254780817

254780817

preprotein translocase subunit SecB

GeneID in NCBI database:8209823Locus tag:CLIBASIA_03540
Protein GI in NCBI database:254780817Protein Accession:YP_003065230.1
Gene range:-(437917, 438375)Protein Length:152aa
Gene description:preprotein translocase subunit SecB
COG prediction:[U] Preprotein translocase subunit SecB
KEGG prediction:secB; preprotein translocase subunit SecB; K03071 preprotein translocase subunit SecB
SEED prediction:Protein export cytoplasm chaperone protein (SecB, maintains protein to be exported in unfolded state)
Pathway involved in KEGG:Protein export [PATH:las03060]
Bacterial secretion system [PATH:las03070]
Subsystem involved in SEED:Glutaredoxins
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150--
MEKKQKQAFTILNQYIKDFSFESPNAPHCFFDIQNQQPTIKINVQVNANTISGADFDVILSFDIEAKNNDKVIFRLELAYSGILRILDCPQEHISQILFVECPQLLFPFVRQIISNTIRDGGFPPLVIDTIDFLKLFQQEKSLIKNKEGLMK
ccccccHHHHHHHHHEEEEcccccccHHHHHcccccccEEEEEEEEccEEccccEEEEEEEEEEEEEccccEEEEEEEEEEEEEEEccccHHHHHHHHHHcccccHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHcc
ccccccccHHHHHEEEEEEEEEccccccccHHHHHccccEEEEEcccccccccccEEEEEEEEEEEEccccEEEEEEEEcccEEEEccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHcccccc
MEKKQKQAFTILNQYIKdfsfespnaphcffdiqnqqptikINVQVNantisgadfDVILSFDIEAKNNDKVIFRLELAYSGILrildcpqehisqilfvecpqllfPFVRQIISNtirdggfpplviDTIDFLKLFQQEKSLIKNKEGLMK
MEKKQKQAFTILNQYIKDFSFESPNAPHCFFDIQNQQPTIKINVQVNANTISGADFDVILSFDIEAKNNDKVIFRLELAYSGILRILDCPQEHISQILFVECPQLLFPFVRQIISNTIRDGGFPPLVIDTIDFLKLFQQEKsliknkeglmk
MEKKQKQAFTILNQYIKDFSFESPNAPHCFFDIQNQQPTIKINVQVNANTISGADFDVILSFDIEAKNNDKVIFRLELAYSGILRILDCPQEHISQILFVECPQLLFPFVRQIISNTIRDGGFPPLVIDTIDFLKLFQQEKSLIKNKEGLMK
**********ILNQYIKDFSFESPNAPHCFFD*****P*IKINVQVNANTISGADFDVILSFDIEAKNNDKVIFRLELAYSGILRILDCPQEHISQILFVECPQLLFPFVRQIISNTIRDGGFPPLVIDTIDFLKL****************
MEKKQKQAFTILNQYIKDFSFESPNAPHCFFDIQNQQPTIKINVQVNANTISGADFDVILSFDIEAKNNDKVIFRLELAYSGILRILDCPQEHISQILFVECPQLLFPFVRQIISNTIRDGGFPPLVIDTIDFLKLFQQEKSLIKNKEGLMK
*****KQAFTILNQYIKDFSFESPNAPHCFFDIQNQQPTIKINVQVNANTISGADFDVILSFDIEAKNNDKVIFRLELAYSGILRILDCPQEHISQILFVECPQLLFPFVRQIISNTIRDGGFPPLVIDTIDFLKLFQQEKSLIKN******
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEKKQKQAFTILNQYIKDFSFESPNAPHCFFDIQNQQPTIKINVQVNANTISGADFDVILSFDIEAKNNDKVIFRLELAYSGILRILDCPQEHISQILFVECPQLLFPFVRQIISNTIRDGGFPPLVIDTIDFLKLFQQEKSLIKNKEGLMK
MEKKQKQAFTILNQYIKDFSFESPNAPHCFFDIQNQQPTIKINVQVNANTISGADFDVILSFDIEAKNNDKVIFRLELAYSGILRILDCPQEHISQILFVECPQLLFPFVRQIISNTIRDGGFPPLVIDTIDFLKLFQQEKSLIKNKEGLMK
MEKKQKQAFTILNQYIKDFSFESPNAPHCFFDIQNQQPTIKINVQVNANTISGADFDVILSFDIEAKNNDKVIFRLELAYSGILRILDCPQEHISQILFVECPQLLFPFVRQIISNTIRDGGFPPLVIDTIDFLKLFQQEKSLIKNKEGLMK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target152 preprotein translocase subunit SecB [Candidatus Liberib
148251775162 preprotein translocase subunit SecB [Bradyrhizobium sp. 1 1e-34
146337370162 preprotein translocase subunit SecB [Bradyrhizobium sp. 1 1e-34
49473775158 preprotein translocase subunit SecB [Bartonella quintan 1 2e-34
92115748159 preprotein translocase subunit SecB [Nitrobacter hambur 1 2e-34
163867400158 preprotein translocase subunit SecB [Bartonella triboco 1 4e-34
121601951159 preprotein translocase subunit SecB [Bartonella bacilli 1 6e-34
325291459160 Preprotein translocase subunit SecB [Agrobacterium sp. 1 8e-34
319898293158 protein-export protein SecB [Bartonella clarridgeiae 73 1 9e-34
90421822164 preprotein translocase subunit SecB [Rhodopseudomonas p 1 1e-33
319405012158 protein-export protein SecB [Bartonella sp. AR 15-3] Le 1 1e-33
>gi|148251775|ref|YP_001236360.1| preprotein translocase subunit SecB [Bradyrhizobium sp. BTAi1] Length = 162 Back     alignment and organism information
 Score =  149 bits (376), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 63/138 (45%), Positives = 96/138 (69%), Gaps = 1/138 (0%)

