [Sinorhizobium meliloti 1021] Length = 889 Back     alignment and organism information
>gi|163867511|ref|YP_001608710.1| translation initiation factor IF-2 [Bartonella tribocorum CIP 105476] Length = 842 Back     alignment and organism information
>gi|150398627|ref|YP_001329094.1| translation initiation factor IF-2 [Sinorhizobium medicae WSM419] Length = 885 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target884 translation initiation factor IF-2 [Candidatus Liberiba
PRK05306787 PRK05306, infB, translation initiation factor IF-2; Val 0.0
TIGR00487587 TIGR00487, IF-2, translation initiation factor IF-2 0.0
KOG1145683 KOG1145, KOG1145, KOG1145, Mitochondrial translation in 1e-157
CHL00189742 CHL00189, infB, translation initiation factor 2; Provis 1e-142
cd01887168 cd01887, IF2_eIF5B, IF2/eIF5B (initiation factors 2/ eu 2e-71
pfam00009185 pfam00009, GTP_EFTU, Elongation factor Tu GTP binding d 8e-42
cd00881189 cd00881, GTP_translation_factor, GTP translation factor 4e-28
TIGR00231161 TIGR00231, small_GTP, small GTP-binding protein domain 5e-19
cd04171164 cd04171, SelB, SelB subfamily 3e-15
cd01891194 cd01891, TypA_BipA, TypA (tyrosine phosphorylated prote 7e-14
cd01890179 cd01890, LepA, LepA subfamily 3e-13
TIGR03680406 TIGR03680, eif2g_arch, translation initiation factor 2 3e-12
cd00880163 cd00880, Era_like, Era (E 4e-12
cd00882157 cd00882, Ras_like_GTPase, Ras-like GTPase superfamily 2e-11
cd01889192 cd01889, SelB_euk, SelB subfamily 2e-11
cd04168237 cd04168, TetM_like, Tet(M)-like subfamily 4e-11
PRK04000411 PRK04000, PRK04000, translation initiation factor IF-2 6e-10
COG5257415 COG5257, GCD11, Translation initiation factor 2, gamma 1e-09
cd01883219 cd01883, EF1_alpha, Eukaryotic elongation factor 1 (EF1 7e-09
COG1159298 COG1159, Era, GTPase [General function prediction only] 1e-08
PRK05433600 PRK05433, PRK05433, GTP-binding protein LepA; Provision 1e-08
COG5256428 COG5256, TEF1, Translation elongation factor EF-1alpha 3e-08
cd01888203 cd01888, eIF2_gamma, eIF2-gamma (gamma subunit of initi 1e-07
COG1160444 COG1160, COG1160, Predicted GTPases [General function p 2e-07
PRK00089292 PRK00089, era, GTPase Era; Reviewed 3e-06
cd01895174 cd01895, EngA2, EngA2 subfamily 7e-06
COG0218200 COG0218, COG0218, Predicted GTPase [General function pr 2e-05
COG1100219 COG1100, COG1100, GTPase SAR1 and related small G prote 3e-05
cd01876170 cd01876, YihA_EngB, The YihA (EngB) subfamily 2e-04
COG2895431 COG2895, CysN, GTPases - Sulfate adenylate transferase 3e-04
cd01881176 cd01881, Obg_like, The Obg-like subfamily consists of f 4e-04
TIGR03594429 TIGR03594, GTPase_EngA, ribosome-associated GTPase EngA 4e-04
PRK00093435 PRK00093, PRK00093, GTP-binding protein Der; Reviewed 4e-04
COG2229187 COG2229, COG2229, Predicted GTPase [General function pr 5e-04
COG2262411 COG2262, HflX, GTPases [General function prediction onl 0.002
TIGR00450442 TIGR00450, mnmE_trmE_thdF, tRNA modification GTPase Trm 0.004
TIGR00491590 TIGR00491, aIF-2, translation initiation factor aIF-2/y 2e-35
PRK148451049 PRK14845, PRK14845, translation initiation factor IF-2; 2e-29
COG0532509 COG0532, InfB, Translation initiation factor 2 (IF-2; G 1e-170
pfam11987109 pfam11987, IF-2, Translation-initiation factor 2 1e-33
PRK04004586 PRK04004, PRK04004, translation initiation factor IF-2; 1e-32
COG0480 697 COG0480, FusA, Translation elongation factors (GTPases) 3e-17
PRK12740 668 PRK12740, PRK12740, elongation factor G; Reviewed 1e-15
PRK13351 687 PRK13351, PRK13351, elongation factor G; Reviewed 1e-14
cd04170268 cd04170, EF-G_bact, Elongation factor G (EF-G) subfamil 1e-12
cd04167213 cd04167, Snu114p, Snu114p subfamily 3e-12
KOG0467 887 KOG0467, KOG0467, KOG0467, Translation elongation facto 1e-11
cd01884195 cd01884, EF_Tu, EF-Tu subfamily 1e-11
KOG0468 971 KOG0468, KOG0468, KOG0468, U5 snRNP-specific protein [T 2e-11
CHL00071409 CHL00071, tufA, elongation factor Tu 6e-11
TIGR00484 689 TIGR00484, EF-G, translation elongation factor EF-G 4e-10
PRK12735396 PRK12735, PRK12735, elongation factor Tu; Reviewed 4e-10
KOG0465 721 KOG0465, KOG0465, KOG0465, Mitochondrial elongation fac 7e-10
PRK00049396 PRK00049, PRK00049, elongation factor Tu; Reviewed 8e-10
COG4108528 COG4108, PrfC, Peptide chain release factor RF-3 [Trans 1e-09
PRK10512 614 PRK10512, PRK10512, selenocysteinyl-tRNA-specific trans 1e-09
cd01885222 cd01885, EF2, EF2 (for archaea and eukarya) 2e-09
PLN03127447 PLN03127, PLN03127, Elongation factor Tu; Provisional 2e-09
TIGR00485394 TIGR00485, EF-Tu, translation elongation factor TU 5e-09
PRK12317425 PRK12317, PRK12317, elongation factor 1-alpha; Reviewed 6e-09
pfam01926106 pfam01926, MMR_HSR1, GTPase of unknown function 2e-08
KOG0464 753 KOG0464, KOG0464, KOG0464, Elongation factor G [Transla 3e-08
PRK07560 731 PRK07560, PRK07560, elongation factor EF-2; Reviewed 3e-08
TIGR00483426 TIGR00483, EF-1_alpha, translation elongation factor EF 6e-08
TIGR00490 720 TIGR00490, aEF-2, translation elongation factor aEF-2 7e-08
PLN03126478 PLN03126, PLN03126, Elongation factor Tu; Provisional 2e-07
PRK10218607 PRK10218, PRK10218, GTP-binding protein; Provisional 3e-07
