254780852

254780852

NADH dehydrogenase subunit A

GeneID in NCBI database:8209867Locus tag:CLIBASIA_03735
Protein GI in NCBI database:254780852Protein Accession:YP_003065265.1
Gene range:+(822573, 822938)Protein Length:121aa
Gene description:NADH dehydrogenase subunit A
COG prediction:[C] NADH:ubiquinone oxidoreductase subunit 3 (chain A)
KEGG prediction:nuoA; NADH dehydrogenase subunit A (EC:1.6.99.5); K00330 NADH dehydrogenase I subunit A [EC:1.6.5.3]
SEED prediction:NADH ubiquinone oxidoreductase chain A (EC 1.6.5.3)
Pathway involved in KEGG:Oxidative phosphorylation [PATH:las00190]
Subsystem involved in SEED:Respiratory Complex I
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM3 TM-Helix
TOPPRED3 TM-Helix
HMMTOP3 TM-Helix
MEMSAT3 TM-Helix
MEMSAT_SVM3 TM-Helix
PHOBIUS3 TM-Helix
SignalP_HMMyes
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-
MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccc
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHccccccccccccccHHHHHHHHHHHHHHHHHHHHcHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHccccccc
msdlltsyAPILVFMAIASAIVIVLMISPfivafkspdpeklstyecgfdpfddarvKFDIRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD
MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD
MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD
**DLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW*
MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD
MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW*
oooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiii
xxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxx
ooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiii
ooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiii
oooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHiiiiiiiiii
oooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD
MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD
MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target121 NADH dehydrogenase subunit A [Candidatus Liberibacter a
315122726121 NADH dehydrogenase subunit A [Candidatus Liberibacter s 1 2e-52
110633376121 NADH dehydrogenase subunit A [Mesorhizobium sp. BNC1] L 1 2e-47
153009752121 NADH dehydrogenase subunit A [Ochrobactrum anthropi ATC 1 4e-46
254501694127 NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 s 1 6e-46
17987441121 NADH dehydrogenase subunit A [Brucella melitensis bv. 1 1 2e-45
23501689121 NADH dehydrogenase subunit A [Brucella suis 1330] Lengt 1 3e-45
222148274124 NADH dehydrogenase subunit A [Agrobacterium vitis S4] L 1 6e-45
294852159121 NADH dehydrogenase I subunit A [Brucella sp. NVSL 07-00 1 7e-45
254469811121 NADH-quinone oxidoreductase chain a [Pseudovibrio sp. J 1 2e-44
118590039121 NADH dehydrogenase subunit A [Stappia aggregata IAM 126 1 2e-44
>gi|315122726|ref|YP_004063215.1| NADH dehydrogenase subunit A [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 121 Back     alignment and organism information
 Score =  208 bits (530), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 110/121 (90%), Positives = 117/121 (96%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M+DLLTSYAPILVF+AIASAIVI LMISPF+VAFKSPDPEKLSTYECGFDPFD A +KFD
Sbjct: 1   MNDLLTSYAPILVFIAIASAIVIALMISPFLVAFKSPDPEKLSTYECGFDPFDSAHMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RFCLVSVLF+IFDLEIAFLFPWAVYFK+I WLGFGSMMVFLGILTVGFIYEWKKGALEW
