254780879

254780879

hypothetical protein CLIBASIA_03880

GeneID in NCBI database:8209894Locus tag:CLIBASIA_03880
Protein GI in NCBI database:254780879Protein Accession:YP_003065292.1
Gene range:-(851980, 853938)Protein Length:652aa
Gene description:hypothetical protein
COG prediction:[M] Membrane proteins related to metalloendopeptidases
KEGG prediction:hypothetical protein
SEED prediction:Membrane proteins related to metalloendopeptidases
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED2 TM-Helix
HMMTOP1 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650--
MTLCTISNKRDILFSFGDTPPILGNNDAKIFLDNRRKVSLRWLSTTFFAGITSGVIIGGSLLTALDGHQKIAIPAKLSHQTSEENAINLSAKLSSMQRARLSPKTKSKHPEKIIIEVPTLIKDHNKDIIKKIPFAYARMTFATPYPKVKDHPKFDPLKIFSEGKIESSSQMLMDTIHNVDSFEVTTQKINFPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPKKPLFTSH
cEEEEEccccEEEEcccccccccccccHHcccccccEEEEEEHHHHHHHHHHHHHHHHHHHHHHcccccEEEccHHHHHccccccccccccccccccHHHcccccccccccccEEEEEHHHHcccHHHEEEccHHHHHHHHccccccccccccccHHHHccccccccccccccccccccccccccHHHccccccccccccccccccccccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccHHHHHHHccccHHHHHHHHHHccccccccccccccEEEEEEccccccccEEEEEEcccccEEEEEEEcccccccccccccccccccccccccEEccccEEcccHHHHHHHccccHHHHHHHHHHHcccccHHHHHccccEEEEEEEEccccccccccccEEEEEEccccccccEEEcccccccccccccccccccccccccccccccEEEEccccccccccccccccccEEEEccccccEEEccccEEEEEEEccccccEEEEEccccEEEEEEEHHHHHHccccccEEccccEEEEEEccccccccEEEEEEEEccEEEccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccc
ccEEEEEccccHHHcccccccccccccccccccccHHEEHHHHHHHHHHHHHHHHHHHHHHHEEccccccccccHHHHHHHHHccccccccccccHccccccccccccHHccEEEEEEEEEEcccEEEEEEcccHHHHHHcccccccccccccccHHHHHccccccccccHHcccccccccccEEEEcccccccccHHcHcccccHHHHHHHHHHHcccccccccccHHHccccccccccccccccccccHHcccccccEccccccccccccccccEEEEEcccccHHHHHHHccccHHHHHHHHHHHHHHHHHcccccccEEEEEEEcccccccEEEEEEEEccEEEEEEEEcccccEEEcccccEEEEEEccccEEEcccccEEcHHHHHHHHHccccHHHHHHHHHHHHccccHHHHccccccEEEEEEEEEEcccEcccccEEEEEEEEccEEEEEEEEEEccccccEEEccccccHHHHHHcccccccEEcccccccccccccEEcccccccccccccccEEEccccEEEEEEcccccccEEEEEccccEEEHHHHHHHHHHccccccEEcccEEEEEEccccccccccEEEEEEEccEcccccEEEccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccc
mtlctisnkrdilfsfgdtppilgnndakifldnrrkVSLRWLSTTFFAGITSGVIIGGSLltaldghqkiaipaklshqtseENAINLSAKLSSMqrarlspktkskhpekiiievptlikdhNKDIIKKIPFAYarmtfatpypkvkdhpkfdplkifsegkiessSQMLMDTIHNvdsfevttqkinfptditriqldhtaqDEEIKNAIMNQFFLLHnkknqsftlyyadpqtldqrhdhpitysKKIKIIeenrtitspqvlidkipefaddlipiqhnTTIFDAMvhagysngdSAKIAKALKNEVRVDQLTKDEILRIgvvqkddkftIVRFSIYHKQKHLLTIAlndnneyvlgvepvkmdinhqmdymrtseespniydgiwratsfngmNSNLVKLIMRTLASSVnlqehlkptdflETFFSvnhannqasddseLLYIHARFGETRTRFyrflnpvdgsveyfnengkssrpfllrtpvpfgrmtsgfgmryhpilgysrmhtgvdwaaprgtpivaVGDGIVekanwaggygkqtlihhgngyvssynHQDAIAKNIKagtavkqgQIIGwigttglstgphlHYELIVNGikvdstkvriperenlkGDLLQRFAMEKKRINSLlnngenpkkplftsh
mtlctisnkrdilfsfgdtppilgnndakifldNRRKVSLRWLSTTFFAGITSGVIIGGSLLTALDGHQKIAIpaklshqtseENAINLSAKLSSMQRARlspktkskhpekiiievptlikdhnkDIIKKIPFAYARMTFATpypkvkdhpkFDPLKIFSEGKIESSSQMLMDTIHNVDSFEVTTQKINFPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADpqtldqrhdhPITYSkkikiieenrtitspqVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNevrvdqltkdeilrigvvqkddkfTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHAnnqasddseLLYIHARFGETRTRFYRFLNPVDGSVEYFNengkssrpfllrtpvPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNgikvdstkvriperenlkgdllQRFAMEKKRInsllnngenpkkplftsh
MTLCTISNKRDILFSFGDTPPILGNNDAKIFLDNRRKVSLRWLSTTFFAGITSGVIIGGSLLTALDGHQKIAIPAKLSHQTSEENAINLSAKLSSMQRARLSPKTKSKHPEKIIIEVPTLikdhnkdiikkiPFAYARMTFATPYPKVKDHPKFDPLKIFSEGKIESSSQMLMDTIHNVDSFEVTTQKINFPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKqgqiigwigttgLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPKKPLFTSH
****************GDTPPILGNNDAKI*LDNRRKVSLRWLSTTFFAGITSGVIIGGSLLTALDGHQKIAIPA****************************************EVPTLIKDHNKDIIKKIPFAYARMTFATPYPKVKDHPKFDPL*******************************INFP*********************************************************************************FADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDST*******************MEKK********************
MTLCTISNKRDILFSFGDTPPILGNNDAKIFLDNRRKVSLRWLSTTFFAGITSGVIIGGSLLTALDGHQKIAIPAKLSHQTSEENAINLSAKLS***************PEKIIIEVPTLIKDHNKDIIKKIPFAYARMTFATPYPKVKDHPKFDPLKIFSEGKIESSSQMLMDTIHNVDSFEVTTQKINFPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPKKPLFTSH
*TLCTISNKRDILFSFGDTPPILGNNDAKIFLDNRRKVSLRWLSTTFFAGITSGVIIGGSLLTALDGHQKIAIPAKLSHQTSEENAINLSAKLSSMQRARLSPKTKSKHPEKIIIEVPTLIKDHNKDIIKKIPFAYARMTFATPYPKVKDHPKFDPLKIFSEGKIESSSQMLMDTIHNVDSFEVTTQKINFPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTL**RHDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGE**********
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTLCTISNKRDILFSFGDTPPILGNNDAKIFLDNRRKVSLRWLSTTFFAGITSGVIIGGSLLTALDGHQKIAIPAKLSHQTSEENAINLSAKLSSMQRARLSPKTKSKHPEKIIIEVPTLIKDHNKDIIKKIPFAYARMTFATPYPKVKDHPKFDPLKIFSEGKIESSSQMLMDTIHNVDSFEVTTQKINFPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPKKPLFTSH
MTLCTISNKRDILFSFGDTPPILGNNDAKIFLDNRRKVSLRWLSTTFFAGITSGVIIGGSLLTALDGHQKIAIPAKLSHQTSEENAINLSAKLSSMQRARLSPKTKSKHPEKIIIEVPTLIKDHNKDIIKKIPFAYARMTFATPYPKVKDHPKFDPLKIFSEGKIESSSQMLMDTIHNVDSFEVTTQKINFPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPKKPLFTSH
MTLCTISNKRDILFSFGDTPPILGNNDAKIFLDNRRKVSLRWLSTTFFAGITSGVIIGGSLLTALDGHQKIAIPAKLSHQTSEENAINLSAKLSSMQRARLSPKTKSKHPEKIIIEVPTLIKDHNKDIIKKIPFAYARMTFATPYPKVKDHPKFDPLKIFSEGKIESSSQMLMDTIHNVDSFEVTTQKINFPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYYADPQTLDQRHDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGENPKKPLFTSH

