254780838

254780838

hypothetical protein CLIBASIA_03665

GeneID in NCBI database:8209849Locus tag:CLIBASIA_03665
Protein GI in NCBI database:254780838Protein Accession:YP_003065251.1
Gene range:+(808801, 809112)Protein Length:103aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:not defined as a protein in SEED
Pathway involved in KEGG:not defined
Subsystem involved in KEGG:not defined
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100---
MNSLLFGFLAFLYAYGGSVVFSLFESFFVEKEDGELFIRIMVFEISWSRGEFYVDLLPFNFASRSSYQQRSNILSHRKEIAIDQRRTPITQKLSMGNLSELQE
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEEEEEEEcccEEEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHccccHHHHcc
ccHHHHHHHHHHHHHcccEEEEEEEEEEEEcccccEEEEEEEEEEEccccEEEEEccccccccccHHHHHHHHHHHHHHHHHHccccccHHEcccccHHHHcc
MNSLLFGFLAFLYAYGGSVVFSLFESFFVEKEDGELFIRIMVFEISwsrgefyvdllpfnfasrssyQQRSNILSHRKEIAidqrrtpitqklsmgnlselqe
MNSLLFGFLAFLYAYGGSVVFSLFESFFVEKEDGELFIRIMVFEISWSRGEFYVDLLPFNFASRSSYQQRSNILSHRkeiaidqrrtpitqklsmgnlselqe
MNSllfgflaflyayggsvvfslfesffvekeDGELFIRIMVFEISWSRGEFYVDLLPFNFASRSSYQQRSNILSHRKEIAIDQRRTPITQKLSMGNLSELQE
*NSLLFGFLAFLYAYGGSVVFSLFESFFVEKEDGELFIRIMVFEISWSRGEFYVDLLPFNFAS***************EIAIDQRRTPITQKLS**N******
MNSLLFGFLAFLYAYGGSVVFSLFESFFVEKEDGELFIRIMVFEISWSRGEFYVDLLPFNFASRSSYQQRSNILSHRKEIAIDQRRTPITQKLSMGNLSELQE
*NSLLFGFLAFLYAYGGSVVFSLFESFFVEKEDGELFIRIMVFEISWSRGEFYVDLLPFNFASRSSYQQRSNILSHRKEIAIDQRRTPITQKLS*********
iiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNSLLFGFLAFLYAYGGSVVFSLFESFFVEKEDGELFIRIMVFEISWSRGEFYVDLLPFNFASRSSYQQRSNILSHRKEIAIDQRRTPITQKLSMGNLSELQE

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

No hits with e-value below 0.005 within the first 2 iteration


Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00