cd04169267 cd04169, RF3, RF3 subfamily 1e-06
cd01886270 cd01886, EF-G, Elongation factor G (EF-G) subfamily 2e-06
TIGR00503527 TIGR00503, prfC, peptide chain release factor 3 7e-06
PTZ00416 836 PTZ00416, PTZ00416, elongation factor 2; Provisional 3e-04
PRK12739 691 PRK12739, PRK12739, elongation factor G; Reviewed 4e-04
PRK00741526 PRK00741, prfC, peptide chain release factor 3; Provisi 5e-04
KOG0469 842 KOG0469, KOG0469, KOG0469, Elongation factor 2 [Transla 0.003
cd0370295 cd03702, IF2_mtIF2_II, This family represents the domai 6e-31
cd0370195 cd03701, IF2_IF5B_II, IF2_IF5B_II: This family represen 8e-27
cd0369284 cd03692, mtIF2_IVc, mtIF2_IVc: this family represents t 3e-26
cd0134283 cd01342, Translation_Factor_II_like, Translation_Factor 1e-09
pfam0314470 pfam03144, GTP_EFTU_D2, Elongation factor Tu domain 2 5e-04
KOG11441064 KOG1144, KOG1144, KOG1144, Translation initiation facto 3e-26
KOG0462650 KOG0462, KOG0462, KOG0462, Elongation factor-type GTP-b 5e-15
TIGR00475581 TIGR00475, selB, selenocysteine-specific elongation fac 9e-15
COG1217603 COG1217, TypA, Predicted membrane GTPase involved in st 1e-14
TIGR01394594 TIGR01394, TypA_BipA, GTP-binding protein TypA/BipA 2e-14
COG0481603 COG0481, LepA, Membrane GTPase LepA [Cell envelope biog 1e-13
TIGR01393595 TIGR01393, lepA, GTP-binding protein LepA 2e-13
COG3276447 COG3276, SelB, Selenocysteine-specific translation elon 3e-13
KOG0460449 KOG0460, KOG0460, KOG0460, Mitochondrial translation el 3e-12
COG0050394 COG0050, TufB, GTPases - translation elongation factors 2e-11
PRK12736394 PRK12736, PRK12736, elongation factor Tu; Reviewed 5e-11
COG1160444 COG1160, COG1160, Predicted GTPases [General function p 2e-07
KOG0461522 KOG0461, KOG0461, KOG0461, Selenocysteine-specific elon 2e-07
COG5258527 COG5258, GTPBP1, GTPase [General function prediction on 0.001
PRK04004586 PRK04004, PRK04004, translation initiation factor IF-2; 1e-14
pfam0476052 pfam04760, IF2_N, Translation initiation factor IF-2, N 8e-06
COG0486454 COG0486, ThdF, Predicted GTPase [General function predi 9e-06
cd04163168 cd04163, Era, Era subfamily 1e-05
cd01894157 cd01894, EngA1, EngA1 subfamily 3e-04
cd04147198 cd04147, Ras_dva, Ras-dva subfamily 0.001
KOG0458603 KOG0458, KOG0458, KOG0458, Elongation factor 1 alpha [T 0.003
KOG0466466 KOG0466, KOG0466, KOG0466, Translation initiation facto 0.004
KOG0459501 KOG0459, KOG0459, KOG0459, Polypeptide release factor 3 4e-05
PTZ00327460 PTZ00327, PTZ00327, eukaryotic translation initiation f 5e-05
cd01878204 cd01878, HflX, HflX subfamily 2e-04
>gnl|CDD|180006 PRK05306, infB, translation initiation factor IF-2; Validated Back     alignment and domain information
>gnl|CDD|161900 TIGR00487, IF-2, translation initiation factor IF-2 Back     alignment and domain information
>gnl|CDD|36360 KOG1145, KOG1145, KOG1145, Mitochondrial translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|177089 CHL00189, infB, translation initiation factor 2; Provisional Back     alignment and domain information
>gnl|CDD|133287 cd01887, IF2_eIF5B, IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily Back     alignment and domain information
>gnl|CDD|143801 pfam00009, GTP_EFTU, Elongation factor Tu GTP binding domain Back     alignment and domain information
>gnl|CDD|133257 cd00881, GTP_translation_factor, GTP translation factor family Back     alignment and domain information
>gnl|CDD|161778 TIGR00231, small_GTP, small GTP-binding protein domain Back     alignment and domain information
>gnl|CDD|133371 cd04171, SelB, SelB subfamily Back     alignment and domain information
>gnl|CDD|133291 cd01891, TypA_BipA, TypA (tyrosine phosphorylated protein A)/BipA subfamily Back     alignment and domain information
>gnl|CDD|133290 cd01890, LepA, LepA subfamily Back     alignment and domain information
>gnl|CDD|163393 TIGR03680, eif2g_arch, translation initiation factor 2 subunit gamma Back     alignment and domain information
>gnl|CDD|133256 cd00880, Era_like, Era (E Back     alignment and domain information
>gnl|CDD|133258 cd00882, Ras_like_GTPase, Ras-like GTPase superfamily Back     alignment and domain information
>gnl|CDD|133289 cd01889, SelB_euk, SelB subfamily Back     alignment and domain information
>gnl|CDD|133368 cd04168, TetM_like, Tet(M)-like subfamily Back     alignment and domain information
>gnl|CDD|179703 PRK04000, PRK04000, translation initiation factor IF-2 subunit gamma; Validated Back     alignment and domain information
>gnl|CDD|34854 COG5257, GCD11, Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|133283 cd01883, EF1_alpha, Eukaryotic elongation factor 1 (EF1) alpha subfamily Back     alignment and domain information
>gnl|CDD|31353 COG1159, Era, GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|180078 PRK05433, PRK05433, GTP-binding protein LepA; Provisional Back     alignment and domain information
>gnl|CDD|34853 COG5256, TEF1, Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|133288 cd01888, eIF2_gamma, eIF2-gamma (gamma subunit of initiation factor 2) Back     alignment and domain information