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target652 hypothetical protein CLIBASIA_03880 [Candidatus Liberib
25478068384 lipoprotein [Candidatus Liberibacter asiaticus str 3e-05
254780617509 F0F1 ATP synthase subunit alpha [Candidatus Liberi 0.028
>gi|254780683|ref|YP_003065096.1| lipoprotein [Candidatus Liberibacter asiaticus str. psy62] Length = 84 Back     alignment
 Score = 42.0 bits (97), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 42/85 (49%), Gaps = 9/85 (10%)

Query: 526 IVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIG 585
           ++ VG+ +VE        G   LI H +  V+ Y+H D     ++ G  V +G  IG  G
Sbjct: 2   VIYVGNDLVE-------LGNTILIRHDDSIVTVYSHID--TPYVQKGQKVSRGHTIGLSG 52

Query: 586 TTGLSTGPHLHYELIVNGIKVDSTK 610
            +G +  P +H+EL  N I +D  K
Sbjct: 53  KSGNAQHPQVHFELRKNAIAMDPIK 77

>gi|254780617|ref|YP_003065030.1| F0F1 ATP synthase subunit alpha [Candidatus Liberibacter asiaticus str. psy62] Length = 509 Back     alignment
 Score = 32.0 bits (71), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 21/98 (21%), Positives = 45/98 (45%), Gaps = 6/98 (6%)

Query: 422 KPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVD--GSVEY-FNENG 478
           K +  L+TF +   ++++ S+  ++  I+   G+ R+   RF+  ++  G++ Y      
Sbjct: 175 KTSIILDTFLNQKSSHDKGSEKDKVYCIYVAIGQKRSSVARFVKALEDRGALSYSIVVVA 234

Query: 479 KSSRPFLLRTPVPFGRMTSGFGMR---YHPILGYSRMH 513
            +S P  ++   PF     G   R   YH ++ Y  + 
Sbjct: 235 SASDPAPMQLLAPFAGCAMGEYFRDNGYHALIAYDDLQ 272

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target652 hypothetical protein CLIBASIA_03880 [Candidatus Liberib
315122700660 hypothetical protein CKC_04760 [Candidatus Liberibacter 1 0.0
15890798648 hypothetical protein Atu4178 [Agrobacterium tumefaciens 1 1e-162
227823184651 putative metalloendopeptidase [Sinorhizobium fredii NGR 1 1e-162
332716896648 putative peptidase protein, M23/M37 family [Agrobacteri 1 1e-161
241206498640 peptidase M23 [Rhizobium leguminosarum bv. trifolii WSM 1 1e-158
190893587640 peptidase, M23/M37 family [Rhizobium etli CIAT 652] Len 1 1e-158
15966360646 hypothetical protein SMc02432 [Sinorhizobium meliloti 1 1 1e-158
86359336640 M24/M37 family peptidase [Rhizobium etli CFN 42] Length 1 1e-158
116254015646 transmembrane peptidase family protein [Rhizobium legum 1 1e-158
209551096640 peptidase M23 [Rhizobium leguminosarum bv. trifolii WSM 1 1e-157
>gi|315122700|ref|YP_004063189.1| hypothetical protein CKC_04760 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 660 Back     alignment and organism information
 Score =  945 bits (2443), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 452/642 (70%), Positives = 543/642 (84%), Gaps = 9/642 (1%)

Query: 1   MTLCTISNKRDILFSFGDTPPILGNNDAKIFLDNRRKVSLRWLSTTFFAGITSGVIIGGS 60
           MTL +  NK++ILFSFG+ PPILG+N+ KIFL NRRKVSLRW+ TTFFAG+TSGV++GG+
Sbjct: 1   MTLYSTLNKKEILFSFGNNPPILGDNNEKIFL-NRRKVSLRWVYTTFFAGVTSGVLMGGA 59

Query: 61  LLTALDGHQKIAIPAKLSHQTSEENAINLSAKLSSMQRARLSPK-TKSKHPEKIIIEVPT 119
           LLTALDGHQK+AIPAKLS QT + N+ + +    SM++ARLS K TKSK+PEKIII+VPT
Sbjct: 60  LLTALDGHQKVAIPAKLSRQTLDLNSAHFNPNPFSMRKARLSTKNTKSKNPEKIIIDVPT 119

Query: 120 LIKDHNKDIIKKIPFAYARMTFATPYPKVKDHPKFDPLKIFSEGKIESSSQMLMDTIHNV 179
           LIK H+KDIIKKIPFAYARMTF TPY  ++D+PKFDPLKIFS G+IES+SQMLMDTI+N+
Sbjct: 120 LIKSHDKDIIKKIPFAYARMTFTTPYQNLRDYPKFDPLKIFSGGRIESTSQMLMDTINNI 179

Query: 180 DSF-------EVTTQKINFPTDITRIQLDHTAQDEEIKNAIMNQFFLLHNKKNQSFTLYY 232
           D+        E+TT+K NFPTDIT I+ D   +D+ IK AI+NQ+F L+  KNQS+ LYY
Sbjct: 180 DTLYDTKSKLEITTKKFNFPTDITNIKKDIIEKDDTIKKAIINQYFPLNYDKNQSYNLYY 239

Query: 233 ADPQTLDQRHDHPITYSKKIKIIEENRTITSPQVLIDKIPEFADDLIPIQHNTTIFDAMV 292
           AD Q L +   +    S  +K+IEENRTIT+PQ+  +  PEFADDLI IQHNTT+F AM+
Sbjct: 240 ADDQPLYKEQYNSTINSTTVKVIEENRTITTPQLSTNISPEFADDLIVIQHNTTVFKAMI 299

Query: 293 HAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIA 352
            AGYSN +S+KI KALK+++ VD+LTKDE +RIG++QK+ + TI+RFSIYHK++H+LTIA
Sbjct: 300 QAGYSNSESSKIVKALKDKIHVDKLTKDETIRIGMLQKEAESTIIRFSIYHKKEHILTIA 359

Query: 353 LNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLA 412
           LNDNNEYVLG EP K+DI+   D +RTSE  P+IYDGIWRATSFNGMN NLV+L++R LA
Sbjct: 360 LNDNNEYVLGAEPAKIDIDSYTDNIRTSESFPSIYDGIWRATSFNGMNKNLVQLVIRILA 419

Query: 413 SSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVE 472
           +++NLQEHLKPTDFLETFFSV+   NQ+++DSELLYIHARFGETRTRFYRF NP+DGSVE
Sbjct: 420 NNLNLQEHLKPTDFLETFFSVDPVKNQSTNDSELLYIHARFGETRTRFYRFQNPLDGSVE 479

Query: 473 YFNENGKSSRPFLLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDG 532
           YFNENGKSSRPFLLRTPVPFGR+TSGFGMR HPILGY+RMHTGVDWAAPRGTPI+AV DG
Sbjct: 480 YFNENGKSSRPFLLRTPVPFGRITSGFGMRRHPILGYTRMHTGVDWAAPRGTPIIAVSDG 539

Query: 533 IVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTG 592
           IVEK+ WAGGYGKQT+I H NG+VSSYNHQDAI+KN+   T VKQGQIIGWIG TGL+TG
Sbjct: 540 IVEKSGWAGGYGKQTIIRHANGFVSSYNHQDAISKNVTEKTTVKQGQIIGWIGATGLATG 599

Query: 593 PHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRI 634
           PHLHYELIVNGIKV+  K+RIPE E LKG++LQRF ME K +
Sbjct: 600 PHLHYELIVNGIKVNPMKIRIPEGETLKGEMLQRFLMETKEL 641