Query: 2   EKKQKQAFTILNQYIKDFSFESPNAPHCFFDIQNQQPTIKINVQVNANTISGADFDVILS 61
           E        +L QYIKD SFE+PNAP      Q Q P I I + V AN ++  +F+V L+
Sbjct: 10  EAAPPPQLNVLAQYIKDLSFENPNAPQSLAP-QGQPPQINIQINVGANALADTEFEVTLT 68

Query: 62  FDIEAKNNDKVIFRLELAYSGILRILDCPQEHISQILFVECPQLLFPFVRQIISNTIRDG 121
            + +A++  +V+F  EL Y G+ R+++ PQEH+S +L +ECP+LLFPF R+I++N++RDG
Sbjct: 69  IEGKAESGTQVMFSFELVYGGVFRLVNVPQEHLSPMLLIECPRLLFPFAREIVANSVRDG 128

Query: 122 GFPPLVIDTIDFLKLFQQ 139
           GFPPL++D +DF+ L++Q
Sbjct: 129 GFPPLMLDPVDFVSLYRQ 146


Species: Bradyrhizobium sp. BTAi1
Genus: Bradyrhizobium
Family: Bradyrhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|146337370|ref|YP_001202418.1| preprotein translocase subunit SecB [Bradyrhizobium sp. ORS278] Length = 162 Back     alignment and organism information
>gi|49473775|ref|YP_031817.1| preprotein translocase subunit SecB [Bartonella quintana str. Toulouse] Length = 158 Back     alignment and organism information
>gi|92115748|ref|YP_575477.1| preprotein translocase subunit SecB [Nitrobacter hamburgensis X14] Length = 159 Back     alignment and organism information
>gi|163867400|ref|YP_001608595.1| preprotein translocase subunit SecB [Bartonella tribocorum CIP 105476] Length = 158 Back     alignment and organism information
>gi|121601951|ref|YP_989545.1| preprotein translocase subunit SecB [Bartonella bacilliformis KC583] Length = 159 Back     alignment and organism information
>gi|325291459|ref|YP_004277323.1| Preprotein translocase subunit SecB [Agrobacterium sp. H13-3] Length = 160 Back     alignment and organism information
>gi|319898293|ref|YP_004158386.1| protein-export protein SecB [Bartonella clarridgeiae 73] Length = 158 Back     alignment and organism information
>gi|90421822|ref|YP_530192.1| preprotein translocase subunit SecB [Rhodopseudomonas palustris BisB18] Length = 164 Back     alignment and organism information
>gi|319405012|emb|CBI78621.1| protein-export protein SecB [Bartonella sp. AR 15-3] Length = 158 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target152 preprotein translocase subunit SecB [Candidatus Liberib
PRK05751156 PRK05751, PRK05751, preprotein translocase subunit SecB 2e-44
COG1952157 COG1952, SecB, Preprotein translocase subunit SecB [Int 3e-37
TIGR00809140 TIGR00809, secB, protein-export chaperone SecB 4e-27
cd00557131 cd00557, Translocase_SecB, Preprotein translocase subun 5e-20
PRK13031149 PRK13031, PRK13031, preprotein translocase subunit SecB 1e-11
pfam02556147 pfam02556, SecB, Preprotein translocase subunit SecB 1e-41
>gnl|CDD|180234 PRK05751, PRK05751, preprotein translocase subunit SecB; Validated Back     alignment and domain information
>gnl|CDD|32135 COG1952, SecB, Preprotein translocase subunit SecB [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|129891 TIGR00809, secB, protein-export chaperone SecB Back     alignment and domain information
>gnl|CDD|29643 cd00557, Translocase_SecB, Preprotein translocase subunit SecB Back     alignment and domain information
>gnl|CDD|106068 PRK13031, PRK13031, preprotein translocase subunit SecB; Provisional Back     alignment and domain information