>gnl|CDD|31354 COG1160, COG1160, Predicted GTPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|178854 PRK00089, era, GTPase Era; Reviewed Back     alignment and domain information
>gnl|CDD|133295 cd01895, EngA2, EngA2 subfamily Back     alignment and domain information
>gnl|CDD|30567 COG0218, COG0218, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|31297 COG1100, COG1100, GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>gnl|CDD|133278 cd01876, YihA_EngB, The YihA (EngB) subfamily Back     alignment and domain information
>gnl|CDD|32720 COG2895, CysN, GTPases - Sulfate adenylate transferase subunit 1 [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|133281 cd01881, Obg_like, The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1 Back     alignment and domain information
>gnl|CDD|163343 TIGR03594, GTPase_EngA, ribosome-associated GTPase EngA Back     alignment and domain information
>gnl|CDD|178858 PRK00093, PRK00093, GTP-binding protein Der; Reviewed Back     alignment and domain information
>gnl|CDD|32410 COG2229, COG2229, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|32443 COG2262, HflX, GTPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|161885 TIGR00450, mnmE_trmE_thdF, tRNA modification GTPase TrmE Back     alignment and domain information
>gnl|CDD|129582 TIGR00491, aIF-2, translation initiation factor aIF-2/yIF-2 Back     alignment and domain information
>gnl|CDD|184848 PRK14845, PRK14845, translation initiation factor IF-2; Provisional Back     alignment and domain information
>gnl|CDD|30878 COG0532, InfB, Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|152422 pfam11987, IF-2, Translation-initiation factor 2 Back     alignment and domain information
>gnl|CDD|179704 PRK04004, PRK04004, translation initiation factor IF-2; Validated Back     alignment and domain information
>gnl|CDD|30828 COG0480, FusA, Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|183713 PRK12740, PRK12740, elongation factor G; Reviewed Back     alignment and domain information
>gnl|CDD|183990 PRK13351, PRK13351, elongation factor G; Reviewed Back     alignment and domain information
>gnl|CDD|133370 cd04170, EF-G_bact, Elongation factor G (EF-G) subfamily Back     alignment and domain information
>gnl|CDD|133367 cd04167, Snu114p, Snu114p subfamily Back     alignment and domain information
>gnl|CDD|35688 KOG0467, KOG0467, KOG0467, Translation elongation factor 2/ribosome biogenesis protein RIA1 and related proteins [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|133284 cd01884, EF_Tu, EF-Tu subfamily Back     alignment and domain information
>gnl|CDD|35689 KOG0468, KOG0468, KOG0468, U5 snRNP-specific protein [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|177010 CHL00071, tufA, elongation factor Tu Back     alignment and domain information
>gnl|CDD|129575 TIGR00484, EF-G, translation elongation factor EF-G Back     alignment and domain information
>gnl|CDD|183708 PRK12735, PRK12735, elongation factor Tu; Reviewed Back     alignment and domain information
>gnl|CDD|35686 KOG0465, KOG0465, KOG0465, Mitochondrial elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|178823 PRK00049, PRK00049, elongation factor Tu; Reviewed Back     alignment and domain information
>gnl|CDD|33865 COG4108, PrfC, Peptide chain release factor RF-3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|182508 PRK10512, PRK10512, selenocysteinyl-tRNA-specific translation factor; Provisional Back     alignment and domain information
>gnl|CDD|133285 cd01885, EF2, EF2 (for archaea and eukarya) Back     alignment and domain information
>gnl|CDD|178673 PLN03127, PLN03127, Elongation factor Tu; Provisional Back     alignment and domain information
>gnl|CDD|129576 TIGR00485, EF-Tu, translation elongation factor TU Back     alignment and domain information
>gnl|CDD|183433 PRK12317, PRK12317, elongation factor 1-alpha; Reviewed Back     alignment and domain information
>gnl|CDD|145217 pfam01926, MMR_HSR1, GTPase of unknown function Back     alignment and domain information
>gnl|CDD|35685 KOG0464, KOG0464, KOG0464, Elongation factor G [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|181029 PRK07560, PRK07560, elongation factor EF-2; Reviewed Back     alignment and domain information
>gnl|CDD|129574 TIGR00483, EF-1_alpha, translation elongation factor EF-1 alpha Back     alignment and domain information
>gnl|CDD|129581 TIGR00490, aEF-2, translation elongation factor aEF-2 Back     alignment and domain information
>gnl|CDD|178672 PLN03126, PLN03126, Elongation factor Tu; Provisional Back     alignment and domain information
>gnl|CDD|104396 PRK10218, PRK10218, GTP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|133369 cd04169, RF3, RF3 subfamily Back     alignment and domain information
>gnl|CDD|133286 cd01886, EF-G, Elongation factor G (EF-G) subfamily Back     alignment and domain information
>gnl|CDD|129594 TIGR00503, prfC, peptide chain release factor 3 Back     alignment and domain information
>gnl|CDD|185604 PTZ00416, PTZ00416, elongation factor 2; Provisional Back     alignment and domain information