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|15890798|ref|NP_356470.1| hypothetical protein Atu4178 [Agrobacterium tumefaciens str. C58] Length = 648 Back     alignment and organism information
>gi|227823184|ref|YP_002827156.1| putative metalloendopeptidase [Sinorhizobium fredii NGR234] Length = 651 Back     alignment and organism information
>gi|332716896|ref|YP_004444362.1| putative peptidase protein, M23/M37 family [Agrobacterium sp. H13-3] Length = 648 Back     alignment and organism information
>gi|241206498|ref|YP_002977594.1| peptidase M23 [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 640 Back     alignment and organism information
>gi|190893587|ref|YP_001980129.1| peptidase, M23/M37 family [Rhizobium etli CIAT 652] Length = 640 Back     alignment and organism information
>gi|15966360|ref|NP_386713.1| hypothetical protein SMc02432 [Sinorhizobium meliloti 1021] Length = 646 Back     alignment and organism information
>gi|86359336|ref|YP_471228.1| M24/M37 family peptidase [Rhizobium etli CFN 42] Length = 640 Back     alignment and organism information
>gi|116254015|ref|YP_769853.1| transmembrane peptidase family protein [Rhizobium leguminosarum bv. viciae 3841] Length = 646 Back     alignment and organism information
>gi|209551096|ref|YP_002283013.1| peptidase M23 [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 640 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target652 hypothetical protein CLIBASIA_03880 [Candidatus Liberib
pfam0155196 pfam01551, Peptidase_M23, Peptidase family M23 4e-32
COG4942420 COG4942, COG4942, Membrane-bound metallopeptidase [Cell 4e-15
PRK10871319 PRK10871, nlpD, lipoprotein NlpD; Provisional 2e-09
PRK11637428 PRK11637, PRK11637, AmiB activator; Provisional 4e-09
PRK06148 1013 PRK06148, PRK06148, hypothetical protein; Provisional 1e-06
PRK11649439 PRK11649, PRK11649, putative peptidase; Provisional 3e-22
COG0739277 COG0739, NlpD, Membrane proteins related to metalloendo 6e-35
>gnl|CDD|144954 pfam01551, Peptidase_M23, Peptidase family M23 Back     alignment and domain information
>gnl|CDD|34550 COG4942, COG4942, Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|182796 PRK10871, nlpD, lipoprotein NlpD; Provisional Back     alignment and domain information
>gnl|CDD|183249 PRK11637, PRK11637, AmiB activator; Provisional Back     alignment and domain information
>gnl|CDD|180426 PRK06148, PRK06148, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|183257 PRK11649, PRK11649, putative peptidase; Provisional Back     alignment and domain information
>gnl|CDD|31082 COG0739, NlpD, Membrane proteins related to metalloendopeptidases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 652 hypothetical protein CLIBASIA_03880 [Candidatus Liberib
PRK11649418 hypothetical protein; Provisional 100.0
COG0739277 NlpD Membrane proteins related to metalloendopeptidases 100.0
PRK10871374 nlpD lipoprotein NlpD; Provisional 100.0
PRK11637404 hypothetical protein; Provisional 100.0
COG4942420 Membrane-bound metallopeptidase [Cell division and chro 99.94
pfam0155196 Peptidase_M23 Peptidase family M23. Members of this fam 99.97
PRK06148 1015 hypothetical protein; Provisional 99.49
PRK06149 972 hypothetical protein; Provisional 98.93
PRK09439169 glucose-specific PTS system component; Provisional 94.52
cd00210124 PTS_IIA_glc PTS_IIA, PTS system, glucose/sucrose specif 94.36
pfam00358133 PTS_EIIA_1 phosphoenolpyruvate-dependent sugar phosphot 93.69
TIGR00830129 PTBA PTS system, glucose subfamily, IIA component; Inte 93.65
PRK09824625 beta-glucoside-specific PTS system components IIABC; Pr 92.27
TIGR01995660 PTS-II-ABC-beta PTS system, beta-glucoside-specific IIA 91.0
PRK10255648 N-acetyl glucosamine specific PTS system components IIA 90.54
COG2190156 NagE Phosphotransferase system IIA components [Carbohyd 90.43
pfam0422585 OapA Opacity-associated protein A LysM-like domain. Thi 98.61
COG3061242 OapA Cell envelope opacity-associated protein A [Cell e 98.02
PRK10783449 mltD membrane-bound lytic murein transglycosylase D; Pr 98.11
PRK10783449 mltD membrane-bound lytic murein transglycosylase D; Pr 97.76
PRK06347593 autolysin; Reviewed 97.03
PRK06347593 autolysin; Reviewed 96.88
cd0011846 LysM Lysin domain, found in a variety of enzymes involv 97.6
smart0025744 LysM Lysin motif. 97.53
PRK13914475 invasion associated secreted endopeptidase; Provisional 97.27
pfam0147643 LysM LysM domain. The LysM (lysin motif) domain is abou 97.24
PRK11198147 hypothetical protein; Provisional 96.98
TIGR0289944 spore_safA spore coat assembly protein SafA; InterPro: 96.46
TIGR02907371 spore_VI_D stage VI sporulation protein D; InterPro: IP 95.55
COG1388124 LytE FOG: LysM repeat [Cell envelope biogenesis, outer 94.91
PRK11649418 hypothetical protein; Provisional 94.11
COG1652269 XkdP Uncharacterized protein containing LysM domain [Fu 92.06
TIGR01843434 type_I_hlyD type I secretion membrane fusion protein, H 94.15
100 kDa) subunits and an array of up to 12 different small (less than 50 kDa) subunits. This entry describes orthologues of the beta subunit of bacterial RNA polymerase. The core enzyme consists of two alpha chains, one beta chain, and one beta' subunit.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006350 transcription." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR02013">TIGR02013 1449 rpoB DNA-directed RNA polymerase, beta subunit; InterPr 91.82
PRK02597 1295 DNA-directed RNA polymerase subunit beta'; Provisional 91.54
TIGR02005533 PTS-IIBC-alpha PTS system, alpha-glucoside-specific IIB 91.24
>PRK11649 hypothetical protein; Provisional Back     alignment and domain information
>COG0739 NlpD Membrane proteins related to metalloendopeptidases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK10871 nlpD lipoprotein NlpD; Provisional Back     alignment and domain information
>PRK11637 hypothetical protein; Provisional Back     alignment and domain information
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>pfam01551 Peptidase_M23 Peptidase family M23 Back     alignment and domain information
>PRK06148 hypothetical protein; Provisional Back     alignment and domain information
>PRK06149 hypothetical protein; Provisional Back     alignment and domain information
>PRK09439 glucose-specific PTS system component; Provisional Back     alignment and domain information
>cd00210 PTS_IIA_glc PTS_IIA, PTS system, glucose/sucrose specific IIA subunit Back     alignment and domain information
>pfam00358 PTS_EIIA_1 phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 1 Back     alignment and domain information
>TIGR00830 PTBA PTS system, glucose subfamily, IIA component; InterPro: IPR001127 The phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS) , is a major carbohydrate transport system in bacteria Back     alignment and domain information
>PRK09824 beta-glucoside-specific PTS system components IIABC; Provisional Back     alignment and domain information
>TIGR01995 PTS-II-ABC-beta PTS system, beta-glucoside-specific IIABC component; InterPro: IPR011297 The phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS) , is a major carbohydrate transport system in bacteria Back     alignment and domain information
>PRK10255 N-acetyl glucosamine specific PTS system components IIABC; Provisional Back     alignment and domain information
>COG2190 NagE Phosphotransferase system IIA components [Carbohydrate transport and metabolism] Back     alignment and domain information
>pfam04225 OapA Opacity-associated protein A LysM-like domain Back     alignment and domain information
>COG3061 OapA Cell envelope opacity-associated protein A [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK10783 mltD membrane-bound lytic murein transglycosylase D; Provisional Back     alignment and domain information
>PRK10783 mltD membrane-bound lytic murein transglycosylase D; Provisional Back     alignment and domain information
>PRK06347 autolysin; Reviewed Back     alignment and domain information
>PRK06347 autolysin; Reviewed Back     alignment and domain information
>cd00118 LysM Lysin domain, found in a variety of enzymes involved in bacterial cell wall degradation Back     alignment and domain information
>smart00257 LysM Lysin motif Back     alignment and domain information
>PRK13914 invasion associated secreted endopeptidase; Provisional Back     alignment and domain information
>pfam01476 LysM LysM domain Back     alignment and domain information
>PRK11198 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02899 spore_safA spore coat assembly protein SafA; InterPro: IPR014248 This entry represents a domain of about 40 residues long which is found in a variety of enzymes involved in bacterial cell wall degradation , and which may have a general peptidoglycan binding function Back     alignment and domain information
>TIGR02907 spore_VI_D stage VI sporulation protein D; InterPro: IPR014256 This entry represents SpoVID, the stage VI sporulation protein D, which is restricted to endospore-forming bacteria, all of which are found among the Firmicutes Back     alignment and domain information
>COG1388 LytE FOG: LysM repeat [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK11649 hypothetical protein; Provisional Back     alignment and domain information
>COG1652 XkdP Uncharacterized protein containing LysM domain [Function unknown] Back     alignment and domain information
>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family; InterPro: IPR010129 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>TIGR02013 rpoB DNA-directed RNA polymerase, beta subunit; InterPro: IPR010243 DNA-directed RNA polymerases 2 Back     alignment and domain information
>PRK02597 DNA-directed RNA polymerase subunit beta'; Provisional Back     alignment and domain information
>TIGR02005 PTS-IIBC-alpha PTS system, alpha-glucoside-specific IIBC component; InterPro: IPR010975 This entry represents the fused PTS enzyme II B and C domains Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target652 hypothetical protein CLIBASIA_03880 [Candidatus Liberib
2gu1_A361 Crystal Structure Of A Zinc Containing Peptidase Fr 9e-75
2hsi_A282 Crystal Structure Of Putative Peptidase M23 From Ps 5e-28
1qwy_A291 Latent Lytm At 1.3 A Resolution Length = 291 2e-26
2b0p_A134 Truncated S. Aureus Lytm, P212121 Crystal Form Leng 5e-25
2b44_A133 Truncated S. Aureus Lytm, P 32 2 1 Crystal Form Len 1e-24
3nyy_A252 Crystal Structure Of A Putative Glycyl-Glycine Endo 3e-12
3it5_A182 Crystal Structure Of The Lasa Virulence Factor From 1e-09
>gi|110590412|pdb|2GU1|A Chain A, Crystal Structure Of A Zinc Containing Peptidase From Vibrio Cholerae Length = 361 Back     alignment and structure
 Score =  286 bits (731), Expect = 9e-75,   Method: Composition-based stats.
 Identities = 75/366 (20%), Positives = 133/366 (36%), Gaps = 20/366 (5%)