>gnl|CDD|145603 pfam02556, SecB, Preprotein translocase subunit SecB Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 152 preprotein translocase subunit SecB [Candidatus Liberib
PRK05751147 preprotein translocase subunit SecB; Validated 100.0
PRK13031149 preprotein translocase subunit SecB; Provisional 100.0
pfam02556147 SecB Preprotein translocase subunit SecB. This family c 100.0
COG1952157 SecB Preprotein translocase subunit SecB [Intracellular 100.0
cd00557131 Translocase_SecB Preprotein translocase subunit SecB. S 100.0
TIGR00809146 secB protein-export chaperone SecB; InterPro: IPR003708 99.94
>PRK05751 preprotein translocase subunit SecB; Validated Back     alignment and domain information
>PRK13031 preprotein translocase subunit SecB; Provisional Back     alignment and domain information
>pfam02556 SecB Preprotein translocase subunit SecB Back     alignment and domain information
>COG1952 SecB Preprotein translocase subunit SecB [Intracellular trafficking and secretion] Back     alignment and domain information
>cd00557 Translocase_SecB Preprotein translocase subunit SecB Back     alignment and domain information
>TIGR00809 secB protein-export chaperone SecB; InterPro: IPR003708 Secretion across the inner membrane in some Gram-negative bacteria occurs via the preprotein translocase pathway Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target152 preprotein translocase subunit SecB [Candidatus Liberib
1qyn_A153 Crystal Structure Of Secb From Escherichia Coli Len 2e-35
1fx3_A169 Crystal Structure Of H. Influenzae Secb Length = 16 1e-30
>gi|40889477|pdb|1QYN|A Chain A, Crystal Structure Of Secb From Escherichia Coli Length = 153 Back     alignment and structure
 Score =  151 bits (383), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 40/146 (27%), Positives = 72/146 (49%), Gaps = 2/146 (1%)

Query: 2   EKKQKQAFTILNQYIKDFSFESPNAPHCFFDIQNQQPTIKINVQVNANTISGADFDVILS 61
           +   +  F I   Y KD SFE+PNAPH F   ++ QP +K+++   ++ ++   ++V+L 
Sbjct: 4   QNNTEMTFQIQRIYTKDISFEAPNAPHVF--QKDWQPEVKLDLDTASSQLADDVYEVVLR 61

Query: 62  FDIEAKNNDKVIFRLELAYSGILRILDCPQEHISQILFVECPQLLFPFVRQIISNTIRDG 121
             + A   ++  F  E+   GI  I       ++  L   CP +LFP+ R+ I++ +  G
Sbjct: 62  VTVTASLGEETAFLCEVQQGGIFSIAGIEGTQMAHCLGAYCPNILFPYARECITSMVSRG 121

Query: 122 GFPPLVIDTIDFLKLFQQEKSLIKNK 147
            FP L +  ++F  LF         +
Sbjct: 122 TFPQLNLAPVNFDALFMNYLQQQAGE 147


gi|12084673|pdb|1FX3|A Chain A, Crystal Structure Of H. Influenzae Secb Length = 169 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target152 preprotein translocase subunit SecB [Candidatus Liberib
1qyn_A153 Protein-export protein SECB; tetramer, greek KEY beta s 2e-30
1fx3_A169 SECB, protein-export protein SECB; protein trasnport, t 5e-28
>1qyn_A Protein-export protein SECB; tetramer, greek KEY beta sheet, chaperone; 2.35A {Escherichia coli} SCOP: d.33.1.1 Length = 153 Back     alignment and structure
 Score =  126 bits (319), Expect = 2e-30
 Identities = 40/140 (28%), Positives = 71/140 (50%), Gaps = 2/140 (1%)

