254780881

254780881

Mrp protein

GeneID in NCBI database:8209901Locus tag:CLIBASIA_03890
Protein GI in NCBI database:254780881Protein Accession:YP_003065294.1
Gene range:+(859502, 859807)Protein Length:101aa
Gene description:Mrp protein
COG prediction:none
KEGG prediction:Mrp protein
SEED prediction:Mrp protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-
MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQNIPTVKNAVVTLTENKNPPQQRNNLNVKKFVAVA
ccHHHHHHHHHHHHHcccccccccccccccEEEEEEEccEEEEEEEEcccccHHHHHHHHHHHHHHHHccccEEEEEEEEEcccccccccccccEEEEEEc
cHHHHHHHHHHHHHHHccccccccccccccHHHHHcccccEEEEEEccHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEcccccHHHHccccccEEEEEc
MNQILKNQIVDSlkvlsipgeknniVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQNIPTVKNAVVTLTenknppqqrnnlnVKKFVAVA
mnqilknqivdslkvlsipgEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQNIPTVKNAVVTLTenknppqqrnnlnvkkfvava
MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQNIPTVKNAVVTLTENKNPPQQRNNLNVKKFVAVA
**QILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQNIPTVKNAVVTL***************KKFVAVA
MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQNIPTVKNAVVTLTENKNPPQQRNNLNVKKFVAVA
MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQNIPTVKNAVVTLTENKNPPQQRNNLNVKKFVAVA
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQNIPTVKNAVVTLTENKNPPQQRNNLNVKKFVAVA
MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQNIPTVKNAVVTLTENKNPPQQRNNLNVKKFVAVA
MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQNIPTVKNAVVTLTENKNPPQQRNNLNVKKFVAVA

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target101 Mrp protein [Candidatus Liberibacter asiaticus str. psy
254780831 341 hypothetical protein CLIBASIA_03620 [Candidatus Li 3e-54
254780491101 Mrp protein [Candidatus Liberibacter asiaticus str 3e-53
>gi|254780831|ref|YP_003065244.1| hypothetical protein CLIBASIA_03620 [Candidatus Liberibacter asiaticus str. psy62] Length = 341 Back     alignment
 Score =  201 bits (510), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 101/101 (100%), Positives = 101/101 (100%)

Query: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS 60
           MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS
Sbjct: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS 60

Query: 61  NAQQIIQNIPTVKNAVVTLTENKNPPQQRNNLNVKKFVAVA 101
           NAQQIIQNIPTVKNAVVTLTENKNPPQQRNNLNVKKFVAVA
Sbjct: 61  NAQQIIQNIPTVKNAVVTLTENKNPPQQRNNLNVKKFVAVA 101

>gi|254780491|ref|YP_003064904.1| Mrp protein [Candidatus Liberibacter asiaticus str. psy62] Length = 101 Back     alignment
 Score =  197 bits (501), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 101/101 (100%), Positives = 101/101 (100%)

Query: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS 60
           MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS
Sbjct: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS 60

Query: 61  NAQQIIQNIPTVKNAVVTLTENKNPPQQRNNLNVKKFVAVA 101
           NAQQIIQNIPTVKNAVVTLTENKNPPQQRNNLNVKKFVAVA
Sbjct: 61  NAQQIIQNIPTVKNAVVTLTENKNPPQQRNNLNVKKFVAVA 101

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target101 Mrp protein [Candidatus Liberibacter asiaticus str. psy
254780831 341 hypothetical protein CLIBASIA_03620 [Candidatus Liberib 1 4e-50
254780491101 Mrp protein [Candidatus Liberibacter asiaticus str. psy 1 4e-49
315122330 348 hypothetical protein CKC_02910 [Candidatus Liberibacter 1 1e-26
315122699105 hypothetical protein CKC_04755 [Candidatus Liberibacter 1 5e-26
222085037 385 Mrp protein [Agrobacterium radiobacter K84] Length = 38 1 1e-10
254700870102 nucleotide-binding protein-like protein [Brucella suis 1 1e-10
25605983399 hypothetical protein Bneo5_05732 [Brucella neotomae 5K3 1 1e-10
29724710093 predicted protein [Brucella abortus bv. 5 str. B3196] L 1 1e-10
25604584594 ATPase [Brucella melitensis bv. 1 str. Rev.1] Length = 1 2e-10
25471827698 ATPase [Brucella sp. 83/13] Length = 98 1 2e-10
>gi|254780831|ref|YP_003065244.1| hypothetical protein CLIBASIA_03620 [Candidatus Liberibacter asiaticus str. psy62] Length = 341 Back     alignment and organism information
 Score =  201 bits (510), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 101/101 (100%), Positives = 101/101 (100%)