>gnl|CDD|183712 PRK12739, PRK12739, elongation factor G; Reviewed Back     alignment and domain information
>gnl|CDD|179105 PRK00741, prfC, peptide chain release factor 3; Provisional Back     alignment and domain information
>gnl|CDD|35690 KOG0469, KOG0469, KOG0469, Elongation factor 2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|58093 cd03702, IF2_mtIF2_II, This family represents the domain II of bacterial Initiation Factor 2 (IF2) and its eukaryotic mitochondrial homologue mtIF2 Back     alignment and domain information
>gnl|CDD|58092 cd03701, IF2_IF5B_II, IF2_IF5B_II: This family represents the domain II of prokaryotic Initiation Factor 2 (IF2) and its archeal and eukaryotic homologue aeIF5B Back     alignment and domain information
>gnl|CDD|58083 cd03692, mtIF2_IVc, mtIF2_IVc: this family represents the C2 subdomain of domain IV of mitochondrial translation initiation factor 2 (mtIF2) which adopts a beta-barrel fold displaying a high degree of structural similarity with domain II of the translation elongation factor EF-Tu Back     alignment and domain information
>gnl|CDD|58078 cd01342, Translation_Factor_II_like, Translation_Factor_II_like: Elongation factor Tu (EF-Tu) domain II-like proteins Back     alignment and domain information
>gnl|CDD|145992 pfam03144, GTP_EFTU_D2, Elongation factor Tu domain 2 Back     alignment and domain information
>gnl|CDD|36359 KOG1144, KOG1144, KOG1144, Translation initiation factor 5B (eIF-5B) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|35683 KOG0462, KOG0462, KOG0462, Elongation factor-type GTP-binding protein [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|129567 TIGR00475, selB, selenocysteine-specific elongation factor SelB Back     alignment and domain information
>gnl|CDD|31410 COG1217, TypA, Predicted membrane GTPase involved in stress response [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|162336 TIGR01394, TypA_BipA, GTP-binding protein TypA/BipA Back     alignment and domain information
>gnl|CDD|30829 COG0481, LepA, Membrane GTPase LepA [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|130460 TIGR01393, lepA, GTP-binding protein LepA Back     alignment and domain information
>gnl|CDD|33087 COG3276, SelB, Selenocysteine-specific translation elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|35681 KOG0460, KOG0460, KOG0460, Mitochondrial translation elongation factor Tu [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|30399 COG0050, TufB, GTPases - translation elongation factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|183709 PRK12736, PRK12736, elongation factor Tu; Reviewed Back     alignment and domain information
>gnl|CDD|31354 COG1160, COG1160, Predicted GTPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|35682 KOG0461, KOG0461, KOG0461, Selenocysteine-specific elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|34855 COG5258, GTPBP1, GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|179704 PRK04004, PRK04004, translation initiation factor IF-2; Validated Back     alignment and domain information
>gnl|CDD|147093 pfam04760, IF2_N, Translation initiation factor IF-2, N-terminal region Back     alignment and domain information
>gnl|CDD|30833 COG0486, ThdF, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|133363 cd04163, Era, Era subfamily Back     alignment and domain information
>gnl|CDD|133294 cd01894, EngA1, EngA1 subfamily Back     alignment and domain information
>gnl|CDD|133347 cd04147, Ras_dva, Ras-dva subfamily Back     alignment and domain information
>gnl|CDD|35679 KOG0458, KOG0458, KOG0458, Elongation factor 1 alpha [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|35687 KOG0466, KOG0466, KOG0466, Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|35680 KOG0459, KOG0459, KOG0459, Polypeptide release factor 3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|185557 PTZ00327, PTZ00327, eukaryotic translation initiation factor 2 gamma subunit; Provisional Back     alignment and domain information
>gnl|CDD|133279 cd01878, HflX, HflX subfamily Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 884 translation initiation factor IF-2 [Candidatus Liberiba
PRK05306839 infB translation initiation factor IF-2; Validated 100.0
CHL00189770 infB translation initiation factor 2; Provisional 100.0
PRK12312610 infB translation initiation factor IF-2; Provisional 100.0
KOG1145683 consensus 100.0
TIGR00487594 IF-2 translation initiation factor IF-2; InterPro: IPR0 100.0
COG0532509 InfB Translation initiation factor 2 (IF-2; GTPase) [Tr 100.0
PRK04004592 translation initiation factor IF-2; Validated 100.0
KOG11441064 consensus 100.0
TIGR004911145 aIF-2 translation initiation factor aIF-2; InterPro: IP 100.0
cd01887168 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic i 100.0
cd01889192 SelB_euk SelB subfamily. SelB is an elongation factor n 100.0
cd01891194 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA 100.0
cd00881189 GTP_translation_factor GTP translation factor family. T 100.0
cd01888203 eIF2_gamma eIF2-gamma (gamma subunit of initiation fact 100.0