Query: 2   EKKQKQAFTILNQYIKDFSFESPNAPHCFFDIQNQQPTIKINVQVNANTISGADFDVILS 61
           +   +  F I   Y KD SFE+PNAPH F   ++ QP +K+++   ++ ++   ++V+L 
Sbjct: 4   QNNTEMTFQIQRIYTKDISFEAPNAPHVF--QKDWQPEVKLDLDTASSQLADDVYEVVLR 61

Query: 62  FDIEAKNNDKVIFRLELAYSGILRILDCPQEHISQILFVECPQLLFPFVRQIISNTIRDG 121
             + A   ++  F  E+   GI  I       ++  L   CP +LFP+ R+ I++ +  G
Sbjct: 62  VTVTASLGEETAFLCEVQQGGIFSIAGIEGTQMAHCLGAYCPNILFPYARECITSMVSRG 121

Query: 122 GFPPLVIDTIDFLKLFQQEK 141
            FP L +  ++F  LF    
Sbjct: 122 TFPQLNLAPVNFDALFMNYL 141


>1fx3_A SECB, protein-export protein SECB; protein trasnport, translocation, transport protein; 2.50A {Haemophilus influenzae} SCOP: d.33.1.1 PDB: 1ozb_A Length = 169 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target152 preprotein translocase subunit SecB [Candidatus Liberib
1qyn_A153 Protein-export protein SECB; tetramer, greek KEY beta s 100.0
1fx3_A169 SECB, protein-export protein SECB; protein trasnport, t 100.0
>1qyn_A Protein-export protein SECB; tetramer, greek KEY beta sheet, chaperone; 2.35A {Escherichia coli} SCOP: d.33.1.1 Back     alignment and structure
Probab=100.00  E-value=0  Score=327.04  Aligned_cols=148  Identities=28%  Similarity=0.545  Sum_probs=139.3

Q ss_pred             CCCC--CCCCCHHHHEEEHHHCCCCCCHHHHHHHHHCCCCEEEEEEEECCCCCCCCEEEEEEEEEECCCCCCCCCEEEEE
Q ss_conf             9831--13010123013011103788716776431015841588865121214654057999984046766543012577
Q gi|254780817|r    1 MEKK--QKQAFTILNQYIKDFSFESPNAPHCFFDIQNQQPTIKINVQVNANTISGADFDVILSFDIEAKNNDKVIFRLEL   78 (152)
Q Consensus         1 M~~~--~~~~~~I~~qYIKDLSFE~P~ap~~f~~~~~~~p~~~i~i~i~~~~l~~~~~EV~l~l~~~ak~~~~~~f~~Ei   78 (152)
                      |.++  .+++|+|+++||||||||+|++|++|.  .+|.|++++++|+++++++++.|||.|+++++++.+++++|++|+
T Consensus         1 Mse~~~~~~~f~I~~~YiKDlSfE~P~ap~~f~--~~~~p~~~~~v~i~~~~l~~~~~EV~L~l~~~a~~~~~~~f~vEl   78 (153)
T 1qyn_A            1 MSEQNNTEMTFQIQRIYTKDISFEAPNAPHVFQ--KDWQPEVKLDLDTASSQLADDVYEVVLRVTVTASLGEETAFLCEV   78 (153)
T ss_dssp             --------CEEEEEEEEEEEEEEECTTHHHHTT--SCCCCEEEEEEEEEEEEEETTEEEEEEEEEEEEEETTEEEEEEEE
T ss_pred             CCCCCCCCCEEEEEEEEEEECCCCCCCCHHHHC--CCCCCCEEEEEECCCEECCCCEEEEEEEEEEEECCCCCEEEEEEE
T ss_conf             986556786489887898502543899815636--466984378883463044786399999999998258816999999