Query: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS 60
           MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS
Sbjct: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS 60

Query: 61  NAQQIIQNIPTVKNAVVTLTENKNPPQQRNNLNVKKFVAVA 101
           NAQQIIQNIPTVKNAVVTLTENKNPPQQRNNLNVKKFVAVA
Sbjct: 61  NAQQIIQNIPTVKNAVVTLTENKNPPQQRNNLNVKKFVAVA 101


Species: Candidatus Liberibacter asiaticus
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|254780491|ref|YP_003064904.1| Mrp protein [Candidatus Liberibacter asiaticus str. psy62] Length = 101 Back     alignment and organism information
>gi|315122330|ref|YP_004062819.1| hypothetical protein CKC_02910 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 348 Back     alignment and organism information
>gi|315122699|ref|YP_004063188.1| hypothetical protein CKC_04755 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 105 Back     alignment and organism information
>gi|222085037|ref|YP_002543566.1| Mrp protein [Agrobacterium radiobacter K84] Length = 385 Back     alignment and organism information
>gi|254700870|ref|ZP_05162698.1| nucleotide-binding protein-like protein [Brucella suis bv. 5 str. 513] Length = 102 Back     alignment and organism information
>gi|256059833|ref|ZP_05450024.1| hypothetical protein Bneo5_05732 [Brucella neotomae 5K33] Length = 99 Back     alignment and organism information
>gi|297247100|ref|ZP_06930822.1| predicted protein [Brucella abortus bv. 5 str. B3196] Length = 93 Back     alignment and organism information
>gi|256045845|ref|ZP_05448721.1| ATPase [Brucella melitensis bv. 1 str. Rev.1] Length = 94 Back     alignment and organism information
>gi|254718276|ref|ZP_05180087.1| ATPase [Brucella sp. 83/13] Length = 98 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 101 Mrp protein [Candidatus Liberibacter asiaticus str. psy
PRK11670 369 putative ATPase; Provisional 99.84
TIGR0294596 SUF_assoc FeS assembly SUF system protein; InterPro: IP 99.69
TIGR03406174 FeS_long_SufT probable FeS assembly SUF system protein 99.67
pfam0188376 DUF59 Domain of unknown function DUF59. This family inc 99.66
COG2151111 PaaD Predicted metal-sulfur cluster biosynthetic enzyme 99.61
TIGR02159152 PA_CoA_Oxy4 phenylacetate-CoA oxygenase, PaaJ subunit; 98.87
>PRK11670 putative ATPase; Provisional Back     alignment and domain information
>TIGR02945 SUF_assoc FeS assembly SUF system protein; InterPro: IPR014291 Iron-sulphur (FeS) clusters are important cofactors for numerous proteins involved in electron transfer, in redox and non-redox catalysis, in gene regulation, and as sensors of oxygen and iron Back     alignment and domain information
>TIGR03406 FeS_long_SufT probable FeS assembly SUF system protein SufT Back     alignment and domain information
>pfam01883 DUF59 Domain of unknown function DUF59 Back     alignment and domain information
>COG2151 PaaD Predicted metal-sulfur cluster biosynthetic enzyme [General function prediction only] Back     alignment and domain information
>TIGR02159 PA_CoA_Oxy4 phenylacetate-CoA oxygenase, PaaJ subunit; InterPro: IPR011883 Phenylacetate-CoA oxygenase is comprised of a five gene complex responsible for the hydroxylation of phenylacetate-CoA (PA-CoA) as the second catabolic step in phenylacetic acid (PA) degradation , Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target101 Mrp protein [Candidatus Liberibacter asiaticus str. psy
1uwd_A103 Nmr Structure Of A Protein With Unknown Function Fr 5e-13
3cq1_A103 Structure Of The Dtdp-4-Keto-L-Rhamnose Reductase R 7e-08
2cu6_A103 Crystal Structure Of The Dtdp-4-Keto-L-Rhamnose Red 7e-08
3lno_A108 Crystal Structure Of Domain Of Unknown Function Duf 2e-06
>gi|58176957|pdb|1UWD|A Chain A, Nmr Structure Of A Protein With Unknown Function From Thermotoga Maritima (Tm0487), Which Belongs To The Duf59 Family. Length = 103 Back     alignment and structure
 Score = 77.8 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 19/97 (19%), Positives = 46/97 (47%), Gaps = 2/97 (2%)

