254780905

254780905

glutamate racemase

GeneID in NCBI database:8209925Locus tag:CLIBASIA_04020
Protein GI in NCBI database:254780905Protein Accession:YP_003065318.1
Gene range:+(885150, 885965)Protein Length:271aa
Gene description:glutamate racemase
COG prediction:none
KEGG prediction:murI; glutamate racemase (EC:5.1.1.3); K01776 glutamate racemase [EC:5.1.1.3]
SEED prediction:Glutamate racemase (EC 5.1.1.3)
Pathway involved in KEGG:D-Glutamine and D-glutamate metabolism [PATH:las00471]
Subsystem involved in SEED:Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis;
Peptidoglycan Biosynthesis
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED3 TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-
MKIDNYPCEKKLQNSILIFDSGIGGLIVLQKMRFLMPEYHFIYVADDVGFPYGNWEDHALKKRLMFLFSDILDKYQPVLSVIACNTAFTLIKDELRSTFPSMAFLGAVPAIKQAAAYTQSGLISILSTPATLRRTYTSNLIHSYVSQCHIHLVSSMILASRVEEYACGIKIKEDEIKKEIEGCFIEKEGKRTDVIVLACTHYPLIVHVFRQLSPWPVDWLDNSDSIARRARCLLPRINTHQTRVFDDHALFLSGKPDIAMRRLMQGFGLKS
cccccccccccccccEEEEEccccHHHHHHHHHHHcccccEEEEEEccccccccccHHHHHHHHHHHHHHHHHcccccEEEEcccccHHHHHHHHHHHcccccEEEEHHHHHHHHHHccccEEEEEccHHHHHHHHHHHHHHHHccccEEEEcccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHccccEEEEEcccHHHHHHHHHHHcccccEEEEcHHHHHHHHHHHHHHcccccccccccEEEEEcccHHHHHHHHHHHccccc
cccccccccccccccEEEEcccccHHHHHHHHHHHcccccEEEEEcccccccccccHHHHHHHHHHHHHHHHHHccccEEEEEccHHHHHHHHHHHHHcccccEEEEccccHHHHHHHccccEEEEEcccccccHHHHHHHHHHccccEEEEcccccHHHHHHcccccccccHHHHHHHHHHHHHHHccccccEEEEcccccHHHHHHHHHHcccccEEEccHHHHHHHHHHHHHHccccccccccccEEEEcccHHHHHHHHHHHHcccc
mkidnypcekklqNSILIFDSGIGGLIVLQKMRFLMPEYHFIyvaddvgfpygnweDHALKKRLMFLFSDILDKYQPVLSVIACNTAFTLIKDElrstfpsmaflGAVPAIKQAAAYTQSGLIsilstpatlRRTYTSNLIHSYVSQCHIHLVSSMILASRVEEYACGIKIKEDEIKKEIEGCfiekegkrTDVIVLACTHYPLIVHVFrqlspwpvdwldnsdSIARRARCLlprinthqtrvfddhalflsgkPDIAMRRLMQGFGLKS
MKIDNYPCEKKLQNSILIFDSGIGGLIVLQKMRFLMPEYHFIYVADDVGFPYGNWEDHALKKRLMFLFSDILDKYQPVLSVIACNTAFTLIKDELRSTFPSMAFLGAVPAIKQAAAYTQSGLISILSTPATLRRTYTSNLIHSYVSQCHIHLVSSMILASRVEEYACGikikedeiKKEIEGCfiekegkrTDVIVLACTHYPLIVHVFRQLSPWPVDWLDNSDSIARRARCLLPRinthqtrvfddhalflsgkpdIAMRRLMQGFGLKS
MKIDNYPCEKKLQNSILIFDSGIGGLIVLQKMRFLMPEYHFIYVADDVGFPYGNWEDHALKKRLMFLFSDILDKYQPVLSVIACNTAFTLIKDELRSTFPSMAFLGAVPAIKQAAAYTQSGLISILSTPATLRRTYTSNLIHSYVSQCHIHLVSSMILASRVEEYACGikikedeikkeieGCFIEKEGKRTDVIVLACTHYPLIVHVFRQLSPWPVDWLDNSDSIARRARCLLPRINTHQTRVFDDHALFLSGKPDIAMRRLMQGFGLKS
***************ILIFDSGIGGLIVLQKMRFLMPEYHFIYVADDVGFPYGNWEDHALKKRLMFLFSDILDKYQPVLSVIACNTAFTLIKDELRSTFPSMAFLGAVPAIKQAAAYTQSGLISILSTPATLRRTYTSNLIHSYVSQCHIHLVSSMILASRVEEYACGIKIKEDEIKKEIEGCFIEKEGKRTDVIVLACTHYPLIVHVFRQLSPWPVDWLDNSDSIARRARCLL**************ALFLSGKPDIAMRRLMQGFGLK*
MKIDNYPCEKKLQNSILIFDSGIGGLIVLQKMRFLMPEYHFIYVADDVGFPYGNWEDHALKKRLMFLFSDILDKYQPVLSVIACNTAFTLIKDELRSTFPSMAFLGAVPAIKQAAAYTQSGLISILSTPATLRRTYTSNLIHSYVSQCHIHLVSSMILASRVEEYACGIKIKEDEIKKEIEGCFIEKEGKRTDVIVLACTHYPLIVHVFRQLSPWPVDWLDNSDSIARRARCLLPRINTHQTRVFDDHALFLSGKPDIAMRRLMQGFGLKS
*****YPCEKKLQNSILIFDSGIGGLIVLQKMRFLMPEYHFIYVADDVGFPYGNWEDHALKKRLMFLFSDILDKYQPVLSVIACNTAFTLIKDELRSTFPSMAFLGAVPAIKQAAAYTQSGLISILSTPATLRRTYTSNLIHSYVSQCHIHLVSSMILASRVEEYACGIKIKEDEIKKEIEGCFIEKEGKRTDVIVLACTHYPLIVHVFRQLSPWPVDWLDNSDSIARRARCLLPRINTHQTRVFDDHALFLSGKPDIAMRRLMQGFGLKS
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKIDNYPCEKKLQNSILIFDSGIGGLIVLQKMRFLMPEYHFIYVADDVGFPYGNWEDHALKKRLMFLFSDILDKYQPVLSVIACNTAFTLIKDELRSTFPSMAFLGAVPAIKQAAAYTQSGLISILSTPATLRRTYTSNLIHSYVSQCHIHLVSSMILASRVEEYACGIKIKEDEIKKEIEGCFIEKEGKRTDVIVLACTHYPLIVHVFRQLSPWPVDWLDNSDSIARRARCLLPRINTHQTRVFDDHALFLSGKPDIAMRRLMQGFGLKS
MKIDNYPCEKKLQNSILIFDSGIGGLIVLQKMRFLMPEYHFIYVADDVGFPYGNWEDHALKKRLMFLFSDILDKYQPVLSVIACNTAFTLIKDELRSTFPSMAFLGAVPAIKQAAAYTQSGLISILSTPATLRRTYTSNLIHSYVSQCHIHLVSSMILASRVEEYACGIKIKEDEIKKEIEGCFIEKEGKRTDVIVLACTHYPLIVHVFRQLSPWPVDWLDNSDSIARRARCLLPRINTHQTRVFDDHALFLSGKPDIAMRRLMQGFGLKS
MKIDNYPCEKKLQNSILIFDSGIGGLIVLQKMRFLMPEYHFIYVADDVGFPYGNWEDHALKKRLMFLFSDILDKYQPVLSVIACNTAFTLIKDELRSTFPSMAFLGAVPAIKQAAAYTQSGLISILSTPATLRRTYTSNLIHSYVSQCHIHLVSSMILASRVEEYACGIKIKEDEIKKEIEGCFIEKEGKRTDVIVLACTHYPLIVHVFRQLSPWPVDWLDNSDSIARRARCLLPRINTHQTRVFDDHALFLSGKPDIAMRRLMQGFGLKS

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target271 glutamate racemase [Candidatus Liberibacter asiaticus s
315122618271 glutamate racemase [Candidatus Liberibacter solanacearu 1 1e-114
150396728271 glutamate racemase [Sinorhizobium medicae WSM419] Lengt 1 1e-87
15965542277 glutamate racemase [Sinorhizobium meliloti 1021] Length 1 2e-87
227822188267 glutamate racemase [Sinorhizobium fredii NGR234] Length 1 9e-87
328543188258 glutamate racemase [polymorphum gilvum SL003B-26A1] Len 1 4e-85
241204880267 glutamate racemase [Rhizobium leguminosarum bv. trifoli 1 1e-84
116252373267 glutamate racemase [Rhizobium leguminosarum bv. viciae 1 2e-84
218663166450 glutamate racemase [Rhizobium etli IE4771] Length = 450 1 2e-84
325293269273 Glutamate racemase [Agrobacterium sp. H13-3] Length = 2 1 4e-84
86357929266 glutamate racemase [Rhizobium etli CFN 42] Length = 266 1 4e-84
>gi|315122618|ref|YP_004063107.1| glutamate racemase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 271 Back     alignment and organism information
 Score =  416 bits (1069), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 190/262 (72%), Positives = 226/262 (86%)