Q ss_pred             EEEEEEEECCCCCHHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHHHC
Q ss_conf             546899975887103444666304553417899999999973899886605539899999999999864201
Q gi|254780817|r   79 AYSGILRILDCPQEHISQILFVECPQLLFPFVRQIISNTIRDGGFPPLVIDTIDFLKLFQQEKSLIKNKEGL  150 (152)
Q Consensus        79 ~yagif~i~~~~~~~l~~illv~~P~~lfP~~R~ii~~~~~~~Gfp~l~l~~IdF~~LY~~~~~~~~~~~~~  150 (152)
                      +|||||.|.+.++++++++|+|+||++||||||++|++++++|||||++|+||||++||++|++|++++++.
T Consensus        79 ~yagif~i~~~~~e~~~~illi~~P~~lfPy~R~ii~~l~~~~GFppl~L~pIdF~~LY~~~~~q~~~~~~~  150 (153)
T 1qyn_A           79 QQGGIFSIAGIEGTQMAHCLGAYCPNILFPYARECITSMVSRGTFPQLNLAPVNFDALFMNYLQQQAGEGTE  150 (153)
T ss_dssp             EEEEEEEEESCCHHHHHHHHHTHHHHHHHHHHHHHHHHHHHHHTCCCCCCCCCCHHHHHHHHHC--------
T ss_pred             EEEEEEEEECCCHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHCCC
T ss_conf             988999993062767657677338388878999999999984699985678758999999999998764101



>1fx3_A SECB, protein-export protein SECB; protein trasnport, translocation, transport protein; 2.50A {Haemophilus influenzae} SCOP: d.33.1.1 PDB: 1ozb_A Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 152 preprotein translocase subunit SecB [Candidatus Liberib
d1qyna_134 d.33.1.1 (A:) Bacterial protein-export protein SecB {Es 5e-27
d1ozba_144 d.33.1.1 (A:) Bacterial protein-export protein SecB {Ha 4e-25
>d1qyna_ d.33.1.1 (A:) Bacterial protein-export protein SecB {Escherichia coli [TaxId: 562]} Length = 134 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: SecB-like
superfamily: SecB-like
family: Bacterial protein-export protein SecB
domain: Bacterial protein-export protein SecB
species: Escherichia coli [TaxId: 562]
 Score =  114 bits (286), Expect = 5e-27
 Identities = 40/132 (30%), Positives = 69/132 (52%), Gaps = 2/132 (1%)

Query: 9   FTILNQYIKDFSFESPNAPHCFFDIQNQQPTIKINVQVNANTISGADFDVILSFDIEAKN 68
           F I   Y KD SFE+PNAPH F   ++ QP +K+++   ++ ++   ++V+L   + A  
Sbjct: 3   FQIQRIYTKDISFEAPNAPHVF--QKDWQPEVKLDLDTASSQLADDVYEVVLRVTVTASL 60

Query: 69  NDKVIFRLELAYSGILRILDCPQEHISQILFVECPQLLFPFVRQIISNTIRDGGFPPLVI 128
            ++  F  E+   GI  I       ++  L   CP +LFP+ R+ I++ +  G FP L +
Sbjct: 61  GEETAFLCEVQQGGIFSIAGIEGTQMAHCLGAYCPNILFPYARECITSMVSRGTFPQLNL 120

Query: 129 DTIDFLKLFQQE 140
             ++F  LF   
Sbjct: 121 APVNFDALFMNY 132


>d1ozba_ d.33.1.1 (A:) Bacterial protein-export protein SecB {Haemophilus influenzae [TaxId: 727]} Length = 144 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target152 preprotein translocase subunit SecB [Candidatus Liberib
d1ozba_144 Bacterial protein-export protein SecB {Haemophilus infl 100.0
d1qyna_134 Bacterial protein-export protein SecB {Escherichia coli 100.0
>d1ozba_ d.33.1.1 (A:) Bacterial protein-export protein SecB {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: SecB-like
superfamily: SecB-like
family: Bacterial protein-export protein SecB
domain: Bacterial protein-export protein SecB
species: Haemophilus influenzae [TaxId: 727]
Probab=100.00  E-value=0  Score=313.89  Aligned_cols=141  Identities=27%  Similarity=0.575  Sum_probs=132.3

