254780811

254780811

hypothetical protein CLIBASIA_03510

GeneID in NCBI database:8209817Locus tag:CLIBASIA_03510
Protein GI in NCBI database:254780811Protein Accession:YP_003065224.1
Gene range:+(443967, 444503)Protein Length:178aa
Gene description:hypothetical protein
COG prediction:[S] Predicted membrane protein
KEGG prediction:hypothetical protein; K08973 putative membrane protein
SEED prediction:Hypothetical membrane protein, possible involvement in cytochrome functioning/assembly
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Heme and Siroheme Biosynthesis;
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM5 TM-Helix
TOPPRED5 TM-Helix
HMMTOP5 TM-Helix
MEMSAT5 TM-Helix
MEMSAT_SVM5 TM-Helix
PHOBIUS5 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------18
MKFFLSDSIGKKAQAIAFIALFVFLFLSLLCFFFLTSQFNLCIKSIHILSVISWMAGLLYMPRIFVYHSLSAPDTDQYKTFEIMEERLFKVIMNPAMILSWVCGLYLAWKTFYIHIGWLRLKMISVLFLSFYHVYLSFVMRKFRDKKLFHSPKYFKIINEIPTLIMIIIVFLSVIKPF
cccHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHcccc
ccccccccHHHHHcHHHHHHHHHHHHccHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHEEEccc
mkfflsdsIGKKAQAIAFIALFVFLFLSLLCFFFLTSQFNLCIKSIHILSVISWMAGLLYMPrifvyhslsapdtdqykTFEIMEERLFKVIMNPAMILSWVCGLYLAWKTFYIHIGWLRLKMISVLFLSFYHVYLSFVMRkfrdkklfhspkyfkiINEIPTLIMIIIVFLSVIKPF
MKFFLSDSIGKKAQAIAFIALFVFLFLSLLCFFFLTSQFNLCIKSIHILSVISWMAGLLYMPRIFVYHSLSAPDTDQYKTFEIMEERLFKVIMNPAMILSWVCGLYLAWKTFYIHIGWLRLKMISVLFLSFYHVYLSFVMRKFRDKKLFHSPKYFKIINEIPTLIMIIIVFLSVIKPF
MKFFLSDSIGKKAQAIAFIAlfvflflsllcffflTSQFNLCIKSIHILSVISWMAGLLYMPRIFVYHSLSAPDTDQYKTFEIMEERLFKVIMNPAMILSWVCGLYLAWKTFYIHIGWLRLKMISVLFLSFYHVYLSFVMRKFRDKKLFHSPKYFKIINEIPTLIMIIIVFLSVIKPF
***************IAFIALFVFLFLSLLCFFFLTSQFNLCIKSIHILSVISWMAGLLYMPRIFVYHSLSAPDTDQYKTFEIMEERLFKVIMNPAMILSWVCGLYLAWKTFYIHIGWLRLKMISVLFLSFYHVYLSFVMRKFRDKKLFHSPKYFKIINEIPTLIMIIIVFLSVIKPF
MKFFLSDSIGKKAQAIAFIALFVFLFLSLLCFFFLTSQFNLCIKSIHILSVISWMAGLLYMPRIFVYHSLSAPDTDQYKTFEIMEERLFKVIMNPAMILSWVCGLYLAWKTFYIHIGWLRLKMISVLFLSFYHVYLSFVMRKFRDKKLFHSPKYFKIINEIPTLIMIIIVFLSVIKPF
*KFFLSDSIGKKAQAIAFIALFVFLFLSLLCFFFLTSQFNLCIKSIHILSVISWMAGLLYMPRIFVYHSLSAPDTDQYKTFEIMEERLFKVIMNPAMILSWVCGLYLAWKTFYIHIGWLRLKMISVLFLSFYHVYLSFVMRKFRDKKLFHSPKYFKIINEIPTLIMIIIVFLSVIKPF
iiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooo
xxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHx
iiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooo
iiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoo
iiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooo
iiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKFFLSDSIGKKAQAIAFIALFVFLFLSLLCFFFLTSQFNLCIKSIHILSVISWMAGLLYMPRIFVYHSLSAPDTDQYKTFEIMEERLFKVIMNPAMILSWVCGLYLAWKTFYIHIGWLRLKMISVLFLSFYHVYLSFVMRKFRDKKLFHSPKYFKIINEIPTLIMIIIVFLSVIKPF
MKFFLSDSIGKKAQAIAFIALFVFLFLSLLCFFFLTSQFNLCIKSIHILSVISWMAGLLYMPRIFVYHSLSAPDTDQYKTFEIMEERLFKVIMNPAMILSWVCGLYLAWKTFYIHIGWLRLKMISVLFLSFYHVYLSFVMRKFRDKKLFHSPKYFKIINEIPTLIMIIIVFLSVIKPF
MKFFLSDSIGKKAQAIAFIALFVFLFLSLLCFFFLTSQFNLCIKSIHILSVISWMAGLLYMPRIFVYHSLSAPDTDQYKTFEIMEERLFKVIMNPAMILSWVCGLYLAWKTFYIHIGWLRLKMISVLFLSFYHVYLSFVMRKFRDKKLFHSPKYFKIINEIPTLIMIIIVFLSVIKPF