Query: 9   EKKLQNSILIFDSGIGGLIVLQKMRFLMPEYHFIYVADDVGFPYGNWEDHALKKRLMFLF 68
           +K  +N I+IFDSGIGGL VLQK+RFLMPEYHFIYVADD GFPYGNWED+ALK+RL+FLF
Sbjct: 9   KKNPKNCIMIFDSGIGGLSVLQKVRFLMPEYHFIYVADDSGFPYGNWEDNALKERLLFLF 68

Query: 69  SDILDKYQPVLSVIACNTAFTLIKDELRSTFPSMAFLGAVPAIKQAAAYTQSGLISILST 128
           +DIL+KY+PVLS++ACNTAFTL+KDELRSTFPSM FLGAVPAIKQA  YT +GL+S+LST
Sbjct: 69  ADILEKYKPVLSIVACNTAFTLVKDELRSTFPSMLFLGAVPAIKQATVYTSTGLVSVLST 128

Query: 129 PATLRRTYTSNLIHSYVSQCHIHLVSSMILASRVEEYACGIKIKEDEIKKEIEGCFIEKE 188
           PATLRR YT +LI SY S+C I+LVSS  LAS  E+Y CG  +KED I++EI+GCF+EKE
Sbjct: 129 PATLRRAYTDDLIRSYASKCQINLVSSTTLASIAEDYTCGKIVKEDGIQREIQGCFLEKE 188

Query: 189 GKRTDVIVLACTHYPLIVHVFRQLSPWPVDWLDNSDSIARRARCLLPRINTHQTRVFDDH 248
           G+RTDV+VLACTHYP + H+FR+LSPWPVDWLD S SIARRAR LLP I  ++  + DD 
Sbjct: 189 GRRTDVVVLACTHYPFMTHIFRRLSPWPVDWLDTSYSIARRARSLLPVIAMNEVGLSDDQ 248

Query: 249 ALFLSGKPDIAMRRLMQGFGLK 270
            +F+S KPDIAM+RLMQGFGLK
Sbjct: 249 VVFISRKPDIAMQRLMQGFGLK 270


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|150396728|ref|YP_001327195.1| glutamate racemase [Sinorhizobium medicae WSM419] Length = 271 Back     alignment and organism information
>gi|15965542|ref|NP_385895.1| glutamate racemase [Sinorhizobium meliloti 1021] Length = 277 Back     alignment and organism information
>gi|227822188|ref|YP_002826159.1| glutamate racemase [Sinorhizobium fredii NGR234] Length = 267 Back     alignment and organism information
>gi|328543188|ref|YP_004303297.1| glutamate racemase [polymorphum gilvum SL003B-26A1] Length = 258 Back     alignment and organism information
>gi|241204880|ref|YP_002975976.1| glutamate racemase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 267 Back     alignment and organism information
>gi|116252373|ref|YP_768211.1| glutamate racemase [Rhizobium leguminosarum bv. viciae 3841] Length = 267 Back     alignment and organism information
>gi|218663166|ref|ZP_03519096.1| glutamate racemase [Rhizobium etli IE4771] Length = 450 Back     alignment and organism information
>gi|325293269|ref|YP_004279133.1| Glutamate racemase [Agrobacterium sp. H13-3] Length = 273 Back     alignment and organism information
>gi|86357929|ref|YP_469821.1| glutamate racemase [Rhizobium etli CFN 42] Length = 266 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target271 glutamate racemase [Candidatus Liberibacter asiaticus s
PRK00865261 PRK00865, PRK00865, glutamate racemase; Provisional 7e-72
TIGR00067251 TIGR00067, glut_race, glutamate racemase 2e-31
COG0796269 COG0796, MurI, Glutamate racemase [Cell envelope biogen 5e-57
pfam01177212 pfam01177, Asp_Glu_race, Asp/Glu/Hydantoin racemase 7e-13
>gnl|CDD|179146 PRK00865, PRK00865, glutamate racemase; Provisional Back     alignment and domain information
>gnl|CDD|161688 TIGR00067, glut_race, glutamate racemase Back     alignment and domain information
>gnl|CDD|31139 COG0796, MurI, Glutamate racemase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|144681 pfam01177, Asp_Glu_race, Asp/Glu/Hydantoin racemase Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 271 glutamate racemase [Candidatus Liberibacter asiaticus s
PRK00865262 glutamate racemase; Provisional 100.0
COG0796269 MurI Glutamate racemase [Cell envelope biogenesis, oute 100.0
TIGR00067262 glut_race glutamate racemase; InterPro: IPR004391 Gluta 100.0
pfam01177212 Asp_Glu_race Asp/Glu/Hydantoin racemase. This family co 99.97
PRK10200230 putative racemase; Provisional 99.94
COG1794230 RacX Aspartate racemase [Cell envelope biogenesis, oute 99.9
TIGR00035241 asp_race aspartate racemase; InterPro: IPR004380 Aspara 99.62
COG3473238 Maleate cis-trans isomerase [Secondary metabolites bios 98.22
COG4126230 Hydantoin racemase [Amino acid transport and metabolism 98.97
PRK07475243 hypothetical protein; Provisional 98.01
) and D-serine dehydratase () catalyze the dehydratation of L-serine (respectively D-serine) into ammonia and pyruvate. Threonine dehydratase () (TDH) catalyzes the dehydratation of threonine into alpha-ketobutarate and ammonia. In Escherichia coli and other microorganisms, two classes of TDH are known to exist. One is involved in the biosynthesis of isoleucine, the other in hydroxamino acid catabolism. Threonine synthase () is also a pyridoxal-phosphate enzyme, it catalyzes the transformation of homoserine-phosphate into threonine. It has been shown that threonine synthase is distantly related to the serine/threonine dehydratases. In all these enzymes, the pyridoxal-phosphate group is attached to a lysine residue. This family describes a form of threonine dehydratase, with two copies of the threonine dehydratase C-terminal domain IPR001721 from INTERPRO. Members with known function participate in isoleucine biosynthesis and are inhibited by isoleucine.; GO: 0004794 L-threonine ammonia-lyase activity, 0009097 isoleucine biosynthetic process." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR01124">TIGR01124 508 ilvA_2Cterm threonine ammonia-lyase, biosynthetic; Inte 92.95
PRK10200230 putative racemase; Provisional 96.0
TIGR02990239 ectoine_eutA ectoine utilization protein EutA; InterPro 95.97
COG1794230 RacX Aspartate racemase [Cell envelope biogenesis, oute 95.5
pfam01177212 Asp_Glu_race Asp/Glu/Hydantoin racemase. This family co 95.41
PRK01433 595 hscA chaperone protein HscA; Provisional 92.7
pfam06723327 MreB_Mbl MreB/Mbl protein. This family consists of bact 90.45
PRK04965 378 nitric oxide reductase; Provisional 95.19
COG4126230 Hydantoin racemase [Amino acid transport and metabolism 93.33
>PRK00865 glutamate racemase; Provisional Back     alignment and domain information
>COG0796 MurI Glutamate racemase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR00067 glut_race glutamate racemase; InterPro: IPR004391 Glutamate racemase (5 Back     alignment and domain information
>pfam01177 Asp_Glu_race Asp/Glu/Hydantoin racemase Back     alignment and domain information
>PRK10200 putative racemase; Provisional Back     alignment and domain information
>COG1794 RacX Aspartate racemase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR00035 asp_race aspartate racemase; InterPro: IPR004380 Asparate racemases (5 Back     alignment and domain information
>COG3473 Maleate cis-trans isomerase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG4126 Hydantoin racemase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07475 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01124 ilvA_2Cterm threonine ammonia-lyase, biosynthetic; InterPro: IPR005787 Serine and threonine dehydratases , are functionally and structurally related pyridoxal-phosphate dependent enzymes Back     alignment and domain information
>PRK10200 putative racemase; Provisional Back     alignment and domain information
>TIGR02990 ectoine_eutA ectoine utilization protein EutA; InterPro: IPR014332 Members of this protein family are EutA, a predicted arylmalonate decarboxylase found in a conserved ectoine utilization operon of species that include include Mesorhizobium loti, Silicibacter pomeroyi and Sinorhizobium meliloti 1021, where it is known to be induced by ectoine Back     alignment and domain information
>COG1794 RacX Aspartate racemase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>pfam01177 Asp_Glu_race Asp/Glu/Hydantoin racemase Back     alignment and domain information
>PRK01433 hscA chaperone protein HscA; Provisional Back     alignment and domain information
>pfam06723 MreB_Mbl MreB/Mbl protein Back     alignment and domain information
>PRK04965 nitric oxide reductase; Provisional Back     alignment and domain information
>COG4126 Hydantoin racemase [Amino acid transport and metabolism] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target271 glutamate racemase [Candidatus Liberibacter asiaticus s
1zuw_A272 Crystal Structure Of B.Subtilis Glutamate Racemase 1e-67
2gzm_A267 Crystal Structure Of The Glutamate Racemase From Ba 1e-66
2jfo_A293 Crystal Structure Of Enterococcus Faecalis Glutamat 2e-65
2vvt_A290 Glutamate Racemase (Muri) From E. Faecalis In Compl 2e-65
2jfu_A291 Crystal Structure Of Enterococcus Faecium Glutamate 7e-65
3hfr_A269 Crystal Structure Of Glutamate Racemase From Lister 9e-62
2jfq_A286 Crystal Structure Of Staphylococcus Aureus Glutamat 9e-62
2oho_A273 Structural Basis For Glutamate Racemase Inhibitor L 4e-60
2ohg_A264 Structural Basis For Glutamte Racemase Inhibition L 5e-60
2dwu_A276 Crystal Structure Of Glutamate Racemase Isoform Rac 1e-58
2jfn_A267 Crystal Structure Of Escherichia Coli Glutamate Rac 9e-55
3out_A268 Crystal Structure Of Glutamate Racemase From Franci 9e-50
1b73_A254 Glutamate Racemase From Aquifex Pyrophilus Length = 3e-49
2jfx_A255 Crystal Structure Of Helicobacter Pylori Glutamate 5e-38
1jfl_A228 Crystal Structure Determination Of Aspartate Racema 2e-05
2dx7_A228 Crystal Structure Of Pyrococcus Horikoshii Ot3 Aspa 9e-05
>gi|83753859|pdb|1ZUW|A Chain A, Crystal Structure Of B.Subtilis Glutamate Racemase (Race) With D-Glu Length = 272 Back     alignment and structure
 Score =  260 bits (665), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 55/258 (21%), Positives = 108/258 (41%), Gaps = 5/258 (1%)