Q ss_pred             CCCHHHHEEEHHHCCCCCCHHHHHHHHHCCCCEEEEEEEECCCCCCCCEEEEEEEEEECCCC--CCCCCEEEEEEEEEEE
Q ss_conf             01012301301110378871677643101584158886512121465405799998404676--6543012577546899
Q gi|254780817|r    7 QAFTILNQYIKDFSFESPNAPHCFFDIQNQQPTIKINVQVNANTISGADFDVILSFDIEAKN--NDKVIFRLELAYSGIL   84 (152)
Q Consensus         7 ~~~~I~~qYIKDLSFE~P~ap~~f~~~~~~~p~~~i~i~i~~~~l~~~~~EV~l~l~~~ak~--~~~~~f~~Ei~yagif   84 (152)
                      |+|+|+++||||||||+||+|.+|.  .+|.|++++++|+++++++++.|||.|+++++++.  +++++|++|++|||+|
T Consensus         1 P~f~I~~~YiKDlSFE~Pn~p~~f~--~~~~p~~~~~i~i~~~~l~~~~~Ev~l~l~~~~~~~~~~~~~F~~e~~yagif   78 (144)
T d1ozba_           1 PVLQIQRIYVKDVSFEAPNLPHIFQ--QEWKPKLGFDLSTETTQVGDDLYEVVLNISVETTLEDSGDVAFICEVKQAGVF   78 (144)
T ss_dssp             CEEEEEEEEEEEEEEECTTTTGGGG--SCCCEEEEEEEEEEEEEEETTEEEEEEEEEEEEEETTTCCEEEEEEEEEEEEE
T ss_pred             CCEEEEEEEEEECCCCCCCCHHHHC--CCCCCCEEEEEEEEEEECCCCCEEEEEEEEEEECCCCCCCCEEEEEEEEEEEE
T ss_conf             9604867887612333899825645--35588557888632442477741799999997413455553189987589999


Q ss_pred             EECCCCCHHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             97588710344466630455341789999999997389988660553989999999999986420
Q gi|254780817|r   85 RILDCPQEHISQILFVECPQLLFPFVRQIISNTIRDGGFPPLVIDTIDFLKLFQQEKSLIKNKEG  149 (152)
Q Consensus        85 ~i~~~~~~~l~~illv~~P~~lfP~~R~ii~~~~~~~Gfp~l~l~~IdF~~LY~~~~~~~~~~~~  149 (152)
                      .+.+.++++++++++|+||++||||||++|++++++|||||++|+||||++||++|++|++++++
T Consensus        79 ~i~~~~~~~~~~illi~~P~~lFP~~R~ii~~l~~~gGFppl~l~pIdF~~ly~~~~~q~~~~~~  143 (144)
T d1ozba_          79 TISGLEDVQMAHCLTSQCPNMLFPYARELVSNLVNRGTFPALNLSPVNFDALFVEYMNRQQAENA  143 (144)
T ss_dssp             EEESCCHHHHHHHHHTHHHHHHHHHHHHHHHHHHHHTTCCCCCCCCCCSHHHHHHHHHHHHHHSC
T ss_pred             EECCCCHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHCC
T ss_conf             95489878863567406728888899999999998469998467875899999999999887605



>d1qyna_ d.33.1.1 (A:) Bacterial protein-export protein SecB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 152 preprotein translocase subunit SecB [Candidatus Li
1qyn_A_153 (A:) Protein-export protein SECB; tetramer, greek 4e-36
1fx3_A_169 (A:) SECB, protein-export protein SECB; protein tr 4e-35
>1qyn_A (A:) Protein-export protein SECB; tetramer, greek KEY beta sheet, chaperone; 2.35A {Escherichia coli}Length = 153 Back     alignment and structure
 Score =  144 bits (365), Expect = 4e-36
 Identities = 40/140 (28%), Positives = 71/140 (50%), Gaps = 2/140 (1%)

Query: 2   EKKQKQAFTILNQYIKDFSFESPNAPHCFFDIQNQQPTIKINVQVNANTISGADFDVILS 61
           +   +  F I   Y KD SFE+PNAPH F   ++ QP +K+++   ++ ++   ++V+L 
Sbjct: 4   QNNTEMTFQIQRIYTKDISFEAPNAPHVF--QKDWQPEVKLDLDTASSQLADDVYEVVLR 61

Query: 62  FDIEAKNNDKVIFRLELAYSGILRILDCPQEHISQILFVECPQLLFPFVRQIISNTIRDG 121
             + A   ++  F  E+   GI  I       ++  L   CP +LFP+ R+ I++ +  G
Sbjct: 62  VTVTASLGEETAFLCEVQQGGIFSIAGIEGTQMAHCLGAYCPNILFPYARECITSMVSRG 121