Query: 273 EFADDLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDD 332
           +       ++   T+       G       KI     + +++D +   E L + +     
Sbjct: 4   QPKRIHYMVKVGDTLSGIFAQLGVPYSILQKILSVDLDHLQLDMIQPGEELELMMDDMG- 62

Query: 333 KFTIVRFSIYHKQKHLLTIALNDNNEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWR 392
              + R   +            ++  +         D        R    S  I      
Sbjct: 63  --QLSRLIYHMSIVEKAIYTRENDGSF-------SYDFQEISGEWREILFSGEINGSFSV 113

Query: 393 ATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHANNQASDDSELLYIHAR 452
           +    G+ S+ V  I + +   ++    L+  D  +      +     + +SE+  I  +
Sbjct: 114 SARRVGLTSSQVANITQVMKDKIDFSRSLRAGDRFDILVKQQYLGEHNTGNSEIKAISFK 173

Query: 453 FGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTP--VPFGRMTSGFGMRY-HPILGY 509
             +     +   +       +++  G S      R P    + ++TSGF  +  HP+ G 
Sbjct: 174 LAKGDVSAFLAED-----GRFYDRAGNSLERAFNRYPVDKAYRQITSGFNPKRKHPVTGR 228

Query: 510 SRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNI 569
              H G D+A P G P+ + GDG V         G   +I H + Y + Y H D I   +
Sbjct: 229 VVPHNGTDFATPIGAPVYSTGDGKVIVVRKHPYAGNYLVIEHNSVYKTRYLHLDKIL--V 286

Query: 570 KAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAM 629
           K G  VK+GQ I   G TG  TGPHLH+E++V    VD+ K  +P  ++L  +    F  
Sbjct: 287 KKGQLVKRGQKIALAGATGRLTGPHLHFEVLVRNRPVDAMKADLPIAKSLSSNQKTSFLA 346

Query: 630 EKKRIN 635
                +
Sbjct: 347 RVSEFD 352


gi|114794497|pdb|2HSI|A Chain A, Crystal Structure Of Putative Peptidase M23 From Pseudomonas Aeruginosa, New York Structural Genomics Consortium Length = 282 Back     alignment and structure
>gi|42543452|pdb|1QWY|A Chain A, Latent Lytm At 1.3 A Resolution Length = 291 Back     alignment and structure
>gi|88192192|pdb|2B0P|A Chain A, Truncated S. Aureus Lytm, P212121 Crystal Form Length = 134 Back     alignment and structure
>gi|88192221|pdb|2B44|A Chain A, Truncated S. Aureus Lytm, P 32 2 1 Crystal Form Length = 133 Back     alignment and structure
>gi|306991893|pdb|3NYY|A Chain A, Crystal Structure Of A Putative Glycyl-Glycine Endopeptidase Lytm (Rumgna_02482) From Ruminococcus Gnavus Atcc 29149 At 1.60 A Resolution Length = 252 Back     alignment and structure
>gi|268612406|pdb|3IT5|A Chain A, Crystal Structure Of The Lasa Virulence Factor From Pseudomonas Aeruginosa Length = 182 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target652 hypothetical protein CLIBASIA_03880 [Candidatus Liberib
3nyy_A252 Putative glycyl-glycine endopeptidase LYTM; structural 4e-36
2gu1_A361 Zinc peptidase; alpha/beta, beta barrel, structural gen 1e-32
1qwy_A291 Peptidoglycan hydrolase; LYTM lysostaphin metalloprotea 4e-29
3csq_A334 Morphogenesis protein 1; hydrolase, infection, late pro 2e-27
3it5_A182 Protease LASA; metallopeptidase, beta-protein, cell mem 1e-18
2hsi_A282 Putative peptidase M23; structural genomics, PSI, prote 2e-24
>3nyy_A Putative glycyl-glycine endopeptidase LYTM; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE 2PE SO4; 1.60A {Ruminococcus gnavus} Length = 252 Back     alignment and structure
 Score =  148 bits (374), Expect = 4e-36
 Identities = 38/221 (17%), Positives = 80/221 (36%), Gaps = 27/221 (12%)

Query: 407 IMRTLASSVNLQEHLKPTDFLETFFSVNHANNQ-------ASDDSELLYIHARFGETRTR 459
           + + + S  + +     ++ ++ +        +       A+D     +          +
Sbjct: 8   LQKPVVSQPDFRR-QPVSETMQVYLKQAADPGRDVGLYWMATDFENRRFPGKVSPSGFQK 66

Query: 460 FYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPFGRMTSGFGMRY------HPILGYSRMH 513
            YR         + + ++ ++    +   P+P     +   + Y          G  R H
Sbjct: 67  LYRQWRN-QTGWDAYVQSCRAIWNDVKYFPIPQSLDDTEDKISYVDSWMFERNYGGKRGH 125

Query: 514 TGVDWAAPRGT----PIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNI 569
            G D  A + T    P+V++ DG+V +  W    G +  I    G    Y H D+ A+ +
Sbjct: 126 EGTDIMAEKNTPGYYPVVSMTDGVVTEKGWLEKGGWRIGITAPTGAYFYYAHLDSYAE-L 184

Query: 570 KAGTAVKQGQIIGWIGTTGLST-------GPHLHYELIVNG 603
           + G  VK G ++G++G +G            HLH  + +  
Sbjct: 185 EKGDPVKAGDLLGYMGDSGYGEEGTTGEFPVHLHLGIYLKE 225