Sbjct: 61  VRFCLVSVLFIIFDLEIAFLFPWAVYFKKIGWLGFGSMMVFLGILTVGFIYEWKKGALEW 120

Query: 121 D 121
           D
Sbjct: 121 D 121


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|110633376|ref|YP_673584.1| NADH dehydrogenase subunit A [Mesorhizobium sp. BNC1] Length = 121 Back     alignment and organism information
>gi|153009752|ref|YP_001370967.1| NADH dehydrogenase subunit A [Ochrobactrum anthropi ATCC 49188] Length = 121 Back     alignment and organism information
>gi|254501694|ref|ZP_05113845.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 superfamily [Labrenzia alexandrii DFL-11] Length = 127 Back     alignment and organism information
>gi|17987441|ref|NP_540075.1| NADH dehydrogenase subunit A [Brucella melitensis bv. 1 str. 16M] Length = 121 Back     alignment and organism information
>gi|23501689|ref|NP_697816.1| NADH dehydrogenase subunit A [Brucella suis 1330] Length = 121 Back     alignment and organism information
>gi|222148274|ref|YP_002549231.1| NADH dehydrogenase subunit A [Agrobacterium vitis S4] Length = 124 Back     alignment and organism information
>gi|294852159|ref|ZP_06792832.1| NADH dehydrogenase I subunit A [Brucella sp. NVSL 07-0026] Length = 121 Back     alignment and organism information
>gi|254469811|ref|ZP_05083216.1| NADH-quinone oxidoreductase chain a [Pseudovibrio sp. JE062] Length = 121 Back     alignment and organism information
>gi|118590039|ref|ZP_01547443.1| NADH dehydrogenase subunit A [Stappia aggregata IAM 12614] Length = 121 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target121 NADH dehydrogenase subunit A [Candidatus Liberibacter a
PRK06602121 PRK06602, PRK06602, NADH:ubiquinone oxidoreductase subu 1e-44
MTH00055118 MTH00055, ND3, NADH dehydrogenase subunit 3; Provisiona 2e-28
MTH00018113 MTH00018, ND3, NADH dehydrogenase subunit 3; Validated 2e-26
pfam00507102 pfam00507, Oxidored_q4, NADH-ubiquinone/plastoquinone o 2e-25
MTH00069114 MTH00069, ND3, NADH dehydrogenase subunit 3; Provisiona 6e-24
MTH00136116 MTH00136, ND3, NADH dehydrogenase subunit 3; Provisiona 3e-23
MTH00113114 MTH00113, ND3, NADH dehydrogenase subunit 3; Provisiona 3e-23
PRK07928119 PRK07928, PRK07928, NADH dehydrogenase subunit A; Valid 2e-22
CHL00022120 CHL00022, ndhC, NADH dehydrogenase subunit 3 1e-21
MTH00030123 MTH00030, ND3, NADH dehydrogenase subunit 3; Provisiona 8e-21
MTH00042116 MTH00042, ND3, NADH dehydrogenase subunit 3; Validated 1e-20
PRK07756122 PRK07756, PRK07756, NADH dehydrogenase subunit A; Valid 2e-19
PRK08489129 PRK08489, PRK08489, NADH dehydrogenase subunit A; Valid 1e-18
KOG4662122 KOG4662, KOG4662, KOG4662, NADH dehydrogenase subunit 3 3e-18
MTH00148117 MTH00148, ND3, NADH dehydrogenase subunit 3; Provisiona 3e-18
MTH00161113 MTH00161, ND3, NADH dehydrogenase subunit 3; Provisiona 4e-18
MTH00203112 MTH00203, ND3, NADH dehydrogenase subunit 3; Provisiona 7e-18
MTH00012117 MTH00012, ND3, NADH dehydrogenase subunit 3; Validated 1e-14
MTH00202117 MTH00202, ND3, NADH dehydrogenase subunit 3; Provisiona 5e-14
MTH00092111 MTH00092, ND3, NADH dehydrogenase subunit 3; Provisiona 2e-04
COG0838123 COG0838, NuoA, NADH:ubiquinone oxidoreductase subunit 3 3e-29
MTH00106115 MTH00106, ND3, NADH dehydrogenase subunit 3; Provisiona 1e-14
PRK06432144 PRK06432, PRK06432, NADH dehydrogenase subunit A; Valid 6e-06
MTH00060116 MTH00060, ND3, NADH dehydrogenase subunit 3; Provisiona 0.002