Query: 122 GFPPLVIDTIDFLKLFQQEK 141
            FP L +  ++F  LF    
Sbjct: 122 TFPQLNLAPVNFDALFMNYL 141


>1fx3_A (A:) SECB, protein-export protein SECB; protein trasnport, translocation, transport protein; 2.50A {Haemophilus influenzae}Length = 169 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target152 preprotein translocase subunit SecB [Candidatus Liberib
1qyn_A_153 Protein-export protein SECB; tetramer, greek KEY b 100.0
1fx3_A_169 SECB, protein-export protein SECB; protein trasnpo 100.0
>1qyn_A (A:) Protein-export protein SECB; tetramer, greek KEY beta sheet, chaperone; 2.35A {Escherichia coli} Back     alignment and structure
Probab=100.00  E-value=0  Score=298.40  Aligned_cols=149  Identities=28%  Similarity=0.540  Sum_probs=140.8

Q ss_pred             CCCCC--CCCCHHHHEEEHHHCCCCCCHHHHHHHHHCCCCEEEEEEEECCCCCCCCEEEEEEEEEECCCCCCCCCEEEEE
Q ss_conf             98311--3010123013011103788716776431015841588865121214654057999984046766543012577
Q gi|254780817|r    1 MEKKQ--KQAFTILNQYIKDFSFESPNAPHCFFDIQNQQPTIKINVQVNANTISGADFDVILSFDIEAKNNDKVIFRLEL   78 (152)
Q Consensus         1 M~~~~--~~~~~I~~qYIKDLSFE~P~ap~~f~~~~~~~p~~~i~i~i~~~~l~~~~~EV~l~l~~~ak~~~~~~f~~Ei   78 (152)
                      |.+..  .|.|.|.++|+||||||+||+|.+|  ...|.|++++++++++++++++.|||.|+++++++.++++.|++|+
T Consensus         1 m~e~~~~~~~~~i~~~Y~Kd~SfE~P~~p~~f--~~~~~p~i~i~i~v~~~~~~e~~~eV~L~i~v~a~~~~~~~F~iev   78 (153)
T 1qyn_A            1 MSEQNNTEMTFQIQRIYTKDISFEAPNAPHVF--QKDWQPEVKLDLDTASSQLADDVYEVVLRVTVTASLGEETAFLCEV   78 (153)
T ss_dssp             --------CEEEEEEEEEEEEEEECTTHHHHT--TSCCCCEEEEEEEEEEEEEETTEEEEEEEEEEEEEETTEEEEEEEE
T ss_pred             CCCCCCCCCEEEEEEEEEEECCCCCCCCHHHH--CCCCCCCEEEEEECCCEECCCCEEEEEEEEEEEECCCCCEEEEEEE
T ss_conf             98655678708888789850354489981453--6467984478883353034686499999999997268834899999


Q ss_pred             EEEEEEEECCCCCHHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCC
Q ss_conf             5468999758871034446663045534178999999999738998866055398999999999998642014
Q gi|254780817|r   79 AYSGILRILDCPQEHISQILFVECPQLLFPFVRQIISNTIRDGGFPPLVIDTIDFLKLFQQEKSLIKNKEGLM  151 (152)
Q Consensus        79 ~yagif~i~~~~~~~l~~illv~~P~~lfP~~R~ii~~~~~~~Gfp~l~l~~IdF~~LY~~~~~~~~~~~~~~  151 (152)
                      +|+|+|.+.|+++++++++|+++||++||||+|++|+++|++|||||++|+||||.+||++++++++++++..
T Consensus        79 ~~~GiF~i~~i~~e~~~~~l~i~~p~iLfPY~R~~Vs~lt~~~gfppl~LppINF~~ly~~~~~~~~~~~~~~  151 (153)
T 1qyn_A           79 QQGGIFSIAGIEGTQMAHCLGAYCPNILFPYARECITSMVSRGTFPQLNLAPVNFDALFMNYLQQQAGEGTEE  151 (153)
T ss_dssp             EEEEEEEEESCCHHHHHHHHHTHHHHHHHHHHHHHHHHHHHHHTCCCCCCCCCCHHHHHHHHHC---------
T ss_pred             EEEEEEEECCCCHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCC
T ss_conf             9999999737707778777863383888789999999999846999856787589999999999987641002



>1fx3_A (A:) SECB, protein-export protein SECB; protein trasnport, translocation, transport protein; 2.50A {Haemophilus influenzae} Back     alignment and structure