Query: 12  LQNSILIFDSGIGGLIVLQKMRFLMPEYHFIYVADDVGFPYGNWEDHALKKRLMFLFSDI 71
           L+  I + DSG+GGL V +++   +P+ + IYV D    PYG   +  + +    L + +
Sbjct: 2   LEQPIGVIDSGVGGLTVAKEIMRQLPKENIIYVGDTKRCPYGPRPEEEVLQYTWELTNYL 61

Query: 72  LDKYQPVLSVIACNTAFTLIKDELRSTFPSMAFLGAVPAIKQAAAYTQSGLISILSTPAT 131
           L+ +   + VIACNTA  +  D+++ +          P  + A   T +  I ++ T  T
Sbjct: 62  LENHHIKMLVIACNTATAIALDDIQRSVGIPVVGVIQPGARAAIKVTDNQHIGVIGTENT 121

Query: 132 LRRTYTSNLIHSYVSQCHIHLVSSMILASRVEEYACGIKIKEDEIKKEIEGCFIEKEGKR 191
           ++       + +      +  ++  +L   VE      K  +    + ++      +   
Sbjct: 122 IKSNAYEEALLALNPDLKVENLACPLLVPFVE----SGKFLDQTADEIVKTSLYPLKDTS 177

Query: 192 TDVIVLACTHYPLIVHVFRQLSPWPVDWLDNSDSIARRARCLLPRINTHQ-TRVFDDHAL 250
            D ++L CTHYP++    ++     V+ + + D  AR    +L        + +  DH  
Sbjct: 178 IDSLILGCTHYPILKEAIQRYMGEHVNIISSGDETAREVSTILSYKGLLNQSPIAPDHQF 237

Query: 251 FLSGKPDIAMRRLMQGFG 268
             +G  D   +     FG
Sbjct: 238 LTTGARDQFAKIADDWFG 255


>gi|149241773|pdb|2GZM|A Chain A, Crystal Structure Of The Glutamate Racemase From Bacillus Anthracis Length = 267 Back     alignment and structure
>gi|151567719|pdb|2JFO|A Chain A, Crystal Structure Of Enterococcus Faecalis Glutamate Racemase In Complex With D- And L-Glutamate Length = 293 Back     alignment and structure
>gi|192988279|pdb|2VVT|A Chain A, Glutamate Racemase (Muri) From E. Faecalis In Complex With A 9-Benzyl Purine Inhibitor Length = 290 Back     alignment and structure
>gi|151567725|pdb|2JFU|A Chain A, Crystal Structure Of Enterococcus Faecium Glutamate Racemase In Complex With Phosphate Length = 291 Back     alignment and structure
>gi|239782122|pdb|3HFR|A Chain A, Crystal Structure Of Glutamate Racemase From Listeria Monocytogenes Length = 269 Back     alignment and structure
>gi|151567723|pdb|2JFQ|A Chain A, Crystal Structure Of Staphylococcus Aureus Glutamate Racemase In Complex With D-Glutamate Length = 286 Back     alignment and structure
>gi|158429235|pdb|2OHO|A Chain A, Structural Basis For Glutamate Racemase Inhibitor Length = 273 Back     alignment and structure
gi|158429234|pdb|2OHG|A Chain A, Structural Basis For Glutamte Racemase Inhibition Length = 264 Back     alignment and structure
gi|150261200|pdb|2DWU|A Chain A, Crystal Structure Of Glutamate Racemase Isoform Race1 From Bacillus Anthracis Length = 276 Back     alignment and structure
>gi|307776633|pdb|3OUT|A Chain A, Crystal Structure Of Glutamate Racemase From Francisella Tularensis Subsp. Tularensis Schu S4 In Complex With D-Glutamate. Length = 268 Back     alignment and structure
>gi|6980778|pdb|1B73|A Chain A, Glutamate Racemase From Aquifex Pyrophilus Length = 254 Back     alignment and structure
gi|151567728|pdb|2JFX|A Chain A, Crystal Structure Of Helicobacter Pylori Glutamate Racemase In Complex With D-Glutamate Length = 255 Back     alignment and structure
gi|21465704|pdb|1JFL|A Chain A, Crystal Structure Determination Of Aspartate Racemase From An Archaea Length = 228 Back     alignment and structure
>gi|158428132|pdb|2DX7|A Chain A, Crystal Structure Of Pyrococcus Horikoshii Ot3 Aspartate Racemase Complex With Citric Acid Length = 228 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target271 glutamate racemase [Candidatus Liberibacter asiaticus s
2jfq_A286 Glutamate racemase; cell WALL, isomerase, cell shape, p 3e-41
2dwu_A276 Glutamate racemase; isomerase; HET: DGL; 1.60A {Bacillu 4e-41
3ist_A269 Glutamate racemase; structural genomics, cell WALL biog 4e-41
3out_A268 Glutamate racemase; structural genomics, center for str 4e-41
2jfn_A285 Glutamate racemase; cell WALL, isomerase, cell shape, U 1e-40
2vvt_A290 Glutamate racemase; isomerase, peptidoglycan synthesis, 1e-40
2gzm_A267 Glutamate racemase; enzyme, isomerase; HET: DGL; 1.99A 2e-39
2oho_A273 Glutamate racemase; isomerase; 2.25A {Streptococcus pyo 5e-39
1b73_A254 Glutamate racemase; isomerase; 2.30A {Aquifex pyrophilu 2e-37
1zuw_A272 Glutamate racemase 1; (R)-glutamate, peptidoglycan bios 5e-37
2jfz_A255 Glutamate racemase; cell WALL, isomerase, cell shape, p 5e-32
3ojc_A231 Putative aspartate/glutamate racemase; structural genom 2e-14
1jfl_A228 Aspartate racemase; alpha-beta structure, HOMO-dimer, h 5e-13
2zsk_A226 PH1733, 226AA long hypothetical aspartate racemase; alp 2e-12
2eq5_A228 228AA long hypothetical hydantoin racemase; structural 1e-08
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis,plant 0.002
>2jfq_A Glutamate racemase; cell WALL, isomerase, cell shape, peptidoglycan synthesis, peptidoglycan biosynthesis; HET: DGL; 2.15A {Staphylococcus aureus} Length = 286 Back     alignment and structure
 Score =  163 bits (414), Expect = 3e-41
 Identities = 56/261 (21%), Positives = 94/261 (36%), Gaps = 5/261 (1%)

