254780909

254780909

hypothetical protein CLIBASIA_04040

GeneID in NCBI database:8209929Locus tag:CLIBASIA_04040
Protein GI in NCBI database:254780909Protein Accession:YP_003065322.1
Gene range:-(886879, 887358)Protein Length:159aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMyes
SignalP_NNyes
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------16
MKRLKYQIILLSLLSTTMASCGQADPVAPPPPQTLAERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPVAANIEPESQETQQQVINKTTTSQTDAEKTPNEKRQGTTDGINNQSNATNDPSSKDKIAENTKED
ccccHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHcccccccHHHHHHHHHccccHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccHHHHHHHccc
ccHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccEEEEcccccHHHHHHHHcccccccccccccccccccccccccccccccccccccHHHHHHccccc
MKRLKYQIILLSLLSTTMascgqadpvappppqtLAERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHkdkkkpkenqevnevpvaaniepesqeTQQQVINKTttsqtdaektpnekrqgttdginnqsnatndpsskdkiaentked
MKRLKYQIILLSLLSTTMASCGQADPVAPPPPQTLAERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIihkdkkkpkenqevnevpvaaniepesqetqQQVINKtttsqtdaektpnekrqgttdginnqsnatndpsskdkiaentked
MKRLKYQIILLSLLSTTMASCGQADPVAPPPPQTLAERGKALLDeatqkaaekaaeaarkaaeqaaeaakkaaekiihkdkkkpkeNQEVNEVPVAANIEPESQETQQQVINKTTTSQTDAEKTPNEKRQGTTDGINNQSNATNDPSSKDKIAENTKED
****KYQIILLSLLSTTMASCGQ*****PP***TLAERGKAL*********************************************************************************************************************
MKRLKYQIILLSLLSTTMASCGQADPVAPPPPQTLAERGKALLDE*****************************KIIHKDKKKPKENQEVNEVPVAANIEP******************************TTDGINNQ********************
*KRLKYQIILLSLLSTTMASCGQADPVAPPPPQTLAERGKALLDEATQKAAEKAAEAA*************A*EKIIHKDKKKPKENQEVNEVPVAANIEPESQE******************************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
MKRLKYQIILLSLLSTTMASCGQADPVAPPPPQTLAERGKALxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxDKKKPKENQEVNEVPVAANIEPESQETQQQVINKTTTSQTDAEKTPNEKRQGTTDGINNQSNATNDPSSKDKIAENTKED
MKRLKYQIILLSLLSTTMASCGQADPVAPPPPQTLAERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPVAANIEPESQETQQQVINKTTTSQTDAEKTPNEKRQGTTDGINNQSNATNDPSSKDKIAENTKED
MKRLKYQIILLSLLSTTMASCGQADPVAPPPPQTLAERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPVAANIEPESQETQQQVINKTTTSQTDAEKTPNEKRQGTTDGINNQSNATNDPSSKDKIAENTKED

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target159 hypothetical protein CLIBASIA_04040 [Candidatus Liberib
2896185831145 unnamed protein product [Sordaria macrospora] Length = 2 2e-04
170784800 2136 hypothetical chloroplast RF19 [Trachelium caeruleum] Le 2 6e-04
242242559 797 FtsK/SpoIIIE family DNA translocase [Staphylococcus epi 2 9e-04
159126350 2473 THO complex component (Rlr1), putative [Aspergillus fum 2 0.001
262282126 1576 glucosyltransferase G [Streptococcus sp. 2_1_36FAA] Len 2 0.001
146324095 2473 THO complex component (Rlr1) [Aspergillus fumigatus Af2 2 0.001
322804787772 N-acetylmuramoyl-L-alanine amidase [Clostridium botulin 2 0.002
159470999 988 predicted protein [Chlamydomonas reinhardtii] Length = 2 0.003
206975864 3386 collagen adhesion protein [Bacillus cereus H3081.97] Le 2 0.004
71756179887 hypothetical protein [Trypanosoma brucei TREU927] Lengt 2 0.004
>gi|289618583|emb|CBI54827.1| unnamed protein product [Sordaria macrospora] Length = 1145 Back     alignment and organism information
 Score = 49.1 bits (115), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 28/99 (28%), Positives = 51/99 (51%), Gaps = 6/99 (6%)

Query: 37   ERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPVA 96
            E+ ++++D   +K AE+A +   KAAE+A +  +KAAEK     +K  +  ++V E    
Sbjct: 1049 EKVESVVDNVKEKVAERAEQVQEKAAEKAEQVQEKAAEKAEQVQEKVAERAEQVQE---- 1104

Query: 97   ANIEPESQETQQQVINKTTTSQTDAEKTPNEKRQGTTDG 135
               +   ++ Q+ V+ K    +  AE+   EK Q  T+ 
Sbjct: 1105 -KAQEAGEKAQEVVLEKADQVEKKAEQV-GEKDQEKTEA 1141


Species: Sordaria macrospora
Genus: Sordaria
Family: Sordariaceae
Order: Sordariales
Class: Sordariomycetes
Phylum: Ascomycota
Superkingdom: Eukaryota
>gi|170784800|ref|YP_001718716.1| hypothetical chloroplast RF19 [Trachelium caeruleum] Length = 2136 Back     alignment and organism information
>gi|242242559|ref|ZP_04797004.1| FtsK/SpoIIIE family DNA translocase [Staphylococcus epidermidis W23144] Length = 797 Back     alignment and organism information
>gi|159126350|gb|EDP51466.1| THO complex component (Rlr1), putative [Aspergillus fumigatus A1163] Length = 2473 Back     alignment and organism information
>gi|262282126|ref|ZP_06059895.1| glucosyltransferase G [Streptococcus sp. 2_1_36FAA] Length = 1576 Back     alignment and organism information
>gi|146324095|ref|XP_001481502.1| THO complex component (Rlr1) [Aspergillus fumigatus Af293] Length = 2473 Back     alignment and organism information
>gi|322804787|emb|CBZ02340.1| N-acetylmuramoyl-L-alanine amidase [Clostridium botulinum H04402 065] Length = 772 Back     alignment and organism information
>gi|159470999|ref|XP_001693644.1| predicted protein [Chlamydomonas reinhardtii] Length = 988 Back     alignment and organism information
>gi|206975864|ref|ZP_03236775.1| collagen adhesion protein [Bacillus cereus H3081.97] Length = 3386 Back     alignment and organism information
>gi|71756179|ref|XP_829004.1| hypothetical protein [Trypanosoma brucei TREU927] Length = 887 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00