>2gu1_A Zinc peptidase; alpha/beta, beta barrel, structural genomics, PSI, protein structure initiative; 1.90A {Vibrio cholerae} Length = 361 Back     alignment and structure
>1qwy_A Peptidoglycan hydrolase; LYTM lysostaphin metalloprotease asparagine switch; 1.30A {Staphylococcus aureus subsp} SCOP: b.84.3.2 PDB: 2b0p_A 2b13_A* 2b44_A Length = 291 Back     alignment and structure
>3csq_A Morphogenesis protein 1; hydrolase, infection, late protein; 1.80A {Bacteriophage phi-29} Length = 334 Back     alignment and structure
>3it5_A Protease LASA; metallopeptidase, beta-protein, cell membrane, cell outer membrane, hydrolase, membrane, metal-binding; 2.00A {Pseudomonas aeruginosa PAO1} PDB: 3it7_A* Length = 182 Back     alignment and structure
>2hsi_A Putative peptidase M23; structural genomics, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 1.90A {Pseudomonas aeruginosa PAO1} Length = 282 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target652 hypothetical protein CLIBASIA_03880 [Candidatus Liberib
2gu1_A361 Zinc peptidase; alpha/beta, beta barrel, structural gen 100.0
2hsi_A282 Putative peptidase M23; structural genomics, PSI, prote 100.0
1qwy_A291 Peptidoglycan hydrolase; LYTM lysostaphin metalloprotea 100.0
3it5_A182 Protease LASA; metallopeptidase, beta-protein, cell mem 99.97
3csq_A334 Morphogenesis protein 1; hydrolase, infection, late pro 99.94
2gpr_A154 Glucose-permease IIA component; phosphotransferase, enz 94.89
1ax3_A162 Iiaglc, glucose permease IIA domain; phosphotransferase 93.64
3nyy_A252 Putative glycyl-glycine endopeptidase LYTM; structural 100.0
2djp_A77 Hypothetical protein SB145; LYSM, structural genomics, 97.77
1e0g_A48 Membrane-bound lytic murein transglycosylase D; cell WA 97.47
1y7m_A164 Hypothetical protein BSU14040; surface mutagenesis, cys 92.46
1f3z_A161 EIIA-GLC, glucose-specific phosphocarrier; phosphotrans 93.72
1ci3_M249 Protein (cytochrome F); electron transfer protein, comp 92.75
2jxm_B249 Cytochrome F; copper, electron transport, metal-binding 92.27
1q90_A292 Apocytochrome F; membrane protein complex, photosynthes 90.2
>2gu1_A Zinc peptidase; alpha/beta, beta barrel, structural genomics, PSI, protein structure initiative; 1.90A {Vibrio cholerae} Back     alignment and structure
Probab=100.00  E-value=0  Score=626.09  Aligned_cols=345  Identities=22%  Similarity=0.305  Sum_probs=311.8

Q ss_pred             EEEEECCCCCHHHHHHHCCCCHHHHHHHHHHHHCCCCHHHCCCCCEEEEEECCCCCCCEEEEEEECCCCCEEEEEEECCC
Q ss_conf             36884179708999997499989999999985401561016998889999727888640589997168834899984278
Q gi|254780879|r  277 DLIPIQHNTTIFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIALNDN  356 (652)
Q Consensus       277 ~~v~VK~GDTL~~IL~r~Gvs~~ei~~i~~al~~~~~~~~Lr~Gq~L~I~~~~~~~~~~~~r~si~~~~~~~~~va~~d~  356 (652)
                      ..++||+||||++||+++|++.+++.+++++.++..++++|++||.|.|.++..+   ++..+.+.........+.+.+.
T Consensus         8 i~Y~Vk~GDTL~~Ia~r~gvs~~~i~~i~~~~~~~~~~~~L~~Gq~l~i~~~~~~---~l~~l~~~~s~~~~~~~~~~~~   84 (361)
T 2gu1_A            8 IHYMVKVGDTLSGIFAQLGVPYSILQKILSVDLDHLQLDMIQPGEELELMMDDMG---QLSRLIYHMSIVEKAIYTREND   84 (361)
T ss_dssp             EEEECCTTCCHHHHHHHTTCCHHHHHHHHHHGGGTCCGGGCCTTCEEEEEECTTS---CEEEEEEEEETTEEEEEEECTT
T ss_pred             EEEEECCCCCHHHHHHHCCCCHHHHHHHHHHCCCCCCHHHCCCCCEEEEEECCCC---CEEEEEEECCCCEEEEEEECCC
T ss_conf             6899899985999998859799999999873704574621799998999989999---7468999538760699994056


Q ss_pred             CCEEECCCCCCCHHHCCCCCCCCCCCCCCCCHHHHHHHHHCCCCHHHHHHHHHHHCCCCHHHHHCCCCCEEEEEEEEECC
Q ss_conf             84320133321000001221112334542110256668871999899999999730111012101445406887532115
Q gi|254780879|r  357 NEYVLGVEPVKMDINHQMDYMRTSEESPNIYDGIWRATSFNGMNSNLVKLIMRTLASSVNLQEHLKPTDFLETFFSVNHA  436 (652)
Q Consensus       357 g~fv~~~ep~~~~~~~~~~~~~~~~~~~~I~~SLy~aa~~~gip~~ii~~lv~i~a~dVDFqr~ir~GD~f~Vlye~~~~  436 (652)
                      +.|.....       ............+.|.+|||.++.++|+|..++.+++++++|++||++++++||+|++.|+....
T Consensus        85 ~~~~~~~~-------~~~~~~~~~~~~g~I~~SL~~~a~~~gl~~~~~~~l~~i~~~~Id~~~~i~~gd~~~i~~e~~~~  157 (361)
T 2gu1_A           85 GSFSYDFQ-------EISGEWREILFSGEINGSFSVSARRVGLTSSQVANITQVMKDKIDFSRSLRAGDRFDILVKQQYL  157 (361)
T ss_dssp             SCEEEEEE-------ECCCEEEEEEEEEESSSCHHHHHHHTTCCHHHHHHHHHHHTTTCCTTTCCCC-CEEEEEEEEEEE
T ss_pred             CCCEEEEC-------CCCCCCEEEEEEEEECCCCCHHHHHCCCCHHHHHHHHHHCCCCCCHHHHCCCCCEEEEECCCEEC
T ss_conf             74112202-------23442003677545536400111103753455555554213645522313579889984010010


Q ss_pred             CCCCCCCCCEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHCCCCCCCCC--CCCCCCCCCCC-CCCCCCCCCC
Q ss_conf             78512467236889623885420134557665544433556610000011233345--41023567641-4340443464
Q gi|254780879|r  437 NNQASDDSELLYIHARFGETRTRFYRFLNPVDGSVEYFNENGKSSRPFLLRTPVPF--GRMTSGFGMRY-HPILGYSRMH  513 (652)
Q Consensus       437 ~g~~~~~geil~A~~~~~g~~~~~yrf~~~~~~~~~yyd~~G~S~~k~llr~Pv~~--~risS~Fg~R~-hPilg~~r~H  513 (652)
                      +++....++++.+.+...++....|++.+     ..|||.+|++.++.++++|+..  .||+|+||+|+ ||++|+++||
T Consensus       158 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-----~~~yd~~G~s~~~~~~~~P~~~~~~risS~fg~r~~~~~~~~~~~H  232 (361)
T 2gu1_A          158 GEHNTGNSEIKAISFKLAKGDVSAFLAED-----GRFYDRAGNSLERAFNRYPVDKAYRQITSGFNPKRKHPVTGRVVPH  232 (361)
T ss_dssp             TTEEEEEEEEEEEEEECTTCCEEEEECTT-----SCEEETTSCBSSCCCCSCSSCGGGCCEEECCBTTCBCTTTCCBCCB
T ss_pred             CCCCCCCCCEEEEEEECCCCCEEEEEECC-----CCEECCCCCCCCHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             66522332023456522786135675035-----6421477740111122101113344444545653353314641014


Q ss_pred             CCEEECCCCCCCEEECCCCEEEEEEEECCCCCEEEEECCCCEEEEEHHHHHHHHCCCCCCEEECCCEEEEECCCCCCCCC
Q ss_conf             20030267967279715967999653089700799983997488200214454118899788349589984166788874
Q gi|254780879|r  514 TGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGP  593 (652)
Q Consensus       514 ~GVD~aAp~GTPI~Aag~G~V~~ag~~~GyGn~V~I~H~~Gy~T~YaHlS~~a~gV~~G~~V~qGQvIG~vGsTG~STGP  593 (652)
                      +||||+||+||||+|+++|+|+++||++||||+|+|+|+|||+|+|||||+|+  |++||+|+|||+||||||||+||||
T Consensus       233 ~GiDiaa~~GtpV~Aa~~G~V~~ag~~~gyGn~V~I~H~~g~~T~YaHls~~~--V~~G~~V~~Gq~Ig~vG~TG~stgp  310 (361)
T 2gu1_A          233 NGTDFATPIGAPVYSTGDGKVIVVRKHPYAGNYLVIEHNSVYKTRYLHLDKIL--VKKGQLVKRGQKIALAGATGRLTGP  310 (361)
T ss_dssp             CSEEECCCTTCEEECSSSEEEEEEEEETTTEEEEEEECSSSEEEEEEEESEEC--CCTTCEECTTCEEEECCCCSSCSSC
T ss_pred             CCEEEECCCCCCEEEEEEEEEEEEEECCCCCCEEEEECCCCEEEEEECCCCCC--CCCCCEECCCCEEEEECCCCCCCCC
T ss_conf             41576447797202130368999986478887589987998599984451113--3889999979999987688998986