Query: 11  KLQNSILIFDSGIGGLIVLQKMRFLMPEYHFIYVADDVGFPYGNWEDHALKKRLMFLFSD 70
            +   I + DSG+GGL V +++   +P     Y+ D    PYG      +K+  + +   
Sbjct: 20  HMNKPIGVIDSGVGGLTVAKEIMRQLPNETIYYLGDIGRCPYGPRPGEQVKQYTVEIA-R 78

Query: 71  ILDKYQPVLSVIACNTAFTLIKDELRSTFPSMAFLGAVPAIKQAAAYTQSGLISILSTPA 130
            L ++   + VIACNTA  +  + L+ T          P  + A   T++  + +L T  
Sbjct: 79  KLMEFDIKMLVIACNTATAVALEYLQKTLSISVIGVIEPGARTAIMTTRNQNVLVLGTEG 138

Query: 131 TLRRTYTSNLIHSYVSQCHIHLVSSMILASRVEEYACGIKIKEDEIKKEIEGCFIEKEGK 190
           T++       I        +H V+       VE+               I          
Sbjct: 139 TIKSEAYRTHIKRINPHVEVHGVACPGFVPLVEQ---MRYSDPTITSIVIHQTLKRWRNS 195

Query: 191 RTDVIVLACTHYPLIVHVFRQLSPWPVDWLDNSDSIARRARCLLPRINTHQTRV-FDDHA 249
            +D ++L CTHYPL+              + +    AR    LL   N H +     DH 
Sbjct: 196 ESDTVILGCTHYPLLYKPIYDYFGGKKTVISSGLETAREVSALLTFSNEHASYTEHPDHR 255

Query: 250 LFLSGKPDIAMRRLMQGFGLK 270
            F +G        + +   L 
Sbjct: 256 FFATGDTTHITNIIKEWLNLS 276


>2dwu_A Glutamate racemase; isomerase; HET: DGL; 1.60A {Bacillus anthracis} Length = 276 Back     alignment and structure
>3ist_A Glutamate racemase; structural genomics, cell WALL biogenesis/degradation, isomerase, peptidoglycan synthesis; HET: MSE; 1.65A {Listeria monocytogenes} PDB: 3hfr_A* 3isv_A* Length = 269 Back     alignment and structure
>3out_A Glutamate racemase; structural genomics, center for structural genomics of infec diseases, csgid, MURI, cell envelope; HET: MSE DGL; 1.65A {Francisella tularensis subsp} Length = 268 Back     alignment and structure
>2jfn_A Glutamate racemase; cell WALL, isomerase, cell shape, UDP- murnac-Ala, peptidoglycan biosynthesis, peptidoglycan synthesis; HET: GLU UMA; 1.9A {Escherichia coli} Length = 285 Back     alignment and structure
>2vvt_A Glutamate racemase; isomerase, peptidoglycan synthesis, cell WALL biogenesis/degradation, cell shape, benzyl purine, MURI inhibitor; HET: I24 DGL; 1.65A {Enterococcus faecalis} PDB: 2jfp_A* 2jfo_A* 2jfu_A 2jfv_A* 2jfw_A* Length = 290 Back     alignment and structure
>2gzm_A Glutamate racemase; enzyme, isomerase; HET: DGL; 1.99A {Bacillus anthracis} Length = 267 Back     alignment and structure
>2oho_A Glutamate racemase; isomerase; 2.25A {Streptococcus pyogenes m1 gas} PDB: 2ohg_A 2ohv_A* Length = 273 Back     alignment and structure
>1b73_A Glutamate racemase; isomerase; 2.30A {Aquifex pyrophilus} SCOP: c.78.2.1 c.78.2.1 PDB: 1b74_A* Length = 254 Back     alignment and structure
>1zuw_A Glutamate racemase 1; (R)-glutamate, peptidoglycan biosynthesis, isomerase; HET: DGL; 1.75A {Bacillus subtilis} Length = 272 Back     alignment and structure
>2jfz_A Glutamate racemase; cell WALL, isomerase, cell shape, peptidoglycan synthesis, peptidoglycan biosynthesis; HET: 003 DGL; 1.86A {Helicobacter pylori} PDB: 2jfx_A* 2jfy_A* 2w4i_A* Length = 255 Back     alignment and structure
>3ojc_A Putative aspartate/glutamate racemase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha beta; 1.75A {Yersinia pestis} Length = 231 Back     alignment and structure
>1jfl_A Aspartate racemase; alpha-beta structure, HOMO-dimer, homologous domains, isomerase; 1.90A {Pyrococcus horikoshii OT3} SCOP: c.78.2.1 c.78.2.1 PDB: 2dx7_A* 1iu9_A Length = 228 Back     alignment and structure
>2zsk_A PH1733, 226AA long hypothetical aspartate racemase; alpha/beta fold, unknown function; 2.55A {Pyrococcus horikoshii} Length = 226 Back     alignment and structure
>2eq5_A 228AA long hypothetical hydantoin racemase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.20A {Pyrococcus horikoshii OT3} Length = 228 Back     alignment and structure
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target271 glutamate racemase [Candidatus Liberibacter asiaticus s
1zuw_A272 Glutamate racemase 1; (R)-glutamate, peptidoglycan bios 100.0
2dwu_A276 Glutamate racemase; isomerase; HET: DGL; 1.60A {Bacillu 100.0
2gzm_A267 Glutamate racemase; enzyme, isomerase; HET: DGL; 1.99A 100.0
2jfq_A286 Glutamate racemase; cell WALL, isomerase, cell shape, p 100.0
3ist_A269 Glutamate racemase; structural genomics, cell WALL biog 100.0
2vvt_A290 Glutamate racemase; isomerase, peptidoglycan synthesis, 100.0
2oho_A273 Glutamate racemase; isomerase; 2.25A {Streptococcus pyo 100.0
2jfn_A285 Glutamate racemase; cell WALL, isomerase, cell shape, U 100.0
3out_A268 Glutamate racemase; structural genomics, center for str 100.0
2jfz_A255 Glutamate racemase; cell WALL, isomerase, cell shape, p 100.0
1b73_A254 Glutamate racemase; isomerase; 2.30A {Aquifex pyrophilu 100.0
2zsk_A226 PH1733, 226AA long hypothetical aspartate racemase; alp 100.0
3ojc_A231 Putative aspartate/glutamate racemase; structural genom 100.0
1jfl_A228 Aspartate racemase; alpha-beta structure, HOMO-dimer, h 100.0
2eq5_A228 228AA long hypothetical hydantoin racemase; structural 99.85
3ixl_A240 Amdase, arylmalonate decarboxylase; enantioselective de 99.0
2xed_A273 Putative maleate isomerase; nicotinic acid catabolism, 98.18
2dgd_A223 223AA long hypothetical arylmalonate decarboxylase; oct 96.84
2gqw_A 408 Ferredoxin reductase; flavoprotein, oxidoreductase; HET 94.53
2eq5_A228 228AA long hypothetical hydantoin racemase; structural 94.15
2zsk_A226 PH1733, 226AA long hypothetical aspartate racemase; alp 92.6
3ojc_A231 Putative aspartate/glutamate racemase; structural genom 94.02
>1zuw_A Glutamate racemase 1; (R)-glutamate, peptidoglycan biosynthesis, isomerase; HET: DGL; 1.75A {Bacillus subtilis} Back     alignment and structure
Probab=100.00  E-value=0  Score=535.63  Aligned_cols=254  Identities=22%  Similarity=0.374  Sum_probs=238.2

Q ss_pred             CCCCEEEEECCCCHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCHHH
Q ss_conf             48870798779105899999999689998999941578989898989999999999999862169848997176202633
Q gi|254780905|r   12 LQNSILIFDSGIGGLIVLQKMRFLMPEYHFIYVADDVGFPYGNWEDHALKKRLMFLFSDILDKYQPVLSVIACNTAFTLI   91 (271)
Q Consensus        12 ~~~~IgifDSGiGGLtv~~~l~~~lP~~~~iY~~D~~~~PYG~ks~~~I~~~~~~~~~~ll~k~~~~~IVIACNTasa~~   91 (271)
                      |++||||||||+|||||+++|++++|+++|+||||++|+|||+||+++|++++.+++++|+++++|++|||||||||+.+
T Consensus         2 ~~~pIgvfDSGvGGltvl~~l~~~lP~~~~iY~~D~~~~PYG~ks~~~i~~~~~~~~~~l~~~~~~~~IVIACNTas~~a   81 (272)
T 1zuw_A            2 LEQPIGVIDSGVGGLTVAKEIMRQLPKENIIYVGDTKRCPYGPRPEEEVLQYTWELTNYLLENHHIKMLVIACNTATAIA   81 (272)
T ss_dssp             TTSCEEEEESSSTTHHHHHHHHHHSTTCCEEEEECGGGCCCSSSCHHHHHHHHHHHHHHHHHHSCCSEEEECCHHHHHHH
T ss_pred             CCCCEEEEECCCCHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCEEEECCCHHHHHH
T ss_conf             99978999889767999999998789998899966888998999999999999999999997179989997663488999