>gnl|CDD|180638 PRK06602, PRK06602, NADH:ubiquinone oxidoreductase subunit A; Validated Back     alignment and domain information
>gnl|CDD|177128 MTH00055, ND3, NADH dehydrogenase subunit 3; Provisional Back     alignment and domain information
>gnl|CDD|164592 MTH00018, ND3, NADH dehydrogenase subunit 3; Validated Back     alignment and domain information
>gnl|CDD|109558 pfam00507, Oxidored_q4, NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 Back     alignment and domain information
>gnl|CDD|177141 MTH00069, ND3, NADH dehydrogenase subunit 3; Provisional Back     alignment and domain information
>gnl|CDD|177194 MTH00136, ND3, NADH dehydrogenase subunit 3; Provisional Back     alignment and domain information
>gnl|CDD|177175 MTH00113, ND3, NADH dehydrogenase subunit 3; Provisional Back     alignment and domain information
>gnl|CDD|181171 PRK07928, PRK07928, NADH dehydrogenase subunit A; Validated Back     alignment and domain information
>gnl|CDD|176964 CHL00022, ndhC, NADH dehydrogenase subunit 3 Back     alignment and domain information
>gnl|CDD|164603 MTH00030, ND3, NADH dehydrogenase subunit 3; Provisional Back     alignment and domain information
>gnl|CDD|177117 MTH00042, ND3, NADH dehydrogenase subunit 3; Validated Back     alignment and domain information
>gnl|CDD|169084 PRK07756, PRK07756, NADH dehydrogenase subunit A; Validated Back     alignment and domain information
>gnl|CDD|181448 PRK08489, PRK08489, NADH dehydrogenase subunit A; Validated Back     alignment and domain information
>gnl|CDD|39861 KOG4662, KOG4662, KOG4662, NADH dehydrogenase subunit 3 and related proteins [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|177205 MTH00148, ND3, NADH dehydrogenase subunit 3; Provisional Back     alignment and domain information
>gnl|CDD|177217 MTH00161, ND3, NADH dehydrogenase subunit 3; Provisional Back     alignment and domain information
>gnl|CDD|177248 MTH00203, ND3, NADH dehydrogenase subunit 3; Provisional Back     alignment and domain information
>gnl|CDD|164588 MTH00012, ND3, NADH dehydrogenase subunit 3; Validated Back     alignment and domain information
>gnl|CDD|177247 MTH00202, ND3, NADH dehydrogenase subunit 3; Provisional Back     alignment and domain information
>gnl|CDD|177155 MTH00092, ND3, NADH dehydrogenase subunit 3; Provisional Back     alignment and domain information
>gnl|CDD|31180 COG0838, NuoA, NADH:ubiquinone oxidoreductase subunit 3 (chain A) [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|177168 MTH00106, ND3, NADH dehydrogenase subunit 3; Provisional Back     alignment and domain information
>gnl|CDD|102372 PRK06432, PRK06432, NADH dehydrogenase subunit A; Validated Back     alignment and domain information
>gnl|CDD|177132 MTH00060, ND3, NADH dehydrogenase subunit 3; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 121 NADH dehydrogenase subunit A [Candidatus Liberibacter a
PRK06602121 NADH dehydrogenase subunit A; Validated 100.0
CHL00022120 ndhC NADH dehydrogenase subunit 3 100.0
PRK07756122 NADH dehydrogenase subunit A; Validated 100.0
PRK07928119 NADH dehydrogenase subunit A; Validated 100.0
MTH00055118 ND3 NADH dehydrogenase subunit 3; Provisional 100.0
MTH00018116 ND3 NADH dehydrogenase subunit 3; Validated 100.0
MTH00030123 ND3 NADH dehydrogenase subunit 3; Provisional 100.0
PRK08489129 NADH dehydrogenase subunit A; Validated 100.0
MTH00202114 ND3 NADH dehydrogenase subunit 3; Provisional 100.0