Q ss_pred             EEEEEEEECCEECCCCEECCCCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             268899786788366200078878788899999999999999998
Q gi|254780879|r  594 HLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLL  638 (652)
Q Consensus       594 HLHfEv~vnG~~VdP~~~~lp~~~~l~~~~l~~F~~~~~~id~ll  638 (652)
                      ||||||++||++||||+++||.+++|++++|++|++++++||.--
T Consensus       311 hLHFEvr~~g~~vdPl~~~~p~~~~l~~~~~~~f~~~~~~~~~~~  355 (361)
T 2gu1_A          311 HLHFEVLVRNRPVDAMKADLPIAKSLSSNQKTSFLARVSEFDHEG  355 (361)
T ss_dssp             CEEEEEEETTEEECTTCSSCC------------------------
T ss_pred             EEEEEEEECCEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCC
T ss_conf             789999989989699635788988789899999999999986136



>2hsi_A Putative peptidase M23; structural genomics, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 1.90A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>1qwy_A Peptidoglycan hydrolase; LYTM lysostaphin metalloprotease asparagine switch; 1.30A {Staphylococcus aureus subsp} SCOP: b.84.3.2 PDB: 2b0p_A 2b13_A* 2b44_A Back     alignment and structure
>3it5_A Protease LASA; metallopeptidase, beta-protein, cell membrane, cell outer membrane, hydrolase, membrane, metal-binding; 2.00A {Pseudomonas aeruginosa PAO1} PDB: 3it7_A* Back     alignment and structure
>3csq_A Morphogenesis protein 1; hydrolase, infection, late protein; 1.80A {Bacteriophage phi-29} Back     alignment and structure
>2gpr_A Glucose-permease IIA component; phosphotransferase, enzyme IIA; 2.50A {Mycoplasma capricolum} SCOP: b.84.3.1 Back     alignment and structure
>1ax3_A Iiaglc, glucose permease IIA domain; phosphotransferase system, sugar transport, transferase, phosphorylation, transmembrane; NMR {Bacillus subtilis} SCOP: b.84.3.1 PDB: 1gpr_A Back     alignment and structure
>3nyy_A Putative glycyl-glycine endopeptidase LYTM; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE 2PE SO4; 1.60A {Ruminococcus gnavus} Back     alignment and structure
>2djp_A Hypothetical protein SB145; LYSM, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1e0g_A Membrane-bound lytic murein transglycosylase D; cell WALL, hydrolase, glycosidase, lipoprotein, outer membrane, multigene family; NMR {Escherichia coli} SCOP: d.7.1.1 Back     alignment and structure
>1y7m_A Hypothetical protein BSU14040; surface mutagenesis, cysteine proteases, cell WALL catabolism, structural genomics, PSI; 2.05A {Bacillus subtilis subsp} SCOP: b.160.1.1 d.7.1.1 Back     alignment and structure
>1f3z_A EIIA-GLC, glucose-specific phosphocarrier; phosphotransferase, signal transduction, sugar transport; 1.98A {Escherichia coli} SCOP: b.84.3.1 PDB: 1f3g_A 1ggr_A 1gla_F 1glb_F* 1glc_F* 1gld_F* 1gle_F* 1o2f_A 2f3g_A Back     alignment and structure
>1ci3_M Protein (cytochrome F); electron transfer protein, complex subunit, electron transport; HET: HEM; 1.90A {Phormidium laminosum} SCOP: b.2.6.1 b.84.2.2 PDB: 1tu2_B* Back     alignment and structure
>2jxm_B Cytochrome F; copper, electron transport, metal-binding, transport; HET: HEC; NMR {Prochlorothrix hollandica} SCOP: i.4.1.1 Back     alignment and structure
>1q90_A Apocytochrome F; membrane protein complex, photosynthesis, electron transfer, oxydoreductase, chlorophyll; HET: HEM CL1 BCR TDS SQD LFA LMG; 3.10A {Chlamydomonas reinhardtii} SCOP: b.2.6.1 b.84.2.2 f.23.23.1 Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 652 hypothetical protein CLIBASIA_03880 [Candidatus Liberib
d1qwya_270 b.84.3.2 (A:) Peptidoglycan hydrolase LytM {Staphylococ 8e-30
>d1qwya_ b.84.3.2 (A:) Peptidoglycan hydrolase LytM {Staphylococcus aureus [TaxId: 1280]} Length = 270 Back     information, alignment and structure

class: All beta proteins
fold: Barrel-sandwich hybrid
superfamily: Duplicated hybrid motif
family: Peptidoglycan hydrolase LytM
domain: Peptidoglycan hydrolase LytM
species: Staphylococcus aureus [TaxId: 1280]
 Score =  125 bits (316), Expect = 8e-30
 Identities = 38/115 (33%), Positives = 57/115 (49%), Gaps = 9/115 (7%)

Query: 493 GRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAG-GYGKQTLIHH 551
            +    +G +YH        H GVD+A P  +P+ ++ DG V +A W+  G G Q  I  
Sbjct: 151 RKQLQPYG-QYHG----GGAHYGVDYAMPENSPVYSLTDGTVVQAGWSNYGGGNQVTIKE 205

Query: 552 GN-GYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIK 605
            N      Y H + +   + AG  VK G  I + G+TG ST PH+H++ +  GI 
Sbjct: 206 ANSNNYQWYMHNNRL--TVSAGDKVKAGDQIAYSGSTGNSTAPHVHFQRMSGGIG 258


Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target652 hypothetical protein CLIBASIA_03880 [Candidatus Liberib
d1qwya_270 Peptidoglycan hydrolase LytM {Staphylococcus aureus [Ta 100.0
d1gpra_158 Glucose permease IIa domain, IIa-glc {Bacillus subtilis 94.95
d2f3ga_150 Glucose-specific factor III (glsIII) {Escherichia coli 94.34
d2gpra_154 Glucose permease IIa domain, IIa-glc {Mycoplasma capric 94.0
d1e0ga_48 Membrane-bound lytic murein transclycosylase D, MltD {E 97.53
d1y7ma248 Hypothetical protein YkuD, N-terminal domain {Bacillus 97.08
d1ci3m262 Cytochrome f, small domain {Phormidium laminosum [TaxId 93.53
d1e2wa264 Cytochrome f, small domain {Chlamydomonas reinhardtii [ 90.55
>d1qwya_ b.84.3.2 (A:) Peptidoglycan hydrolase LytM {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
class: All beta proteins
fold: Barrel-sandwich hybrid
superfamily: Duplicated hybrid motif
family: Peptidoglycan hydrolase LytM
domain: Peptidoglycan hydrolase LytM
species: Staphylococcus aureus [TaxId: 1280]
Probab=100.00  E-value=4.6e-35  Score=262.31  Aligned_cols=119  Identities=32%  Similarity=0.530  Sum_probs=106.4