Q ss_pred             HHHHHHHCCCCCCCCCC-HHHHHHHHHCCCCCEEEEECHHHHCCHHHHHHHHHCCCCCEEEECCCCCHHHHHHHHHHCCC
Q ss_conf             89998625777654454-79999998407883299850677317016899851278857977056422578776642677
Q gi|254780905|r   92 KDELRSTFPSMAFLGAV-PAIKQAAAYTQSGLISILSTPATLRRTYTSNLIHSYVSQCHIHLVSSMILASRVEEYACGIK  170 (271)
Q Consensus        92 ~~~l~~~~~~ipiigii-~~~~~a~~~~~~~~VgiLAT~~Ti~s~~y~~~i~~~~~~~~v~~~~~~~lv~~iE~~~~~~~  170 (271)
                      ++.+|+.+ ++|++||+ |+++.|...+++++||||||++|++|++|++++++++++..|..++|+.||++||++..   
T Consensus        82 l~~l~~~~-~~piigvi~p~~~~a~~~s~~~~IgVlaT~~Tv~s~~y~~~i~~~~~~~~v~~~~~~~Lv~lIE~g~~---  157 (272)
T 1zuw_A           82 LDDIQRSV-GIPVVGVIQPGARAAIKVTDNQHIGVIGTENTIKSNAYEEALLALNPDLKVENLACPLLVPFVESGKF---  157 (272)
T ss_dssp             HHHHHHHC-SSCEEESHHHHHHHHHHHCSSSEEEEEECHHHHHTTHHHHHHHHHCTTCEEEEEECTTHHHHHTSCCC---
T ss_pred             HHHHHHHC-CCCEEECCHHHHHHHHHCCCCCEEEEEECHHHHHHHHHHHHHHHHCCCCEEEECCCCHHHHHHHCCCC---
T ss_conf             99999863-98666224387777765056757999820877744899999873278736995278329999982755---


Q ss_pred             CCHHHHHHHHHHHHHHHHCCCCCEEEECCCCHHHHHHHHHHHCCCCCEEEECHHHHHHHHHHHHHHCCCCC-CCCCCCEE
Q ss_conf             69799999999984654105887899805635889999998648997898285899999999986427334-57788779
Q gi|254780905|r  171 IKEDEIKKEIEGCFIEKEGKRTDVIVLACTHYPLIVHVFRQLSPWPVDWLDNSDSIARRARCLLPRINTHQ-TRVFDDHA  249 (271)
Q Consensus       171 ~~~~~~~~~l~~~l~~~~~~~~D~iILGCTHyPll~~~i~~~~~~~v~iIDpa~~va~~~~~~L~~~~~~~-~~~~~~~~  249 (271)
                       ..+.....++.++.++.++++|++|||||||||+++.|++++|+++++|||++++|++++++|.++++.+ +...++++
T Consensus       158 -~~~~~~~~l~~~l~~l~~~~~D~lVLGCTHyPll~~~i~~~l~~~v~iIDpa~~vA~~v~~~L~~~~l~~~~~~~~~~~  236 (272)
T 1zuw_A          158 -LDQTADEIVKTSLYPLKDTSIDSLILGCTHYPILKEAIQRYMGEHVNIISSGDETAREVSTILSYKGLLNQSPIAPDHQ  236 (272)
T ss_dssp             -CHHHHHHHHHHHHHHHHHSCCSEEEEESTTGGGGHHHHHHHHCTTSEEEEHHHHHHHHHHHHHHHHTCCCCCCSCCCEE
T ss_pred             -CCHHHHHHHHHHHCHHHCCCCCEEEECCCCCHHHHHHHHHHCCCCCEEECCHHHHHHHHHHHHHHCCCCCCCCCCCCEE
T ss_conf             -7488999999995655416788899879883678999999809998998878999999999997667655678998759


Q ss_pred             EEECCCHHHHHHHHHHHCCCC
Q ss_conf             996699799999999856888
Q gi|254780905|r  250 LFLSGKPDIAMRRLMQGFGLK  270 (271)
Q Consensus       250 f~~T~~~~~~~~~~~~~~G~~  270 (271)
                      ||+||+++.|.+.+.+|||.+
T Consensus       237 f~~T~~~~~f~~~~~~flg~~  257 (272)
T 1zuw_A          237 FLTTGARDQFAKIADDWFGHE  257 (272)
T ss_dssp             EEESSCHHHHHHHHHHHC---
T ss_pred             EEECCCHHHHHHHHHHHCCCC
T ss_conf             998999999999999974999



>2dwu_A Glutamate racemase; isomerase; HET: DGL; 1.60A {Bacillus anthracis} Back     alignment and structure
>2gzm_A Glutamate racemase; enzyme, isomerase; HET: DGL; 1.99A {Bacillus anthracis} Back     alignment and structure
>2jfq_A Glutamate racemase; cell WALL, isomerase, cell shape, peptidoglycan synthesis, peptidoglycan biosynthesis; HET: DGL; 2.15A {Staphylococcus aureus} Back     alignment and structure
>3ist_A Glutamate racemase; structural genomics, cell WALL biogenesis/degradation, isomerase, peptidoglycan synthesis; HET: MSE; 1.65A {Listeria monocytogenes} PDB: 3hfr_A* 3isv_A* Back     alignment and structure
>2vvt_A Glutamate racemase; isomerase, peptidoglycan synthesis, cell WALL biogenesis/degradation, cell shape, benzyl purine, MURI inhibitor; HET: I24 DGL; 1.65A {Enterococcus faecalis} PDB: 2jfp_A* 2jfo_A* 2jfu_A 2jfv_A* 2jfw_A* Back     alignment and structure
>2oho_A Glutamate racemase; isomerase; 2.25A {Streptococcus pyogenes m1 gas} PDB: 2ohg_A 2ohv_A* Back     alignment and structure
>2jfn_A Glutamate racemase; cell WALL, isomerase, cell shape, UDP- murnac-Ala, peptidoglycan biosynthesis, peptidoglycan synthesis; HET: GLU UMA; 1.9A {Escherichia coli} Back     alignment and structure
>3out_A Glutamate racemase; structural genomics, center for structural genomics of infec diseases, csgid, MURI, cell envelope; HET: MSE DGL; 1.65A {Francisella tularensis subsp} Back     alignment and structure
>2jfz_A Glutamate racemase; cell WALL, isomerase, cell shape, peptidoglycan synthesis, peptidoglycan biosynthesis; HET: 003 DGL; 1.86A {Helicobacter pylori} PDB: 2jfx_A* 2jfy_A* 2w4i_A* Back     alignment and structure
>1b73_A Glutamate racemase; isomerase; 2.30A {Aquifex pyrophilus} SCOP: c.78.2.1 c.78.2.1 PDB: 1b74_A* Back     alignment and structure
>2zsk_A PH1733, 226AA long hypothetical aspartate racemase; alpha/beta fold, unknown function; 2.55A {Pyrococcus horikoshii} Back     alignment and structure
>3ojc_A Putative aspartate/glutamate racemase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha beta; 1.75A {Yersinia pestis} Back     alignment and structure
>1jfl_A Aspartate racemase; alpha-beta structure, HOMO-dimer, homologous domains, isomerase; 1.90A {Pyrococcus horikoshii OT3} SCOP: c.78.2.1 c.78.2.1 PDB: 2dx7_A* 1iu9_A Back     alignment and structure
>2eq5_A 228AA long hypothetical hydantoin racemase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.20A {Pyrococcus horikoshii OT3} Back     alignment and structure
>3ixl_A Amdase, arylmalonate decarboxylase; enantioselective decarboxylation, lyase; HET: CME PAC; 1.45A {Bordetella bronchiseptica} PDB: 3ixm_A 2vlb_A 3dg9_A 3ip8_A* 3dtv_A* 3eis_A* Back     alignment and structure
>2xed_A Putative maleate isomerase; nicotinic acid catabolism, cofactor-independent CIS-trans isomerase; 1.95A {Nocardia farcinica} PDB: 2xec_A Back     alignment and structure
>2dgd_A 223AA long hypothetical arylmalonate decarboxylase; octamer, alpha/beta structure, lyase; 2.90A {Sulfolobus tokodaii} Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>2eq5_A 228AA long hypothetical hydantoin racemase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.20A {Pyrococcus horikoshii OT3} Back     alignment and structure
>2zsk_A PH1733, 226AA long hypothetical aspartate racemase; alpha/beta fold, unknown function; 2.55A {Pyrococcus horikoshii} Back     alignment and structure
>3ojc_A Putative aspartate/glutamate racemase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha beta; 1.75A {Yersinia pestis} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 271 glutamate racemase [Candidatus Liberibacter asiaticus s
d1b74a1105 c.78.2.1 (A:1-105) Glutamate racemase {Aquifex pyrophil 8e-23
d1b74a2147 c.78.2.1 (A:106-252) Glutamate racemase {Aquifex pyroph 4e-12
d1jfla2113 c.78.2.1 (A:116-228) Aspartate racemase {Archaeon Pyroc 3e-05
>d1b74a1 c.78.2.1 (A:1-105) Glutamate racemase {Aquifex pyrophilus [TaxId: 2714]} Length = 105 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: ATC-like
superfamily: Aspartate/glutamate racemase
family: Aspartate/glutamate racemase
domain: Glutamate racemase
species: Aquifex pyrophilus [TaxId: 2714]
 Score =  101 bits (253), Expect = 8e-23
 Identities = 29/104 (27%), Positives = 46/104 (44%), Gaps = 1/104 (0%)