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target178 hypothetical protein CLIBASIA_03510 [Candidatus Liberib
315122034178 hypothetical protein CKC_01420 [Candidatus Liberibacter 1 2e-58
260467195188 conserved hypothetical protein [Mesorhizobium opportuni 1 3e-38
15967093180 hypothetical protein SMc02795 [Sinorhizobium meliloti 1 1 3e-37
227823858179 hypothetical protein NGR_c33480 [Sinorhizobium fredii N 1 4e-37
319780610178 hypothetical protein Mesci_0870 [Mesorhizobium ciceri b 1 6e-37
222087931184 hypothetical protein Arad_4946 [Agrobacterium radiobact 1 8e-37
239833106178 conserved hypothetical protein [Ochrobactrum intermediu 1 1e-36
116254465180 hypothetical protein RL4741 [Rhizobium leguminosarum bv 1 2e-36
325294204181 hypothetical protein AGROH133_09308 [Agrobacterium sp. 1 2e-36
13473779162 integral membrane protein, involvement in cytochrome fu 1 3e-36
>gi|315122034|ref|YP_004062523.1| hypothetical protein CKC_01420 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 178 Back     alignment and organism information
 Score =  228 bits (582), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 134/178 (75%), Positives = 153/178 (85%)

Query: 1   MKFFLSDSIGKKAQAIAFIALFVFLFLSLLCFFFLTSQFNLCIKSIHILSVISWMAGLLY 60
           MKF +SDS GKKAQ IA IALF+FL L L  FFF T QFNLCIKSIHI+S+ISWMAGLLY
Sbjct: 1   MKFLVSDSTGKKAQIIASIALFLFLVLVLFYFFFFTLQFNLCIKSIHIISIISWMAGLLY 60

Query: 61  MPRIFVYHSLSAPDTDQYKTFEIMEERLFKVIMNPAMILSWVCGLYLAWKTFYIHIGWLR 120
           MPRIF+YHSL++P+TDQYKTF IMEERLFKVIMNPAMILSW+CGLYL W   Y  IGW R
Sbjct: 61  MPRIFLYHSLASPETDQYKTFGIMEERLFKVIMNPAMILSWICGLYLIWTVPYTQIGWFR 120

Query: 121 LKMISVLFLSFYHVYLSFVMRKFRDKKLFHSPKYFKIINEIPTLIMIIIVFLSVIKPF 178
           +KMI  L LS YHVYL+F++R F++KK  +SPKYFKIINEIPT+IMI+IVFLS+IKPF
Sbjct: 121 IKMIFTLLLSSYHVYLAFLIRDFKNKKSRYSPKYFKIINEIPTVIMIVIVFLSIIKPF 178