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCEEECCCCEEEEEEEE-CCCCCEEEEECCCC-EEEEEHHH
Q ss_conf             11233345410235676414340443464200302679672797159679996530-89700799983997-48820021
Q gi|254780879|r  485 LLRTPVPFGRMTSGFGMRYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWA-GGYGKQTLIHHGNG-YVSSYNHQ  562 (652)
Q Consensus       485 llr~Pv~~~risS~Fg~R~hPilg~~r~H~GVD~aAp~GTPI~Aag~G~V~~ag~~-~GyGn~V~I~H~~G-y~T~YaHl  562 (652)
                      .+.||..+ ++.|+||.++-     .++|.||||++|.||||+|+.+|+|+++||. .||||+|+|+|.++ +.|.|+||
T Consensus       144 ~~~wp~~g-~~~~~fG~~r~-----g~~H~GIDi~a~~GtpV~A~~dG~V~~ag~~~~g~G~~V~I~h~~g~~~t~Y~hl  217 (270)
T d1qwya_         144 DASWLTSR-KQLQPYGQYHG-----GGAHYGVDYAMPENSPVYSLTDGTVVQAGWSNYGGGNQVTIKEANSNNYQWYMHN  217 (270)
T ss_dssp             SCHHHHTS-CEEECSEECTT-----SSEECSEEEECCTTCEEECSSSEEEEEEEEETTTTEEEEEEEETTSSEEEEEEEE
T ss_pred             CCCCCCCC-CCCCCCCCCCC-----CCCEEEEEECCCCCCEEEEEECEEEEEEEECCCCCCEEEEEEECCCCEEEEEEEC
T ss_conf             53355478-55178688897-----9964869958899996994108799998975679986999970898879999837


Q ss_pred             HHHHHCCCCCCEEECCCEEEEECCCCCCCCCEEEEEEEECC----EECCCCEE
Q ss_conf             44541188997883495899841667888742688997867----88366200
Q gi|254780879|r  563 DAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNG----IKVDSTKV  611 (652)
Q Consensus       563 S~~a~gV~~G~~V~qGQvIG~vGsTG~STGPHLHfEv~vnG----~~VdP~~~  611 (652)
                      +++.  |++||+|++||+||+||+||+||||||||||+++|    ++|||+..
T Consensus       218 ~~~~--V~~Gq~V~~Gq~IG~vGsTG~stgpHLHFEi~~~g~~~~~~VDP~~~  268 (270)
T d1qwya_         218 NRLT--VSAGDKVKAGDQIAYSGSTGNSTAPHVHFQRMSGGIGNQYAVDPTSY  268 (270)
T ss_dssp             SEEC--CCTTCEECTTCEEEECCCCSSCSSSEEEEEEEESEESGGGEECCHHH
T ss_pred             CEEE--CCCCCEECCCCEEEEECCCCCCCCCEEEEEEEECCCCCCEEECCHHH
T ss_conf             7211--38899998689999967889989977999999899179768394797



>d1gpra_ b.84.3.1 (A:) Glucose permease IIa domain, IIa-glc {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2f3ga_ b.84.3.1 (A:) Glucose-specific factor III (glsIII) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gpra_ b.84.3.1 (A:) Glucose permease IIa domain, IIa-glc {Mycoplasma capricolum [TaxId: 2095]} Back     information, alignment and structure
>d1e0ga_ d.7.1.1 (A:) Membrane-bound lytic murein transclycosylase D, MltD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y7ma2 d.7.1.1 (A:1-48) Hypothetical protein YkuD, N-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ci3m2 b.84.2.2 (M:170-231) Cytochrome f, small domain {Phormidium laminosum [TaxId: 32059]} Back     information, alignment and structure
>d1e2wa2 b.84.2.2 (A:169-232) Cytochrome f, small domain {Chlamydomonas reinhardtii [TaxId: 3055]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 652 hypothetical protein CLIBASIA_03880 [Candidatus Li
2gu1_A_206-361156 (A:206-361) Zinc peptidase; alpha/beta, beta barre 1e-34
3csq_A_166-334169 (A:166-334) Morphogenesis protein 1; hydrolase, in 2e-30
2hsi_A_116-267152 (A:116-267) Putative peptidase M23; structural gen 2e-31
3it5_A_1-134_171-182146 (A:1-134,A:171-182) Protease LASA; metallopeptidas 2e-26
1qwy_A_83-291209 (A:83-291) Peptidoglycan hydrolase; LYTM lysostaph 1e-30
2gu1_A_96-205110 (A:96-205) Zinc peptidase; alpha/beta, beta barrel 1e-13
>2gu1_A (A:206-361) Zinc peptidase; alpha/beta, beta barrel, structural genomics, PSI, protein structure initiative; 1.90A {Vibrio cholerae}Length = 156 Back     alignment and structure
 Score =  142 bits (360), Expect = 1e-34
 Identities = 51/156 (32%), Positives = 74/156 (47%), Gaps = 4/156 (2%)

Query: 489 PVPFGRMTSGFGM-RYHPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQT 547
                ++TSGF   R HP+ G    H G D+A P G P+ + GDG V         G   
Sbjct: 3   KAY-RQITSGFNPKRKHPVTGRVVPHNGTDFATPIGAPVYSTGDGKVIVVRKHPYAGNYL 61

Query: 548 LIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVD 607
           +I H + Y + Y H D I   +K G  VK+GQ I   G TG  TGPHLH+E++V    VD
Sbjct: 62  VIEHNSVYKTRYLHLDKI--LVKKGQLVKRGQKIALAGATGRLTGPHLHFEVLVRNRPVD 119

Query: 608 STKVRIPERENLKGDLLQRFAMEKKRINSLLNNGEN 643
           + K  +P  ++L  +    F       +   ++  +
Sbjct: 120 AMKADLPIAKSLSSNQKTSFLARVSEFDHEGHHHHH 155


>3csq_A (A:166-334) Morphogenesis protein 1; hydrolase, infection, late protein; 1.80A {Bacteriophage phi-29}Length = 169 Back     alignment and structure
>2hsi_A (A:116-267) Putative peptidase M23; structural genomics, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 1.90A {Pseudomonas aeruginosa PAO1}Length = 152 Back     alignment and structure
>3it5_A (A:1-134,A:171-182) Protease LASA; metallopeptidase, beta-protein, cell membrane, cell outer membrane, hydrolase, membrane, metal-binding; 2.00A {Pseudomonas aeruginosa PAO1} PDB: 3it7_A*Length = 146 Back     alignment and structure
>1qwy_A (A:83-291) Peptidoglycan hydrolase; LYTM lysostaphin metalloprotease asparagine switch; 1.30A {Staphylococcus aureus subsp}Length = 209 Back     alignment and structure
>2gu1_A (A:96-205) Zinc peptidase; alpha/beta, beta barrel, structural genomics, PSI, protein structure initiative; 1.90A {Vibrio cholerae}Length = 110 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target652 hypothetical protein CLIBASIA_03880 [Candidatus Liberib
2gu1_A_206-361156 Zinc peptidase; alpha/beta, beta barrel, structura 100.0
1qwy_A_83-291209 Peptidoglycan hydrolase; LYTM lysostaphin metallop 100.0
2hsi_A_116-267152 Putative peptidase M23; structural genomics, PSI, 100.0
3csq_A_166-334169 Morphogenesis protein 1; hydrolase, infection, lat 99.96
3it5_A_1-134_171-182146 Protease LASA; metallopeptidase, beta-protein, cel 99.96
1f3z_A_161 EIIA-GLC, glucose-specific phosphocarrier; phospho 94.68
2gpr_A_154 Glucose-permease IIA component; phosphotransferase 94.66
1ax3_A_162 Iiaglc, glucose permease IIA domain; phosphotransf 94.37
2gu1_A_96-205110 Zinc peptidase; alpha/beta, beta barrel, structura 99.75
2gu1_A_1-9595 Zinc peptidase; alpha/beta, beta barrel, structura 98.78
2djp_A_77 Hypothetical protein SB145; LYSM, structural genom 98.07
1e0g_A_48 Membrane-bound lytic murein transglycosylase D; ce 97.43
1y7m_A_1-5050 Hypothetical protein BSU14040; surface mutagenesis 96.96
2gu1_A_96-205110 Zinc peptidase; alpha/beta, beta barrel, structura 96.23
2a6h_C_593-65967 DNA-directed RNA polymerase beta chain; RNA polyme 96.18
2a6h_D_1244-1362119 DNA-directed RNA polymerase beta' chain; RNA polym 95.6
1e2w_A_157-23377 Cytochrome F; electron transport proteins, interna 93.97
1ci3_M_170-23162 Protein (cytochrome F); electron transfer protein, 93.39
1hcz_A_169-23163 Cytochrome F; electron transport, photosynthesis, 93.27
1q90_A_169-23365 Apocytochrome F; membrane protein complex, photosy 92.91
3iyd_C_701-79696 DNA-directed RNA polymerase subunit beta; transcri 91.34
2jxm_B_171-23161 Cytochrome F; copper, electron transport, metal-bi 91.2
>2gu1_A (A:206-361) Zinc peptidase; alpha/beta, beta barrel, structural genomics, PSI, protein structure initiative; 1.90A {Vibrio cholerae} Back     alignment and structure
Probab=100.00  E-value=9.9e-36  Score=269.75  Aligned_cols=152  Identities=33%  Similarity=0.509  Sum_probs=142.7