Query: 1  MNQ-ILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNT-VYLSITVPHTIAHQLQSL 58
          M++ + K  ++++LK +       ++V +  + +I I     V + +T+   +      +
Sbjct: 2  MSKKVTKEDVLNALKNVIDFELGLDVVSLGLVYDIQIDDQNNVKVLMTMTTPMCPLAGMI 61

Query: 59 RSNAQQIIQNIPTVKNAVVTLTENKNPPQQRNNLNVK 95
           S+A++ I+ I  V N  V LT +     +R +  ++
Sbjct: 62 LSDAEEAIKKIEGVNNVEVELTFDPPWTPERMSPELR 98


>gi|226438173|pdb|3CQ1|A Chain A, Structure Of The Dtdp-4-Keto-L-Rhamnose Reductase Related Protein (Tt1362) From Thermus Thermophilus Hb8 Length = 103 Back     alignment and structure
>gi|83754864|pdb|2CU6|A Chain A, Crystal Structure Of The Dtdp-4-Keto-L-Rhamnose Reductase- Related Protein From Thermus Thermophilus Hb8 Length = 103 Back     alignment and structure
>gi|288965879|pdb|3LNO|A Chain A, Crystal Structure Of Domain Of Unknown Function Duf59 From Bacillus Anthracis Length = 108 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target101 Mrp protein [Candidatus Liberibacter asiaticus str. psy
1uwd_A103 Hypothetical protein TM0487; structural genomics, unkno 99.79
3cq1_A103 Putative uncharacterized protein TTHB138; DTDP-4-keto-L 99.78
3lno_A108 Putative uncharacterized protein; alpha-beta fold, stru 99.69
1th5_A74 NIFU1; iron-sulfur cluster binding, structural genomics 94.69
2z51_A154 NIFU-like protein 2, chloroplast; CNFU, iron-sulfur clu 92.25
1xhj_A88 Nitrogen fixation protein NIFU; alpha-beta, NIFU-like, 90.1
>1uwd_A Hypothetical protein TM0487; structural genomics, unknown function, contains PAAD domain, similar to PAAD protein, unknown activity; NMR {Thermotoga maritima} SCOP: d.52.8.2 PDB: 1wcj_A Back     alignment and structure
Probab=99.79  E-value=1.2e-19  Score=130.34  Aligned_cols=91  Identities=21%  Similarity=0.217  Sum_probs=85.6

Q ss_pred             CCCCHHHHHHHHHHCCCCCCCCCHHHCCCCCCCCCCC-CEEEEEEEECHHHCHHHHHHHHHHHHHHHCCCCCCCEEEEEE
Q ss_conf             6035899999984141879997623238701013369-879999996722220689999999999853985340699997
Q gi|254780881|r    2 NQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVH-NTVYLSITVPHTIAHQLQSLRSNAQQIIQNIPTVKNAVVTLT   80 (101)
Q Consensus         2 s~~~~~~I~~~L~~v~dP~~~~~iv~~g~V~~i~i~~-~~v~i~l~l~~~~~~~~~~l~~~i~~~l~~i~gv~~v~V~lt   80 (101)
                      .++++++|+++|++|.||+++.|||++|+|+++.+++ |+|.|.+++++++|+..+.|.++++++|++++|+.+|+|.++
T Consensus         4 ~~i~~e~V~~aL~~V~DPel~~~IvdLGlV~~i~i~~~g~v~v~~~lt~~~CP~~~~i~~~i~~al~~~~gv~~V~V~~~   83 (103)
T 1uwd_A            4 KKVTKEDVLNALKNVIDFELGLDVVSLGLVYDIQIDDQNNVKVLMTMTTPMCPLAGMILSDAEEAIKKIEGVNNVEVELT   83 (103)
T ss_dssp             SCCCHHHHHHHHTTCBCTTTSSBTTTTTCCCCEEECTTCEEEEEECCSSSCCSSHHHHHHHHHHHHHTSSSCCEEEEEEC
T ss_pred             CCCCHHHHHHHHHCCCCCCCCCCEECCCCEEEEEECCCCEEEEEEEECCCCCCHHHHHHHHHHHHHHCCCCCCEEEEEEE
T ss_conf             53799999999817889999988443683435786269808999986899986579999999999980899742899999