Query: 16  ILIFDSGIGGLIVLQKMRFLMPEYHFIYVADDVGFPYGNWEDHALKKRLMFLFSDILDKY 75
           I IFDSG+GGL VL+ +R    +   +Y+ D    PYG      + +  +      L   
Sbjct: 3   IGIFDSGVGGLTVLKAIRNRYRKVDIVYLGDTARVPYGIRSKDTIIRYSLECA-GFLKDK 61

Query: 76  QPVLSVIACNTAFTLIKDELRSTFPSMAFLGAVPAIKQAAAYTQ 119
              + V+ACNTA     + L+       F    P +K+A   ++
Sbjct: 62  GVDIIVVACNTASAYALERLKKEINVPVFGVIEPGVKEALKKSR 105


>d1b74a2 c.78.2.1 (A:106-252) Glutamate racemase {Aquifex pyrophilus [TaxId: 2714]} Length = 147 Back     information, alignment and structure
>d1jfla2 c.78.2.1 (A:116-228) Aspartate racemase {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 113 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target271 glutamate racemase [Candidatus Liberibacter asiaticus s
d1b74a1105 Glutamate racemase {Aquifex pyrophilus [TaxId: 2714]} 100.0
d1jfla1115 Aspartate racemase {Archaeon Pyrococcus horikoshii [Tax 98.65
d1b74a2147 Glutamate racemase {Aquifex pyrophilus [TaxId: 2714]} 99.96
d1jfla2113 Aspartate racemase {Archaeon Pyrococcus horikoshii [Tax 99.76
d1jfla1115 Aspartate racemase {Archaeon Pyrococcus horikoshii [Tax 94.33
>d1b74a1 c.78.2.1 (A:1-105) Glutamate racemase {Aquifex pyrophilus [TaxId: 2714]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: ATC-like
superfamily: Aspartate/glutamate racemase
family: Aspartate/glutamate racemase
domain: Glutamate racemase
species: Aquifex pyrophilus [TaxId: 2714]
Probab=100.00  E-value=5.7e-37  Score=263.14  Aligned_cols=103  Identities=29%  Similarity=0.495  Sum_probs=97.5

Q ss_pred             CEEEEECCCCHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCHHHHHH
Q ss_conf             70798779105899999999689998999941578989898989999999999999862169848997176202633899
Q gi|254780905|r   15 SILIFDSGIGGLIVLQKMRFLMPEYHFIYVADDVGFPYGNWEDHALKKRLMFLFSDILDKYQPVLSVIACNTAFTLIKDE   94 (271)
Q Consensus        15 ~IgifDSGiGGLtv~~~l~~~lP~~~~iY~~D~~~~PYG~ks~~~I~~~~~~~~~~ll~k~~~~~IVIACNTasa~~~~~   94 (271)
                      .|||||||+|||||++++++++|+++|+|+||++|+|||+||+++|.+++.++++++.++ ++++||+||||||+.+++.
T Consensus         2 kIgifDSGiGGLtVl~~l~~~lP~~~~iY~~D~a~~PYG~ks~~~I~~~~~~~~~~l~~~-~~~~iViACNTaS~~al~~   80 (105)
T d1b74a1           2 KIGIFDSGVGGLTVLKAIRNRYRKVDIVYLGDTARVPYGIRSKDTIIRYSLECAGFLKDK-GVDIIVVACNTASAYALER   80 (105)
T ss_dssp             EEEEEESSSTHHHHHHHHHHHSSSCEEEEEECGGGCCGGGSCHHHHHHHHHHHHHHHHTT-TCSEEEECCHHHHHHHHHH
T ss_pred             EEEEEECCCCHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHC-CCCEEEEECCCHHHHHHHH
T ss_conf             799983897879999999997899987998568879889899999999999999999974-9998998057178999999


Q ss_pred             HHHHCCCCCCCCCC-HHHHHHHHHCC
Q ss_conf             98625777654454-79999998407
Q gi|254780905|r   95 LRSTFPSMAFLGAV-PAIKQAAAYTQ  119 (271)
Q Consensus        95 l~~~~~~ipiigii-~~~~~a~~~~~  119 (271)
                      ||++| ++|++|++ |++++|+..+|
T Consensus        81 lr~~~-~~PiiGvi~P~ik~A~~~tk  105 (105)
T d1b74a1          81 LKKEI-NVPVFGVIEPGVKEALKKSR  105 (105)
T ss_dssp             HHHHS-SSCEEESHHHHHHHHHHHCS
T ss_pred             HHHHC-CCCEEEEEHHHHHHHHHHCC
T ss_conf             99878-99999932289999998568