COG0838123 NuoA NADH:ubiquinone oxidoreductase subunit 3 (chain A) 100.0
MTH00042116 ND3 NADH dehydrogenase subunit 3; Validated 100.0
MTH00203114 ND3 NADH dehydrogenase subunit 3; Provisional 100.0
MTH00148116 ND3 NADH dehydrogenase subunit 3; Provisional 100.0
PRK06432144 NADH dehydrogenase subunit A; Validated 100.0
MTH00161113 ND3 NADH dehydrogenase subunit 3; Provisional 100.0
MTH00069114 ND3 NADH dehydrogenase subunit 3; Provisional 100.0
MTH00012117 ND3 NADH dehydrogenase subunit 3; Validated 100.0
MTH00136116 ND3 NADH dehydrogenase subunit 3; Provisional 100.0
MTH00106115 ND3 NADH dehydrogenase subunit 3; Provisional 100.0
MTH00113115 ND3 NADH dehydrogenase subunit 3; Provisional 100.0
pfam00507102 Oxidored_q4 NADH-ubiquinone/plastoquinone oxidoreductas 100.0
KOG4662122 consensus 100.0
MTH00092111 ND3 NADH dehydrogenase subunit 3; Provisional 99.95
PRK06073125 NADH dehydrogenase subunit A; Validated 99.87
MTH00060116 ND3 NADH dehydrogenase subunit 3; Provisional 99.85
>PRK06602 NADH dehydrogenase subunit A; Validated Back     alignment and domain information
>CHL00022 ndhC NADH dehydrogenase subunit 3 Back     alignment and domain information
>PRK07756 NADH dehydrogenase subunit A; Validated Back     alignment and domain information
>PRK07928 NADH dehydrogenase subunit A; Validated Back     alignment and domain information
>MTH00055 ND3 NADH dehydrogenase subunit 3; Provisional Back     alignment and domain information
>MTH00018 ND3 NADH dehydrogenase subunit 3; Validated Back     alignment and domain information
>MTH00030 ND3 NADH dehydrogenase subunit 3; Provisional Back     alignment and domain information
>PRK08489 NADH dehydrogenase subunit A; Validated Back     alignment and domain information
>MTH00202 ND3 NADH dehydrogenase subunit 3; Provisional Back     alignment and domain information
>COG0838 NuoA NADH:ubiquinone oxidoreductase subunit 3 (chain A) [Energy production and conversion] Back     alignment and domain information
>MTH00042 ND3 NADH dehydrogenase subunit 3; Validated Back     alignment and domain information
>MTH00203 ND3 NADH dehydrogenase subunit 3; Provisional Back     alignment and domain information
>MTH00148 ND3 NADH dehydrogenase subunit 3; Provisional Back     alignment and domain information
>PRK06432 NADH dehydrogenase subunit A; Validated Back     alignment and domain information
>MTH00161 ND3 NADH dehydrogenase subunit 3; Provisional Back     alignment and domain information
>MTH00069 ND3 NADH dehydrogenase subunit 3; Provisional Back     alignment and domain information
>MTH00012 ND3 NADH dehydrogenase subunit 3; Validated Back     alignment and domain information
>MTH00136 ND3 NADH dehydrogenase subunit 3; Provisional Back     alignment and domain information
>MTH00106 ND3 NADH dehydrogenase subunit 3; Provisional Back     alignment and domain information
>MTH00113 ND3 NADH dehydrogenase subunit 3; Provisional Back     alignment and domain information
>pfam00507 Oxidored_q4 NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 Back     alignment and domain information
>KOG4662 consensus Back     alignment and domain information
>MTH00092 ND3 NADH dehydrogenase subunit 3; Provisional Back     alignment and domain information
>PRK06073 NADH dehydrogenase subunit A; Validated Back     alignment and domain information
>MTH00060 ND3 NADH dehydrogenase subunit 3; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00