Q ss_pred             ECCCCCCCCCCC
Q ss_conf             078987321569
Q gi|254780881|r   81 ENKNPPQQRNNL   92 (101)
Q Consensus        81 ~~~~~~~~~~~~   92 (101)
                      ++++|......+
T Consensus        84 ~~p~Wt~~~~s~   95 (103)
T 1uwd_A           84 FDPPWTPERMSP   95 (103)
T ss_dssp             CSSCCCGGGSCH
T ss_pred             ECCCCCHHHCCH
T ss_conf             669999377889



>3cq1_A Putative uncharacterized protein TTHB138; DTDP-4-keto-L-rhamnose reductase, plasmid, oxidoreductase, structural genomics, NPPSFA; 1.90A {Thermus thermophilus} PDB: 2cu6_A 3cq2_A 3cq3_A* Back     alignment and structure
>3lno_A Putative uncharacterized protein; alpha-beta fold, structural genomics, center for structural genomics of infectious diseases, csgid; 2.10A {Bacillus anthracis} Back     alignment and structure
>1th5_A NIFU1; iron-sulfur cluster binding, structural genomics, program for RICE genome research, unknown function; NMR {Oryza sativa} SCOP: d.52.8.1 Back     alignment and structure
>2z51_A NIFU-like protein 2, chloroplast; CNFU, iron-sulfur cluster biosynthesis, metal transport; 1.35A {Arabidopsis thaliana} PDB: 2jnv_A Back     alignment and structure
>1xhj_A Nitrogen fixation protein NIFU; alpha-beta, NIFU-like, structural genomics, protein structure initiative, NESG, PSI; NMR {Staphylococcus epidermidis atcc 12228} SCOP: d.52.8.1 Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target101 Mrp protein [Candidatus Liberibacter asiaticus str. psy
d1uwda_102 Hypothetical protein TM0487 {Thermotoga maritima [TaxId 99.79
d2cu6a191 Hypothetical protein TTHB138 {Thermus thermophilus [Tax 99.76
d1xhja_88 Nitrogen fixation protein NifU homolog SE0630 {Staphylo 92.36
d1th5a173 NifU-like protein 1, NIFUL1 {Rice (Oryza sativa) [TaxId 90.75
>d1uwda_ d.52.8.2 (A:) Hypothetical protein TM0487 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Alpha-lytic protease prodomain-like
superfamily: Fe-S cluster assembly (FSCA) domain-like
family: PaaD-like
domain: Hypothetical protein TM0487
species: Thermotoga maritima [TaxId: 2336]
Probab=99.79  E-value=1.5e-19  Score=128.41  Aligned_cols=91  Identities=21%  Similarity=0.217  Sum_probs=85.3

Q ss_pred             CCCCHHHHHHHHHHCCCCCCCCCHHHCCCCCCCCCCC-CEEEEEEEECHHHCHHHHHHHHHHHHHHHCCCCCCCEEEEEE
Q ss_conf             6035899999984141879997623238701013369-879999996722220689999999999853985340699997
Q gi|254780881|r    2 NQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVH-NTVYLSITVPHTIAHQLQSLRSNAQQIIQNIPTVKNAVVTLT   80 (101)
Q Consensus         2 s~~~~~~I~~~L~~v~dP~~~~~iv~~g~V~~i~i~~-~~v~i~l~l~~~~~~~~~~l~~~i~~~l~~i~gv~~v~V~lt   80 (101)
                      .++++++|+++|++|.||++++|||++|+|+++.+++ |.|.|.+++++++|+..+.|.+++++++.+++|+.+|.|.++
T Consensus         3 ~~vt~~~V~~aL~~V~DPe~~~dIV~LGlV~~i~I~~~g~V~v~~~lt~~~Cp~~~~i~~~i~~al~~~~gV~~v~V~i~   82 (102)
T d1uwda_           3 KKVTKEDVLNALKNVIDFELGLDVVSLGLVYDIQIDDQNNVKVLMTMTTPMCPLAGMILSDAEEAIKKIEGVNNVEVELT   82 (102)
T ss_dssp             SCCCHHHHHHHHTTCBCTTTSSBTTTTTCCCCEEECTTCEEEEEECCSSSCCSSHHHHHHHHHHHHHTSSSCCEEEEEEC
T ss_pred             CCCCHHHHHHHHHCCCCCCCCCCEEECCCEEEEEECCCCCEEEEEECCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEEEE
T ss_conf             51599999999817889999926144362356775146642788864889996279999999999982899760899999