>d1jfla1 c.78.2.1 (A:1-115) Aspartate racemase {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1b74a2 c.78.2.1 (A:106-252) Glutamate racemase {Aquifex pyrophilus [TaxId: 2714]} Back     information, alignment and structure
>d1jfla2 c.78.2.1 (A:116-228) Aspartate racemase {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1jfla1 c.78.2.1 (A:1-115) Aspartate racemase {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 271 glutamate racemase [Candidatus Liberibacter asiati
2jfn_A_1-97_209-267156 (A:1-97,A:209-267) Glutamate racemase; cell WALL, 2e-23
3ist_A_1-97_210-269157 (A:1-97,A:210-269) Glutamate racemase; structural 2e-22
2gzm_A_1-96_208-267156 (A:1-96,A:208-267) Glutamate racemase; enzyme, iso 4e-22
2dwu_A_1-99_212-276164 (A:1-99,A:212-276) Glutamate racemase; isomerase; 5e-22
1b73_A_1-93_213-254135 (A:1-93,A:213-254) Glutamate racemase; isomerase; 1e-20
2jfz_A_1-93_210-255139 (A:1-93,A:210-255) Glutamate racemase; cell WALL, 1e-20
1zuw_A_1-96_209-272160 (A:1-96,A:209-272) Glutamate racemase 1; (R)-gluta 2e-20
2vvt_A_1-117_229-290179 (A:1-117,A:229-290) Glutamate racemase; isomerase, 5e-20
2jfq_A_1-115_228-286174 (A:1-115,A:228-286) Glutamate racemase; cell WALL, 2e-18
2oho_A_1-105_237-273142 (A:1-105,A:237-273) Glutamate racemase; isomerase; 1e-17
2oho_A_106-236131 (A:106-236) Glutamate racemase; isomerase; 2.25A { 1e-18
1zuw_A_97-208112 (A:97-208) Glutamate racemase 1; (R)-glutamate, pe 3e-18
2gzm_A_97-207111 (A:97-207) Glutamate racemase; enzyme, isomerase; 4e-18
2vvt_A_118-228111 (A:118-228) Glutamate racemase; isomerase, peptido 4e-18
3ist_A_98-209112 (A:98-209) Glutamate racemase; structural genomics 1e-17
2jfq_A_116-227112 (A:116-227) Glutamate racemase; cell WALL, isomera 6e-17
2jfn_A_98-208111 (A:98-208) Glutamate racemase; cell WALL, isomeras 8e-17
2dwu_A_100-211112 (A:100-211) Glutamate racemase; isomerase; HET: DG 1e-16
1jfl_A_103-212110 (A:103-212) Aspartate racemase; alpha-beta structu 3e-15
1b73_A_94-212119 (A:94-212) Glutamate racemase; isomerase; 2.30A {A 4e-15
2jfz_A_94-209116 (A:94-209) Glutamate racemase; cell WALL, isomeras 8e-15
2zsk_A_102-212111 (A:102-212) PH1733, 226AA long hypothetical aspart 3e-14
>3ist_A (A:1-97,A:210-269) Glutamate racemase; structural genomics, cell WALL biogenesis/degradation, isomerase, peptidoglycan synthesis; HET: MSE; 1.65A {Listeria monocytogenes} PDB: 3hfr_A* 3isv_A*Length = 157 Back     alignment and structure
>2gzm_A (A:1-96,A:208-267) Glutamate racemase; enzyme, isomerase; HET: DGL; 1.99A {Bacillus anthracis}Length = 156 Back     alignment and structure
>2dwu_A (A:1-99,A:212-276) Glutamate racemase; isomerase; HET: DGL; 1.60A {Bacillus anthracis}Length = 164 Back     alignment and structure
>1b73_A (A:1-93,A:213-254) Glutamate racemase; isomerase; 2.30A {Aquifex pyrophilus}Length = 135 Back     alignment and structure
>2jfz_A (A:1-93,A:210-255) Glutamate racemase; cell WALL, isomerase, cell shape, peptidoglycan synthesis, peptidoglycan biosynthesis; HET: 003 DGL; 1.86A {Helicobacter pylori} PDB: 2jfx_A* 2jfy_A* 2w4i_A*Length = 139 Back     alignment and structure
>1zuw_A (A:1-96,A:209-272) Glutamate racemase 1; (R)-glutamate, peptidoglycan biosynthesis, isomerase; HET: DGL; 1.75A {Bacillus subtilis}Length = 160 Back     alignment and structure
>2vvt_A (A:1-117,A:229-290) Glutamate racemase; isomerase, peptidoglycan synthesis, cell WALL biogenesis/degradation, cell shape, benzyl purine, MURI inhibitor; HET: I24 DGL; 1.65A {Enterococcus faecalis} PDB: 2jfp_A* 2jfo_A* 2jfu_A 2jfv_A* 2jfw_A*Length = 179 Back     alignment and structure
>2jfq_A (A:1-115,A:228-286) Glutamate racemase; cell WALL, isomerase, cell shape, peptidoglycan synthesis, peptidoglycan biosynthesis; HET: DGL; 2.15A {Staphylococcus aureus}Length = 174 Back     alignment and structure
>2oho_A (A:1-105,A:237-273) Glutamate racemase; isomerase; 2.25A {Streptococcus pyogenes m1 gas} PDB: 2ohg_A 2ohv_A*Length = 142 Back     alignment and structure
>2oho_A (A:106-236) Glutamate racemase; isomerase; 2.25A {Streptococcus pyogenes m1 gas} PDB: 2ohg_A 2ohv_A*Length = 131 Back     alignment and structure
>1zuw_A (A:97-208) Glutamate racemase 1; (R)-glutamate, peptidoglycan biosynthesis, isomerase; HET: DGL; 1.75A {Bacillus subtilis}Length = 112 Back     alignment and structure
>2gzm_A (A:97-207) Glutamate racemase; enzyme, isomerase; HET: DGL; 1.99A {Bacillus anthracis}Length = 111 Back     alignment and structure
>2vvt_A (A:118-228) Glutamate racemase; isomerase, peptidoglycan synthesis, cell WALL biogenesis/degradation, cell shape, benzyl purine, MURI inhibitor; HET: I24 DGL; 1.65A {Enterococcus faecalis} PDB: 2jfp_A* 2jfo_A* 2jfu_A 2jfv_A* 2jfw_A*Length = 111 Back     alignment and structure
>3ist_A (A:98-209) Glutamate racemase; structural genomics, cell WALL biogenesis/degradation, isomerase, peptidoglycan synthesis; HET: MSE; 1.65A {Listeria monocytogenes} PDB: 3hfr_A* 3isv_A*Length = 112 Back     alignment and structure
>2jfq_A (A:116-227) Glutamate racemase; cell WALL, isomerase, cell shape, peptidoglycan synthesis, peptidoglycan biosynthesis; HET: DGL; 2.15A {Staphylococcus aureus}Length = 112 Back     alignment and structure
>2dwu_A (A:100-211) Glutamate racemase; isomerase; HET: DGL; 1.60A {Bacillus anthracis}Length = 112 Back     alignment and structure
>1jfl_A (A:103-212) Aspartate racemase; alpha-beta structure, HOMO-dimer, homologous domains, isomerase; 1.90A {Pyrococcus horikoshii OT3}Length = 110 Back     alignment and structure
>1b73_A (A:94-212) Glutamate racemase; isomerase; 2.30A {Aquifex pyrophilus}Length = 119 Back     alignment and structure
>2jfz_A (A:94-209) Glutamate racemase; cell WALL, isomerase, cell shape, peptidoglycan synthesis, peptidoglycan biosynthesis; HET: 003 DGL; 1.86A {Helicobacter pylori} PDB: 2jfx_A* 2jfy_A* 2w4i_A*Length = 116 Back     alignment and structure
>2zsk_A (A:102-212) PH1733, 226AA long hypothetical aspartate racemase; alpha/beta fold, unknown function; 2.55A {Pyrococcus horikoshii}Length = 111 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target271 glutamate racemase [Candidatus Liberibacter asiaticus s
2gzm_A_1-96_208-267156 Glutamate racemase; enzyme, isomerase; HET: DGL; 1 100.0
2vvt_A_1-117_229-290179 Glutamate racemase; isomerase, peptidoglycan synth 100.0
3ist_A_1-97_210-269157 Glutamate racemase; structural genomics, cell WALL 100.0
1zuw_A_1-96_209-272160 Glutamate racemase 1; (R)-glutamate, peptidoglycan 100.0
2jfq_A_1-115_228-286174 Glutamate racemase; cell WALL, isomerase, cell sha 100.0
1b73_A_1-93_213-254135 Glutamate racemase; isomerase; 2.30A {Aquifex pyro 100.0
2jfz_A_1-93_210-255139 Glutamate racemase; cell WALL, isomerase, cell sha 100.0
2jfn_A_1-97_209-267156 Glutamate racemase; cell WALL, isomerase, cell sha 99.96
2zsk_A_1-101_213-226115 PH1733, 226AA long hypothetical aspartate racemase 98.47
1jfl_A_1-102_213-228118 Aspartate racemase; alpha-beta structure, HOMO-dim 98.3
3ixl_A_1-116_212-240145 Amdase, arylmalonate decarboxylase; enantioselecti 93.64
2dwu_A_1-99_212-276164 Glutamate racemase; isomerase; HET: DGL; 1.60A {Ba 100.0
2oho_A_1-105_237-273142 Glutamate racemase; isomerase; 2.25A {Streptococcu 99.97
2oho_A_106-236131 Glutamate racemase; isomerase; 2.25A {Streptococcu 99.93
2dwu_A_100-211112 Glutamate racemase; isomerase; HET: DGL; 1.60A {Ba 99.91
2jfq_A_116-227112 Glutamate racemase; cell WALL, isomerase, cell sha 99.9
3ist_A_98-209112 Glutamate racemase; structural genomics, cell WALL 99.9
2vvt_A_118-228111 Glutamate racemase; isomerase, peptidoglycan synth 99.9
1zuw_A_97-208112 Glutamate racemase 1; (R)-glutamate, peptidoglycan 99.9
2gzm_A_97-207111 Glutamate racemase; enzyme, isomerase; HET: DGL; 1 99.89
1b73_A_94-212119 Glutamate racemase; isomerase; 2.30A {Aquifex pyro 99.87
2jfz_A_94-209116 Glutamate racemase; cell WALL, isomerase, cell sha 99.84
2zsk_A_102-212111 PH1733, 226AA long hypothetical aspartate racemase 99.78
2jfn_A_98-208111 Glutamate racemase; cell WALL, isomerase, cell sha 99.77
1jfl_A_103-212110 Aspartate racemase; alpha-beta structure, HOMO-dim 99.77
2eq5_A_104-204101 228AA long hypothetical hydantoin racemase; struct 96.64
1jfl_A_1-102_213-228118 Aspartate racemase; alpha-beta structure, HOMO-dim 94.68
2oho_A_1-105_237-273142 Glutamate racemase; isomerase; 2.25A {Streptococcu 98.06
2jfz_A_1-93_210-255139 Glutamate racemase; cell WALL, isomerase, cell sha 96.99
1b73_A_1-93_213-254135 Glutamate racemase; isomerase; 2.30A {Aquifex pyro 92.86
1q1r_A_1-110_252-322181 Putidaredoxin reductase; glutathione reductase fol 93.59
3kd9_A_1-110_246-318183 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 91.69
2bc0_A_1-145_307-364203 NADH oxidase; flavoprotein, pyridine nucleotide di 90.49
>2gzm_A (A:1-96,A:208-267) Glutamate racemase; enzyme, isomerase; HET: DGL; 1.99A {Bacillus anthracis} Back     alignment and structure
Probab=100.00  E-value=1.2e-39  Score=283.60  Aligned_cols=96  Identities=29%  Similarity=0.547  Sum_probs=92.1