cd01884195 EF_Tu EF-Tu subfamily. This subfamily includes ortholog 100.0
cd01890179 LepA LepA subfamily. LepA belongs to the GTPase family 100.0
cd04166208 CysN_ATPS CysN_ATPS subfamily. CysN, together with prot 100.0
cd01883219 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha su 100.0
cd04171164 SelB SelB subfamily. SelB is an elongation factor neede 100.0
pfam00009185 GTP_EFTU Elongation factor Tu GTP binding domain. This 100.0
cd04165224 GTPBP1_like GTPBP1-like. Mammalian GTP binding protein 99.97
cd01895174 EngA2 EngA2 subfamily. This CD represents the second GT 99.85
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) is a 99.84
cd01876170 YihA_EngB The YihA (EngB) subfamily. This subfamily of 99.82
cd00880163 Era_like Era (E. coli Ras-like protein)-like. This fami 99.82
PRK00454196 engB GTPase EngB; Reviewed 99.78
TIGR03598179 GTPase_YsxC ribosome biogenesis GTP-binding protein Ysx 99.77
PRK00089296 era GTP-binding protein Era; Reviewed 99.76
cd01894157 EngA1 EngA1 subfamily. This CD represents the first GTP 99.76
PRK00093438 engA GTP-binding protein EngA; Reviewed 99.75
PRK09518714 bifunctional cytidylate kinase/GTP-binding protein; Rev 99.74
PRK03003474 engA GTP-binding protein EngA; Reviewed 99.72
PRK04213195 GTP-binding protein; Provisional 99.7
pfam10662143 PduV-EutP Ethanolamine utilisation - propanediol utilis 99.69
cd04164157 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein foun 99.68
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf family 99.68
TIGR03594429 GTPase_EngA ribosome-associated GTPase EngA. EngA (YfgK 99.67
PRK03003474 engA GTP-binding protein EngA; Reviewed 99.66
pfam02421188 FeoB_N Ferrous iron transport protein B. Escherichia co 99.66
PRK00093438 engA GTP-binding protein EngA; Reviewed 99.65
cd01878204 HflX HflX subfamily. A distinct conserved domain with a 99.65
pfam00025174 Arf ADP-ribosylation factor family. Pfam combines a num 99.64
cd01879158 FeoB Ferrous iron transport protein B (FeoB) subfamily. 99.63
cd01897168 NOG NOG1 is a nucleolar GTP-binding protein present in 99.63
TIGR03594429 GTPase_EngA ribosome-associated GTPase EngA. EngA (YfgK 99.62
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) sm 99.61
COG1159298 Era GTPase [General function prediction only] 99.59
PRK09518714 bifunctional cytidylate kinase/GTP-binding protein; Rev 99.59
cd04154173 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are memb 99.58
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related protein 1) 99.57
COG1160444 Predicted GTPases [General function prediction only] 99.56
COG2229187 Predicted GTPase [General function prediction only] 99.55
cd01898170 Obg Obg subfamily. The Obg nucleotide binding protein s 99.54
cd04153174 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) and Ar 99.5
TIGR00231186 small_GTP small GTP-binding protein domain; InterPro: I 99.5
cd04151158 Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes to the 99.48
cd04150159 Arf1_5_like Arf1-Arf5-like subfamily. This subfamily co 99.47
cd04149168 Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor 6) p 99.47
COG1160444 Predicted GTPases [General function prediction only] 99.46
cd04159159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was identif 99.45
cd04157162 Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a subfamil 99.44
pfam00071162 Ras Ras family. Includes sub-families Ras, Rab, Rac, Ra 99.42
cd00882157 Ras_like_GTPase Ras-like GTPase superfamily. The Ras-li 99.42
cd01881176 Obg_like The Obg-like subfamily consists of five well-d 99.42
PTZ00133182 ADP-ribosylation factor; Provisional 99.41
smart00177175 ARF ARF-like small GTPases; ARF, ADP-ribosylation facto 99.4
cd04156160 ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor suppres 99.37
cd04152183 Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) is hig 99.37
cd04158169 ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor doma 99.37
cd00879190 Sar1 Sar1 subfamily. Sar1 is an essential component of 99.36
TIGR03156351 GTP_HflX GTP-binding protein HflX. This protein family 99.36
cd01896233 DRG The developmentally regulated GTP-binding protein ( 99.35
COG0218200 Predicted GTPase [General function prediction only] 99.34
cd04161167 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 (Arl2- 99.32
cd00154159 Rab Rab family. Rab GTPases form the largest family wit 99.31
cd01862172 Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase that re 99.3
cd00157171 Rho Rho (Ras homology) family. Members of the Rho famil 99.29
cd04147198 Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-ventra 99.25
cd01870175 RhoA_like RhoA-like subfamily. The RhoA subfamily consi 99.25
smart00178184 SAR Sar1p-like members of the Ras-family of small GTPas 99.24
cd01874175 Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPase tha 99.24
cd04116170 Rab9 Rab9 subfamily. Rab9 is found in late endosomes, t 99.24
smart00173164 RAS Ras subfamily of RAS small GTPases. Similar in fold 99.23
cd01863161 Rab18 Rab18 subfamily. Mammalian Rab18 is implicated in 99.23
cd04162164 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9 (Arf- 99.23