Q ss_pred             CCCCCCCCCCCCCCCC-CCCCCCCCCCCCEEECCCCCCCEEECCCCEEEEEEEECCCCCEEEEECCCCEEEEEHHHHHHH
Q ss_conf             3334541023567641-434044346420030267967279715967999653089700799983997488200214454
Q gi|254780879|r  488 TPVPFGRMTSGFGMRY-HPILGYSRMHTGVDWAAPRGTPIVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIA  566 (652)
Q Consensus       488 ~Pv~~~risS~Fg~R~-hPilg~~r~H~GVD~aAp~GTPI~Aag~G~V~~ag~~~GyGn~V~I~H~~Gy~T~YaHlS~~a  566 (652)
                      ||+.+ +|+|+||.++ ||..+..++|.|+||+++.|+||+|+.+|+|+++++..++|++|+|+|.+||.|.|+||+++.
T Consensus         2 wP~~g-~i~~~fg~~~~~~~~~~~~~h~GiDi~~~~g~~V~A~~~G~V~~~~~~~~~g~~V~i~h~~g~~~~y~~l~~~~   80 (156)
T 2gu1_A            2 DKAYR-QITSGFNPKRKHPVTGRVVPHNGTDFATPIGAPVYSTGDGKVIVVRKHPYAGNYLVIEHNSVYKTRYLHLDKIL   80 (156)
T ss_dssp             CGGGC-CEEECCBTTCBCTTTCCBCCBCSEEECCCTTCEEECSSSEEEEEEEEETTTEEEEEEECSSSEEEEEEEESEEC
T ss_pred             CCCCC-CCCCCCCCCCCCCCCCCCCCCCCEEEECCCCCEEECCCCCEEEEECCCCCCCCEEEEECCCCEEEEEECCCCCE
T ss_conf             13444-33553332223212475311343587536996231134623576124776564599974997478883343212


Q ss_pred             HCCCCCCEEECCCEEEEECCCCCCCCCEEEEEEEECCEECCCCEECCCCCCCCCHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             1188997883495899841667888742688997867883662000788787888999999999999999984147
Q gi|254780879|r  567 KNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELIVNGIKVDSTKVRIPERENLKGDLLQRFAMEKKRINSLLNNGE  642 (652)
Q Consensus       567 ~gV~~G~~V~qGQvIG~vGsTG~STGPHLHfEv~vnG~~VdP~~~~lp~~~~l~~~~l~~F~~~~~~id~ll~~~~  642 (652)
                        |++|++|++||+||++|+||.++||||||||+++|++|||++.--..+..+++.++..|...+.+++..++..+
T Consensus        81 --v~~G~~V~~G~~IG~~g~~g~~~~~hLHfei~~~g~~vdP~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  154 (156)
T 2gu1_A           81 --VKKGQLVKRGQKIALAGATGRLTGPHLHFEVLVRNRPVDAMKADLPIAKSLSSNQKTSFLARVSEFDHEGHHHH  154 (156)
T ss_dssp             --CCTTCEECTTCEEEECCCCSSCSSCCEEEEEEETTEEECTTCSSCC----------------------------
T ss_pred             --ECCCCEECCCCEEEEECCCCCCCCCEEEEEEEECCEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCC
T ss_conf             --18899999799899776889989856899999899885886246889996898999999999999873265446



>1qwy_A (A:83-291) Peptidoglycan hydrolase; LYTM lysostaphin metalloprotease asparagine switch; 1.30A {Staphylococcus aureus subsp} Back     alignment and structure
>2hsi_A (A:116-267) Putative peptidase M23; structural genomics, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 1.90A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>3csq_A (A:166-334) Morphogenesis protein 1; hydrolase, infection, late protein; 1.80A {Bacteriophage phi-29} Back     alignment and structure
>3it5_A (A:1-134,A:171-182) Protease LASA; metallopeptidase, beta-protein, cell membrane, cell outer membrane, hydrolase, membrane, metal-binding; 2.00A {Pseudomonas aeruginosa PAO1} PDB: 3it7_A* Back     alignment and structure
>1f3z_A (A:) EIIA-GLC, glucose-specific phosphocarrier; phosphotransferase, signal transduction, sugar transport; 1.98A {Escherichia coli} Back     alignment and structure
>2gpr_A (A:) Glucose-permease IIA component; phosphotransferase, enzyme IIA; 2.50A {Mycoplasma capricolum} Back     alignment and structure
>1ax3_A (A:) Iiaglc, glucose permease IIA domain; phosphotransferase system, sugar transport, transferase, phosphorylation, transmembrane; NMR {Bacillus subtilis} Back     alignment and structure
>2gu1_A (A:96-205) Zinc peptidase; alpha/beta, beta barrel, structural genomics, PSI, protein structure initiative; 1.90A {Vibrio cholerae} Back     alignment and structure
>2gu1_A (A:1-95) Zinc peptidase; alpha/beta, beta barrel, structural genomics, PSI, protein structure initiative; 1.90A {Vibrio cholerae} Back     alignment and structure
>2djp_A (A:) Hypothetical protein SB145; LYSM, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1e0g_A (A:) Membrane-bound lytic murein transglycosylase D; cell WALL, hydrolase, glycosidase, lipoprotein, outer membrane, multigene family; NMR {Escherichia coli} Back     alignment and structure
>1y7m_A (A:1-50) Hypothetical protein BSU14040; surface mutagenesis, cysteine proteases, cell WALL catabolism, structural genomics, PSI; 2.05A {Bacillus subtilis subsp} Back     alignment and structure
>2gu1_A (A:96-205) Zinc peptidase; alpha/beta, beta barrel, structural genomics, PSI, protein structure initiative; 1.90A {Vibrio cholerae} Back     alignment and structure
>2a6h_C (C:593-659) DNA-directed RNA polymerase beta chain; RNA polymerase holoenzyme, streptolydigin, antibiotic, transcription regulation; HET: STD; 2.40A {Thermus thermophilus} Back     alignment and structure
>2a6h_D (D:1244-1362) DNA-directed RNA polymerase beta' chain; RNA polymerase holoenzyme, streptolydigin, antibiotic, transcription regulation; HET: STD; 2.40A {Thermus thermophilus} Back     alignment and structure
>1e2w_A (A:157-233) Cytochrome F; electron transport proteins, internal water chain, photosynthetic function impaired; HET: HEC; 1.6A {Chlamydomonas reinhardtii} Back     alignment and structure
>1ci3_M (M:170-231) Protein (cytochrome F); electron transfer protein, complex subunit; HET: HEM; 1.90A {Phormidium laminosum} Back     alignment and structure
>1hcz_A (A:169-231) Cytochrome F; electron transport, photosynthesis, cytochrome B6F complex, chloroplast transmembrane; HET: HEM; 1.96A {Brassica rapa} Back     alignment and structure
>1q90_A (A:169-233) Apocytochrome F; membrane protein complex, photosynthesis, electron transfer, oxydoreductase, chlorophyll; HET: HEM CL1 BCR TDS SQD LFA LMG; 3.10A {Chlamydomonas reinhardtii} Back     alignment and structure
>3iyd_C (C:701-796) DNA-directed RNA polymerase subunit beta; transcription, initiation, class I, activator, RNA polymerase, holoenzyme, sigma70, open complex, CAP, CRP, CAMP-dependent; HET: DNA CMP; 19.80A {Escherichia coli k-12} Back     alignment and structure
>2jxm_B (B:171-231) Cytochrome F; copper, electron transport, metal-binding, transport; HET: HEC; NMR {Prochlorothrix hollandica} Back     alignment and structure