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|260467195|ref|ZP_05813372.1| conserved hypothetical protein [Mesorhizobium opportunistum WSM2075] Length = 188 Back     alignment and organism information
>gi|15967093|ref|NP_387446.1| hypothetical protein SMc02795 [Sinorhizobium meliloti 1021] Length = 180 Back     alignment and organism information
>gi|227823858|ref|YP_002827831.1| hypothetical protein NGR_c33480 [Sinorhizobium fredii NGR234] Length = 179 Back     alignment and organism information
>gi|319780610|ref|YP_004140086.1| hypothetical protein Mesci_0870 [Mesorhizobium ciceri biovar biserrulae WSM1271] Length = 178 Back     alignment and organism information
>gi|222087931|ref|YP_002546469.1| hypothetical protein Arad_4946 [Agrobacterium radiobacter K84] Length = 184 Back     alignment and organism information
>gi|239833106|ref|ZP_04681435.1| conserved hypothetical protein [Ochrobactrum intermedium LMG 3301] Length = 178 Back     alignment and organism information
>gi|116254465|ref|YP_770303.1| hypothetical protein RL4741 [Rhizobium leguminosarum bv. viciae 3841] Length = 180 Back     alignment and organism information
>gi|325294204|ref|YP_004280068.1| hypothetical protein AGROH133_09308 [Agrobacterium sp. H13-3] Length = 181 Back     alignment and organism information
>gi|13473779|ref|NP_105347.1| integral membrane protein, involvement in cytochrome functioning/assembly [Mesorhizobium loti MAFF303099] Length = 162 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target178 hypothetical protein CLIBASIA_03510 [Candidatus Liberib
COG1981149 COG1981, COG1981, Predicted membrane protein [Function 4e-31
TIGR00701142 TIGR00701, TIGR00701, conserved hypothetical integral m 1e-26
pfam03653147 pfam03653, UPF0093, Uncharacterized protein family (UPF 2e-38
>gnl|CDD|32164 COG1981, COG1981, Predicted membrane protein [Function unknown] Back     alignment and domain information
>gnl|CDD|162002 TIGR00701, TIGR00701, conserved hypothetical integral membrane protein Back     alignment and domain information
>gnl|CDD|146343 pfam03653, UPF0093, Uncharacterized protein family (UPF0093) Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 178 hypothetical protein CLIBASIA_03510 [Candidatus Liberib
COG1981149 Predicted membrane protein [Function unknown] 100.0
pfam03653147 UPF0093 Uncharacterized protein family (UPF0093). 100.0
TIGR00701151 TIGR00701 conserved hypothetical protein TIGR00701; Int 100.0
pfam10027150 DUF2269 Predicted integral membrane protein (DUF2269). 98.7
COG5528155 Predicted integral membrane protein [Function unknown] 97.25
COG3094129 Uncharacterized protein conserved in bacteria [Function 96.84
PRK10278130 putative transcriptional regulator; Provisional 96.59
pfam04247122 SirB Invasion gene expression up-regulator, SirB. SirB 96.29
pfam09980150 DUF2214 Predicted membrane protein (DUF2214). This doma 96.0
COG5615161 Predicted integral membrane protein [Function unknown] 92.2
COG3399148 Uncharacterized protein conserved in bacteria [Function 91.01
pfam05425102 CopD Copper resistance protein D. Copper sequestering a 97.5
>COG1981 Predicted membrane protein [Function unknown] Back     alignment and domain information
>pfam03653 UPF0093 Uncharacterized protein family (UPF0093) Back     alignment and domain information
>TIGR00701 TIGR00701 conserved hypothetical protein TIGR00701; InterPro: IPR014351 There is currently no experimental data for members of this entry or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>pfam10027 DUF2269 Predicted integral membrane protein (DUF2269) Back     alignment and domain information
>COG5528 Predicted integral membrane protein [Function unknown] Back     alignment and domain information
>COG3094 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK10278 putative transcriptional regulator; Provisional Back     alignment and domain information
>pfam04247 SirB Invasion gene expression up-regulator, SirB Back     alignment and domain information
>pfam09980 DUF2214 Predicted membrane protein (DUF2214) Back     alignment and domain information
>COG5615 Predicted integral membrane protein [Function unknown] Back     alignment and domain information
>COG3399 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>pfam05425 CopD Copper resistance protein D Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00