cd04132187 Rho4_like Rho4-like subfamily. Rho4 is a GTPase that co 99.23
cd04130173 Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive Cdc42 99.22
PRK11058426 putative GTPase HflX; Provisional 99.21
cd00876160 Ras Ras family. The Ras family of the Ras superfamily i 99.21
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases are imp 99.21
cd04124161 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily. Rab 99.2
cd04138162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, N-Ra 99.2
cd04128182 Spg1 Spg1p. Spg1p (septum-promoting GTPase) was first i 99.19
cd01893166 Miro1 Miro1 subfamily. Miro (mitochondrial Rho) protein 99.18
cd04139164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) subfa 99.18
cd04135174 Tc10 TC10 subfamily. TC10 is a Rho family protein that 99.18
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in many p 99.18
cd01864165 Rab19 Rab19 subfamily. Rab19 proteins are associated wi 99.17
cd04134189 Rho3 Rho3 subfamily. Rho3 is a member of the Rho family 99.17
cd04176163 Rap2 Rap2 subgroup. The Rap2 subgroup is part of the Ra 99.17
cd04177168 RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the Rap s 99.16
smart00174174 RHO Rho (Ras homology) subfamily of Ras-like small GTPa 99.16
cd04136163 Rap_like Rap-like subfamily. The Rap subfamily consists 99.16
cd04123162 Rab21 Rab21 subfamily. The localization and function of 99.16
cd01860163 Rab5_related Rab5-related subfamily. This subfamily inc 99.15
cd01868165 Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 are cl 99.15
cd04113161 Rab4 Rab4 subfamily. Rab4 has been implicated in numero 99.15
cd01867167 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Ypt2 ar 99.15
cd04112191 Rab26 Rab26 subfamily. First identified in rat pancreat 99.15
cd04137180 RheB Rheb (Ras Homolog Enriched in Brain) subfamily. Rh 99.14
PTZ00132209 GTP-binding nuclear protein; Provisional 99.14
cd04145164 M_R_Ras_like M-Ras/R-Ras-like subfamily. This subfamily 99.14
cd00877166 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily o 99.14
cd04125188 RabA_like RabA-like subfamily. RabA was first identifie 99.13
cd04144190 Ras2 Ras2 subfamily. The Ras2 subfamily, found exclusiv 99.12
PRK05291445 trmE tRNA modification GTPase TrmE; Reviewed 99.12
cd04127180 Rab27A Rab27a subfamily. The Rab27a subfamily consists 99.11
cd01866168 Rab2 Rab2 subfamily. Rab2 is localized on cis-Golgi mem 99.11
cd04107201 Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38 are 99.1
cd04118193 Rab24 Rab24 subfamily. Rab24 is distinct from other Rab 99.09
cd04175164 Rap1 Rap1 subgroup. The Rap1 subgroup is part of the Ra 99.09
cd01871174 Rac1_like Rac1-like subfamily. The Rac1-like subfamily 99.09
cd04141172 Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like protei 99.08
cd04108170 Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found primari 99.07
cd04126220 Rab20 Rab20 subfamily. Rab20 is one of several Rab prot 99.07
cd04110199 Rab35 Rab35 subfamily. Rab35 is one of several Rab prot 99.06
cd04143247 Rhes_like Rhes_like subfamily. This subfamily includes 99.06
cd04121189 Rab40 Rab40 subfamily. This subfamily contains Rab40a, 99.06
cd04122166 Rab14 Rab14 subfamily. Rab14 GTPases are localized to b 99.06
COG0486454 ThdF Predicted GTPase [General function prediction only 99.06
cd04117161 Rab15 Rab15 subfamily. Rab15 colocalizes with the trans 99.05
cd01869166 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in every e 99.05
cd01892169 Miro2 Miro2 subfamily. Miro (mitochondrial Rho) protein 99.05
cd04101164 RabL4 RabL4 (Rab-like4) subfamily. RabL4s are novel pro 99.05
cd04129187 Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that plays 99.05
cd04140165 ARHI_like ARHI subfamily. ARHI (A Ras homolog member I) 99.05
cd01875191 RhoG RhoG subfamily. RhoG is a GTPase with high sequenc 99.05
cd04120202 Rab12 Rab12 subfamily. Rab12 was first identified in ca 99.04
cd01882225 BMS1 Bms1. Bms1 is an essential, evolutionarily conserv 99.04
cd04131178 Rnd Rnd subfamily. The Rnd subfamily contains Rnd1/Rho6 99.04
cd04106162 Rab23_lke Rab23-like subfamily. Rab23 is a member of th 99.03
cd04114169 Rab30 Rab30 subfamily. Rab30 appears to be associated w 99.03
cd01861161 Rab6 Rab6 subfamily. Rab6 is involved in microtubule-de 99.02
cd01865165 Rab3 Rab3 subfamily. The Rab3 subfamily contains Rab3A, 99.01
cd04133176 Rop_like Rop subfamily. The Rop (Rho-related protein fr 99.01
COG2262411 HflX GTPases [General function prediction only] 99.0
cd04115170 Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is ubiqui 98.96
cd04142198 RRP22 RRP22 subfamily. RRP22 (Ras-related protein on ch 98.96
PRK12299334 obgE GTPase ObgE; Reviewed 98.94
COG1100219 GTPase SAR1 and related small G proteins [General funct 98.94
cd04146165 RERG_RasL11_like RERG/RasL11-like subfamily. RERG (Ras- 98.94
PRK09554 772 feoB ferrous iron transport protein B; Reviewed 98.92
cd04111211 Rab39 Rab39 subfamily. Found in eukaryotes, Rab39 is ma 98.91
cd04109215 Rab28 Rab28 subfamily. First identified in maize, Rab28 98.91
cd04172182 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE/Rho8 98.89