Q ss_pred             CCCCCEEEEECCCCHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCHH
Q ss_conf             34887079877910589999999968999899994157898989898999999999999986216984899717620263
Q gi|254780905|r   11 KLQNSILIFDSGIGGLIVLQKMRFLMPEYHFIYVADDVGFPYGNWEDHALKKRLMFLFSDILDKYQPVLSVIACNTAFTL   90 (271)
Q Consensus        11 ~~~~~IgifDSGiGGLtv~~~l~~~lP~~~~iY~~D~~~~PYG~ks~~~I~~~~~~~~~~ll~k~~~~~IVIACNTasa~   90 (271)
                      +|++||||||||+|||||++++++++|+++++|+||++|+|||+||.++|++++.++++||+++ ++++|||||||||++
T Consensus         1 ~~~~pIgvfDSGvGGLtV~~~i~~~lP~~~~iY~gD~a~~PYG~ks~~~i~~~~~~~~~~l~~~-~~k~iViACNTasa~   79 (156)
T 2gzm_A            1 KLNRAIGVIDSGVGGLTVAKELIRQLPKERIIYLGDTARCPYGPRSREEVRQFTWEMTEHLLDL-NIKMLVIACNTATAV   79 (156)
T ss_dssp             CTTSCEEEEESSSTTHHHHHHHHHHCTTSCEEEEECTTTCCCTTSCHHHHHHHHHHHHHHHHTT-TCSEEEECCHHHHHH
T ss_pred             CCCCCEEEEECCCCHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHH-CCCEEEECCCHHHHH
T ss_conf             9999789998896679999999997899998999537899989999999999999999999861-678799726278899


Q ss_pred             HHHHHHHHCCCCCCCCCC
Q ss_conf             389998625777654454
Q gi|254780905|r   91 IKDELRSTFPSMAFLGAV  108 (271)
Q Consensus        91 ~~~~l~~~~~~ipiigii  108 (271)
                      +++.||+++ ++|++|++
T Consensus        80 al~~lr~~~-~iPvigvi   96 (156)
T 2gzm_A           80 VLEEMQKQL-PIPVVGVI   96 (156)
T ss_dssp             HHHHHHHHC-SSCEEESH
T ss_pred             HHHHHHHHC-CCCEEEEE
T ss_conf             999999748-98879876



>2vvt_A (A:1-117,A:229-290) Glutamate racemase; isomerase, peptidoglycan synthesis, cell WALL biogenesis/degradation, cell shape, benzyl purine, MURI inhibitor; HET: I24 DGL; 1.65A {Enterococcus faecalis} PDB: 2jfp_A* 2jfo_A* 2jfu_A 2jfv_A* 2jfw_A* Back     alignment and structure
>3ist_A (A:1-97,A:210-269) Glutamate racemase; structural genomics, cell WALL biogenesis/degradation, isomerase, peptidoglycan synthesis; HET: MSE; 1.65A {Listeria monocytogenes} PDB: 3hfr_A* 3isv_A* Back     alignment and structure
>1zuw_A (A:1-96,A:209-272) Glutamate racemase 1; (R)-glutamate, peptidoglycan biosynthesis, isomerase; HET: DGL; 1.75A {Bacillus subtilis} Back     alignment and structure
>2jfq_A (A:1-115,A:228-286) Glutamate racemase; cell WALL, isomerase, cell shape, peptidoglycan synthesis, peptidoglycan biosynthesis; HET: DGL; 2.15A {Staphylococcus aureus} Back     alignment and structure
>1b73_A (A:1-93,A:213-254) Glutamate racemase; isomerase; 2.30A {Aquifex pyrophilus} Back     alignment and structure
>2jfz_A (A:1-93,A:210-255) Glutamate racemase; cell WALL, isomerase, cell shape, peptidoglycan synthesis, peptidoglycan biosynthesis; HET: 003 DGL; 1.86A {Helicobacter pylori} PDB: 2jfx_A* 2jfy_A* 2w4i_A* Back     alignment and structure
>2zsk_A (A:1-101,A:213-226) PH1733, 226AA long hypothetical aspartate racemase; alpha/beta fold, unknown function; 2.55A {Pyrococcus horikoshii} Back     alignment and structure
>1jfl_A (A:1-102,A:213-228) Aspartate racemase; alpha-beta structure, HOMO-dimer, homologous domains, isomerase; 1.90A {Pyrococcus horikoshii OT3} Back     alignment and structure
>3ixl_A (A:1-116,A:212-240) Amdase, arylmalonate decarboxylase; enantioselective decarboxylation, lyase; HET: CME PAC; 1.45A {Bordetella bronchiseptica} PDB: 3ixm_A 2vlb_A 3dg9_A 3ip8_A* 3dtv_A* 3eis_A* Back     alignment and structure
>2dwu_A (A:1-99,A:212-276) Glutamate racemase; isomerase; HET: DGL; 1.60A {Bacillus anthracis} Back     alignment and structure
>2oho_A (A:1-105,A:237-273) Glutamate racemase; isomerase; 2.25A {Streptococcus pyogenes m1 gas} PDB: 2ohg_A 2ohv_A* Back     alignment and structure
>2oho_A (A:106-236) Glutamate racemase; isomerase; 2.25A {Streptococcus pyogenes m1 gas} PDB: 2ohg_A 2ohv_A* Back     alignment and structure
>2dwu_A (A:100-211) Glutamate racemase; isomerase; HET: DGL; 1.60A {Bacillus anthracis} Back     alignment and structure
>2jfq_A (A:116-227) Glutamate racemase; cell WALL, isomerase, cell shape, peptidoglycan synthesis, peptidoglycan biosynthesis; HET: DGL; 2.15A {Staphylococcus aureus} Back     alignment and structure
>3ist_A (A:98-209) Glutamate racemase; structural genomics, cell WALL biogenesis/degradation, isomerase, peptidoglycan synthesis; HET: MSE; 1.65A {Listeria monocytogenes} PDB: 3hfr_A* 3isv_A* Back     alignment and structure
>2vvt_A (A:118-228) Glutamate racemase; isomerase, peptidoglycan synthesis, cell WALL biogenesis/degradation, cell shape, benzyl purine, MURI inhibitor; HET: I24 DGL; 1.65A {Enterococcus faecalis} PDB: 2jfp_A* 2jfo_A* 2jfu_A 2jfv_A* 2jfw_A* Back     alignment and structure
>1zuw_A (A:97-208) Glutamate racemase 1; (R)-glutamate, peptidoglycan biosynthesis, isomerase; HET: DGL; 1.75A {Bacillus subtilis} Back     alignment and structure
>2gzm_A (A:97-207) Glutamate racemase; enzyme, isomerase; HET: DGL; 1.99A {Bacillus anthracis} Back     alignment and structure
>1b73_A (A:94-212) Glutamate racemase; isomerase; 2.30A {Aquifex pyrophilus} Back     alignment and structure
>2jfz_A (A:94-209) Glutamate racemase; cell WALL, isomerase, cell shape, peptidoglycan synthesis, peptidoglycan biosynthesis; HET: 003 DGL; 1.86A {Helicobacter pylori} PDB: 2jfx_A* 2jfy_A* 2w4i_A* Back     alignment and structure
>2zsk_A (A:102-212) PH1733, 226AA long hypothetical aspartate racemase; alpha/beta fold, unknown function; 2.55A {Pyrococcus horikoshii} Back     alignment and structure
>1jfl_A (A:103-212) Aspartate racemase; alpha-beta structure, HOMO-dimer, homologous domains, isomerase; 1.90A {Pyrococcus horikoshii OT3} Back     alignment and structure
>2eq5_A (A:104-204) 228AA long hypothetical hydantoin racemase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.20A {Pyrococcus horikoshii OT3} Back     alignment and structure
>1jfl_A (A:1-102,A:213-228) Aspartate racemase; alpha-beta structure, HOMO-dimer, homologous domains, isomerase; 1.90A {Pyrococcus horikoshii OT3} Back     alignment and structure
>2oho_A (A:1-105,A:237-273) Glutamate racemase; isomerase; 2.25A {Streptococcus pyogenes m1 gas} PDB: 2ohg_A 2ohv_A* Back     alignment and structure
>2jfz_A (A:1-93,A:210-255) Glutamate racemase; cell WALL, isomerase, cell shape, peptidoglycan synthesis, peptidoglycan biosynthesis; HET: 003 DGL; 1.86A {Helicobacter pylori} PDB: 2jfx_A* 2jfy_A* 2w4i_A* Back     alignment and structure
>1b73_A (A:1-93,A:213-254) Glutamate racemase; isomerase; 2.30A {Aquifex pyrophilus} Back     alignment and structure
>1q1r_A (A:1-110,A:252-322) Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} Back     alignment and structure
>3kd9_A (A:1-110,A:246-318) Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics, protein structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>2bc0_A (A:1-145,A:307-364) NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Back     alignment and structure