Q ss_pred             ECCCCCCCCCCC
Q ss_conf             078987321569
Q gi|254780881|r   81 ENKNPPQQRNNL   92 (101)
Q Consensus        81 ~~~~~~~~~~~~   92 (101)
                      ++++|...+..+
T Consensus        83 ~~p~W~~~~~s~   94 (102)
T d1uwda_          83 FDPPWTPERMSP   94 (102)
T ss_dssp             CSSCCCGGGSCH
T ss_pred             ECCCCCHHHCCH
T ss_conf             629999377789



>d2cu6a1 d.52.8.2 (A:6-96) Hypothetical protein TTHB138 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xhja_ d.52.8.1 (A:) Nitrogen fixation protein NifU homolog SE0630 {Staphylococcus epidermidis [TaxId: 1282]} Back     information, alignment and structure
>d1th5a1 d.52.8.1 (A:154-226) NifU-like protein 1, NIFUL1 {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target101 Mrp protein [Candidatus Liberibacter asiaticus str. psy
3cq1_A_103 Putative uncharacterized protein TTHB138; DTDP-4-k 99.8
1uwd_A_1-8888 Hypothetical protein TM0487; structural genomics, 99.75
3lno_A_1-9292 Putative uncharacterized protein; alpha-beta fold, 99.74
>3cq1_A (A:) Putative uncharacterized protein TTHB138; DTDP-4-keto-L-rhamnose reductase, plasmid, oxidoreductase, structural genomics, NPPSFA; 1.90A {Thermus thermophilus} PDB: 2cu6_A 3cq2_A 3cq3_A* Back     alignment and structure
Probab=99.80  E-value=7.6e-20  Score=132.27  Aligned_cols=95  Identities=16%  Similarity=0.164  Sum_probs=90.1

Q ss_pred             CCCCCHHHHHHHHHHCCCCCCCCCHHHCCCCCCCCCCCCEEEEEEEECHHHCHHHHHHHHHHHHHHHCCCCCCCEEEEEE
Q ss_conf             96035899999984141879997623238701013369879999996722220689999999999853985340699997
Q gi|254780881|r    1 MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQNIPTVKNAVVTLT   80 (101)
Q Consensus         1 Ms~~~~~~I~~~L~~v~dP~~~~~iv~~g~V~~i~i~~~~v~i~l~l~~~~~~~~~~l~~~i~~~l~~i~gv~~v~V~lt   80 (101)
                      |+..++++|+++|++|.||++++||+++|+|+++.+++++|.|.|.+++++|+.++.++++++++|+.++|+++|+|.++
T Consensus         3 ~~~~~~~~i~~aL~~V~DP~~~~~Iv~lg~V~~i~i~~~~V~v~l~l~~~~~~~~~~i~~~i~~~l~~l~gv~~V~V~~~   82 (103)
T 3cq1_A            3 ARNPLEAQAWALLEAVYDPELGLDVVNLGLIYDLVVEPPRAYVRXTLTTPGCPLHDSLGEAVRQALSRLPGVEEVEVEVT   82 (103)
T ss_dssp             CCSHHHHHHHHHHTTCBCTTTCSBTTTTTCEEEEEEETTEEEEEECCSSSSCCSSCHHHHHHHHHHHTSTTCCEEEEEEC
T ss_pred             CCCHHHHHHHHHHCCCCCCCCCCCHHHCCCCEEEEEECCCCEEEEECCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEEEE
T ss_conf             88378999999981688989998844457721578865835728807999986789999999999981899750899999


Q ss_pred             ECCCCCCCCCCCCCC
Q ss_conf             078987321569985
Q gi|254780881|r   81 ENKNPPQQRNNLNVK   95 (101)
Q Consensus        81 ~~~~~~~~~~~~gvK   95 (101)
                      ++.+|...+..+..|
T Consensus        83 ~~~~~~~~~~~~~~r   97 (103)
T 3cq1_A           83 FEPPWTLARLSEKAR   97 (103)
T ss_dssp             CSSCCCGGGCCSGGG
T ss_pred             ECCCCCHHHCCHHHH
T ss_conf             669999577759999



>1uwd_A (A:1-88) Hypothetical protein TM0487; structural genomics, unknown function, contains PAAD domain, similar to PAAD protein, unknown activity; NMR {Thermotoga maritima} Back     alignment and structure
>3lno_A (A:1-92) Putative uncharacterized protein; alpha-beta fold, structural genomics, center for structural genomics of infectious diseases, csgid; 2.10A {Bacillus anthracis} Back     alignment and structure