cd04148221 RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Kir) su 98.89
COG0370 653 FeoB Fe2+ transport system protein B [Inorganic ion tra 98.87
smart00176200 RAN Ran (Ras-related nuclear proteins) /TC4 subfamily o 98.86
cd04174232 Rnd1_Rho6 Rnd1/Rho6 subfamily. Rnd1/Rho6 is a member of 98.83
cd04173222 Rnd2_Rho7 Rnd2/Rho7 subfamily. Rnd2/Rho7 is a member of 98.82
PRK12298380 obgE GTPase ObgE; Reviewed 98.76
PRK12297429 obgE GTPase ObgE; Reviewed 98.71
KOG1191531 consensus 98.7
cd04103158 Centaurin_gamma Centaurin gamma. The centaurins (alpha, 98.65
COG1084346 Predicted GTPase [General function prediction only] 98.63
KOG2486320 consensus 98.62
PRK12296495 obgE GTPase ObgE; Reviewed 98.61
KOG1423379 consensus 98.6
TIGR00437 733 feoB ferrous iron transport protein B; InterPro: IPR003 98.57
KOG0410410 consensus 98.56
KOG1489366 consensus 98.56
KOG0076197 consensus 98.55
KOG1532366 consensus 98.52
TIGR02528144 EutP ethanolamine utilization protein, EutP; InterPro: 98.5
KOG0394210 consensus 98.49
KOG0092200 consensus 98.44
cd01873195 RhoBTB RhoBTB subfamily. Members of the RhoBTB subfamil 98.43
KOG0070181 consensus 98.35
KOG0078207 consensus 98.29
KOG0098216 consensus 98.27
COG0536369 Obg Predicted GTPase [General function prediction only] 98.08
KOG0084205 consensus 98.07
KOG0073185 consensus 98.0
KOG0094221 consensus 97.89
COG4917148 EutP Ethanolamine utilization protein [Amino acid trans 97.81
KOG0395196 consensus 97.81
PRK13768253 GTPase; Provisional 97.76
pfam03308267 ArgK ArgK protein. The ArgK protein acts as an ATPase e 97.67
COG1703323 ArgK Putative periplasmic protein kinase ArgK and relat 97.63
TIGR00436278 era GTP-binding protein Era; InterPro: IPR005662 Era is 97.58
PRK09435325 arginine/ornithine transport system ATPase; Provisional 97.49
KOG0075186 consensus 97.48
KOG0095213 consensus 97.47
KOG0093193 consensus 97.38
KOG0072182 consensus 97.3
KOG0079198 consensus 97.29
KOG0071180 consensus 97.23
KOG0086214 consensus 97.23
KOG0087222 consensus 97.18
KOG0097215 consensus 97.08
KOG0074185 consensus 96.93
KOG0088218 consensus 96.89
KOG0080209 consensus 96.88
PRK05703412 flhF flagellar biosynthesis regulator FlhF; Validated 96.73
COG0378202 HypB Ni2+-binding GTPase involved in regulation of expr 96.68
KOG1490620 consensus 96.63
KOG1707 625 consensus 96.58
PRK10463290 hydrogenase nickel incorporation protein HypB; Provisio 96.26
KOG0091213 consensus 95.96
PRK06995404 flhF flagellar biosynthesis regulator FlhF; Validated 95.14
PRK12727557 flagellar biosynthesis regulator FlhF; Provisional 95.13
KOG0083192 consensus 94.32
TIGR00750333 lao LAO/AO transport system ATPase; InterPro: IPR005129 94.26
KOG0081219 consensus 93.92
KOG0393198 consensus 91.94
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provisional 90.91
KOG0096216 consensus 90.03
TIGR00475 627 selB selenocysteine-specific translation elongation fac 100.0
TIGR01394609 TypA_BipA GTP-binding protein TypA; InterPro: IPR006298 100.0
TIGR01393598 lepA GTP-binding protein LepA; InterPro: IPR006297 LepA 100.0
PRK10218607 GTP-binding protein; Provisional 100.0
PRK10512 615 selenocysteinyl-tRNA-specific translation factor; Provi 100.0
PRK05433601 GTP-binding protein LepA; Provisional 100.0
PRK00049397 elongation factor Tu; Reviewed 100.0
PRK12735396 elongation factor Tu; Reviewed 100.0
PRK04000410 translation initiation factor IF-2 subunit gamma; Valid 100.0
PRK12317426 elongation factor 1-alpha; Reviewed 100.0
PRK12736394 elongation factor Tu; Reviewed 100.0
CHL00071409 tufA elongation factor Tu 100.0
PTZ00141443 elongation factor 1 alpha; Provisional 100.0
PTZ00336449 elongation factor 1-alpha; Provisional 100.0
KOG0462650 consensus 100.0
PRK13351687 elongation factor G; Reviewed 100.0
PRK12739693 elongation factor G; Reviewed 100.0
PRK12740670 elongation factor G; Reviewed 100.0
PRK05124475 cysN sulfate adenylyltransferase subunit 1; Provisional 100.0
COG1217603 TypA Predicted membrane GTPase involved in stress respo 100.0
PTZ00327460 eukaryotic translation initiation factor 2 gamma subuni 100.0
PRK00007693 elongation factor G; Reviewed 100.0
COG0480697 FusA Translation elongation factors (GTPases) [Translat 100.0
COG0481603 LepA Membrane GTPase LepA [Cell envelope biogenesis, ou 100.0
COG5256428 TEF1 Translation elongation factor EF-1alpha (GTPase) [ 99.98
PRK05506613 bifunctional sulfate adenylyltransferase subunit 1/aden 99.98
COG0050394 TufB GTPases - translation elongation factors [Translat 99.97
COG3276447 SelB Selenocysteine-specific translation elongation fac 99.97
PRK07560 730 elongation factor EF-2; Reviewed 99.97
KOG0460449 consensus 99.97
TIGR00483445 EF-1_alpha translation elongation factor EF-1, subunit 99.97
TIGR00485394 EF-Tu translation elongation factor Tu; InterPro: IPR00 99.93
KOG0461522 consensus 99.93
COG5257415 GCD11 Translation initiation factor 2, gamma subunit (e 99.93
COG2895431 CysN GTPases - Sulfate adenylate transferase subunit 1 99.92
KOG0458603 consensus 99.92
TIGR00484705 EF-G translation elongation factor G; InterPro: IPR0045 99.92
TIGR02034411 CysN sulfate adenylyltransferase, large subunit; InterP 99.9
COG5258527 GTPBP1 GTPase [General function prediction only] 99.88
KOG0464753 consensus 99.83
TIGR00490 724 aEF-2 translation elongation factor aEF-2; InterPro: IP 99.82
KOG0459501 consensus 99.82
KOG0466466 consensus 99.65
KOG0463641 consensus 99.52
KOG1143591 consensus 99.38
cd04167213 Snu114p Snu114p subfamily. Snu114p is one of several pr 99.98
cd01885222 EF2 EF2 (for archaea and eukarya). Translocation requir 99.98
PRK00741526 prfC peptide chain release factor 3; Provisional 99.97
cd04168237 TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), Tet(W) 99.97
cd01886270 EF-G Elongation factor G (EF-G) subfamily. Translocatio 99.95
cd04170268 EF-G_bact Elongation factor G (EF-G) subfamily. Translo 99.95
cd04169267 RF3 RF3 subfamily. Peptide chain release factor 3 (RF3) 99.94
KOG0465 721 consensus 99.92
COG4108528 PrfC Peptide chain release factor RF-3 [Translation, ri 99.81
KOG0468 971 consensus 99.77
TIGR00503530 prfC peptide chain release factor 3; InterPro: IPR00454 99.72
KOG0469 842 consensus 99.71
pfam01926106 MMR_HSR1 GTPase of unknown function. 99.32
cd04105203 SR_beta Signal recognition particle receptor, beta subu 99.2
pfam09439181 SRPRB Signal recognition particle receptor beta subunit 99.18
KOG0052391 consensus 99.1
pfam08477118 Miro Miro-like protein. Mitochondrial Rho proteins (Mir 98.79
COG5192 1077 BMS1 GTP-binding protein required for 40S ribosome biog 98.78
cd04102202 RabL3 RabL3 (Rab-like3) subfamily. RabL3s are novel pro 98.55
pfam00350168 Dynamin_N Dynamin family. 98.4
KOG0090238 consensus 98.18
KOG0077193 consensus 98.16
KOG1954532 consensus 97.92
cd04104197 p47_IIGP_like p47 (47-kDa) family. The p47 GTPase famil 97.64
TIGR02729296 Obg_CgtA GTP-binding protein Obg/CgtA; InterPro: IPR014 97.64
COG3596296 Predicted GTPase [General function prediction only] 97.1
pfam00735280 Septin Septin. Members of this family include CDC3, CDC 97.03
pfam04548200 AIG1 AIG1 family. Arabidopsis protein AIG1 appears to b 96.9
pfam05783490 DLIC Dynein light intermediate chain (DLIC). This famil 96.84
pfam04670230 Gtr1_RagA Gtr1/RagA G protein conserved region. GTR1 wa 96.7
cd01850276 CDC_Septin CDC/Septin. Septins are a conserved family o 96.69
cd01852196 AIG1 AIG1 (avrRpt2-induced gene 1). This represents Ara 96.56
KOG3883198 consensus 96.54
cd03115173 SRP The signal recognition particle (SRP) mediates the 96.53
pfam00448196 SRP54 SRP54-type protein, GTPase domain. This family in 96.18
PRK11537317 putative GTP-binding protein YjiA; Provisional 95.89
TIGR03348 1169 VI_IcmF type VI secretion protein IcmF. Members of this 95.87
pfam02492174 cobW CobW/HypB/UreG, nucleotide-binding domain. This do 95.85
cd01853249 Toc34_like Toc34-like (Translocon at the Outer-envelope 94.82
cd01900274 YchF YchF subfamily. YchF is a member of the Obg family 94.75
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 94.52
KOG1547336 consensus 94.39
COG1161322 Predicted GTPases [General function prediction only] 94.29
COG5019373 CDC3 Septin family protein [Cell division and chromosom 94.22
COG0523323 Putative GTPases (G3E family) [General function predict 94.17
KOG0448749 consensus 92.38
COG3523 1188 IcmF Type VI protein secretion system component VasK [I 92.04
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 92.03
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Validated 91.82
KOG0780483 consensus 91.63
PRK10416499 cell division protein FtsY; Provisional 90.47
KOG2655366 consensus 90.21
cd0369284 mtIF2_IVc mtIF2_IVc: this family represents the C2 subd 99.93
cd0134283 Translation_Factor_II_like Translation_Factor_II_like: 98.62
PRK12317 426 elongation factor 1-alpha; Reviewed 98.37
cd0369391 EF1_alpha_II EF1_alpha_II: this family represents the d 98.15
cd0369787 EFTU_II EFTU_II: Elongation factor Tu domain II. Elonga 98.11
PTZ00336 449 elongation factor 1-alpha; Provisional 98.02
cd0369683 selB_II selB_II: this subfamily represents the domain o 97.97
PTZ00141 443 elongation factor 1 alpha; Provisional 97.93
cd0369883 eRF3_II_like eRF3_II_like: domain similar to domain II 97.87
pfam0314470 GTP_EFTU_D2 Elongation factor Tu domain 2. Elongation f 97.73
cd0369487 GTPBP_II Domain II of the GP-1 family of GTPase. This g 97.68
cd0408982 eRF3_II eRF3_II: domain II of the eukaryotic class II r 97.63
PRK04000410 translation initiation factor IF-2 subunit gamma; Valid 97.61
PRK05124 475 cysN sulfate adenylyltransferase subunit 1; Provisional 97.57
cd0369581 CysN_NodQ_II CysN_NodQ_II: This subfamily represents th 97.5
COG5256 428 TEF1 Translation elongation factor EF-1alpha (GTPase) [ 97.21
PTZ00327460 eukaryotic translation initiation factor 2 gamma subuni 96.66
cd0369186 BipA_TypA_II BipA_TypA_II: domain II of BipA (also call 96.65
cd0408883 EFG_mtEFG_II EFG_mtEFG_II: this subfamily represents th 96.43
cd0369986 lepA_II lepA_II: This subfamily represents the domain I 96.28
cd0368985 RF3_II RF3_II: this subfamily represents the domain II 96.17
cd0409283 mtEFG2_II_like mtEFG2_C: C-terminus of mitochondrial El 95.23
TIGR01393 598 lepA GTP-binding protein LepA; InterPro: IPR006297 LepA 95.11