254780911

254780911

formyltetrahydrofolate deformylase

GeneID in NCBI database:8209931Locus tag:CLIBASIA_04050
Protein GI in NCBI database:254780911Protein Accession:YP_003065324.1
Gene range:-(888733, 889599)Protein Length:288aa
Gene description:formyltetrahydrofolate deformylase
COG prediction:[F] Formyltetrahydrofolate hydrolase
KEGG prediction:formyltetrahydrofolate deformylase; K01433 formyltetrahydrofolate deformylase [EC:3.5.1.10]
SEED prediction:Formyltetrahydrofolate deformylase (EC 3.5.1.10)
Pathway involved in KEGG:Glyoxylate and dicarboxylate metabolism [PATH:las00630]
One carbon pool by folate [PATH:las00670]
Subsystem involved in SEED:One-carbon metabolism by tetrahydropterines
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------29
MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNYFQ
ccEEEEEEEccccccHHHHHHHHHHHccccEEEHHHcccccccEEEEEEEEEccccHHHHHHHHHHHHHHcccEEEEcccccccEEEEEEccccHHHHHHHHHHHccccccEEEEEEEccHHHHHHHHHHcccEEEEEcccccHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHccccEEEEccHHcccccccHHHHHHHHccccEEEEEEEEEccccccccEEEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHccccEEcccEEEEEccccccccc
cccEEEEEEccccccHHHHHHHHHHHccccEEEccccccccccEEEEEEEEcccccHHHHHHHHHHHHHHccccEEEcccccccEEEEEEEcccccHHHHHHHHHcccccccEEEEEcccHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHHccccEEEEccccccccHHHHHHccccEEEEEcccccccccccHHHHHHHHcccEEEEEEEEcccccccccEEEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHccEEEEcccEEEEccccccccc
mssyiltitcpsneeitsiipdylstqgcnildisqfndldtsklfMRISFVFNTCMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSqpdhclndllyrwNIGTLALNIVGVVSNHTTHKKLvenyqlpfyylpmteqnkIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTGRIInihhsflpsfkganpykqAYEYGVKIIGATAHYAIceldagpiieqdVVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFInkrktivfpaypnnyfq
MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQqrvfinkrktivfpaypnnyfq
MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNYFQ
*SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYP*****
MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNYFQ
*SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYP*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNYFQ
MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNYFQ
MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNYFQ

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

Original result of BLAST against C. L. asiaticus genome

IdentityAlignment graphLength Definition E-value
Target288 formyltetrahydrofolate deformylase [Candidatus Liberiba
254780570205 phosphoribosylglycinamide formyltransferase [Candi 8e-15
255764462 310 methionyl-tRNA formyltransferase [Candidatus Liber 0.011
>gi|254780570|ref|YP_003064983.1| phosphoribosylglycinamide formyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 205 Back     alignment 
 Score = 72.4 bits (176), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 42/132 (31%), Positives = 72/132 (54%), Gaps = 3/132 (2%)

Query: 113 IVGVVSNHTTHKKLVE--NYQLPFYYLPMTEQ-NKIESEQKLINIIEKNNVELMILARYM 169
           IVGV S+++  + LV+    ++P + +P  +  ++ E E+ ++  +     +L+ LA YM
Sbjct: 33  IVGVFSDNSNAQGLVKARKEKVPTFPIPYKDYISRREHEKAILMQLSSIQPDLICLAGYM 92

Query: 170 QILSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPII 229
           ++LS         +I+NIH S LP F G + +++  + G+KI G T H     +D GPII
Sbjct: 93  RLLSRDFVESYKNKILNIHPSLLPLFPGLHTHRRVLQSGIKITGCTVHMVTANMDEGPII 152

Query: 230 EQDVVRVTHAQT 241
            Q  V V+   T
Sbjct: 153 AQAAVPVSSQDT 164
>gi|255764462|ref|YP_003064709.2| methionyl-tRNA formyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 310 Back     alignment 
 Score = 32.0 bits (71), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 49/113 (43%), Gaps = 18/113 (15%)

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
             HKK  + + LP   L  T+  + E EQ L       N ++ ++  Y  ++   + +  
Sbjct: 50  AVHKK-AQEFSLP--ALVPTKLGQEEYEQFL-----SFNADVAVVVAYGLVIPQRILNAT 101

Query: 181 TGRIINIHHSFLPSFKGANPYKQAY-----EYGVKIIGATAHYAICELDAGPI 228
                N H S LP ++GA P ++A      E G+ I+    H     LD GP+
Sbjct: 102 KLGFYNGHASLLPRWRGAAPIQRAIMAGDNETGIAIMKMDKH-----LDTGPV 149

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

Original result of PSI-BLAST first 2 iterations

IdentityAlignment graphLength Definition Round E-value
Target288 formyltetrahydrofolate deformylase [Candidatus Liberiba
315122658289 formyltetrahydrofolate deformylase [Candidatus Liberiba 1 1e-114
222084490294 formyltetrahydrofolate deformylase [Agrobacterium radio 1 8e-99
222082165294 formyltetrahydrofolate deformylase [Agrobacterium radio 1 2e-98
222081891294 formyltetrahydrofolate deformylase [Agrobacterium radio 1 3e-98
325293815294 formyltetrahydrofolate deformylase [Agrobacterium sp. H 1 4e-98
153008789294 formyltetrahydrofolate deformylase [Ochrobactrum anthro 1 7e-98
294677927294 formyltetrahydrofolate deformylase [Rhodobacter capsula 1 1e-97
239832558294 formyltetrahydrofolate deformylase [Ochrobactrum interm 1 3e-97
209551777294 formyltetrahydrofolate deformylase [Rhizobium leguminos 1 3e-97
209546027294 formyltetrahydrofolate deformylase [Rhizobium leguminos 1 7e-97
>gi|315122658|ref|YP_004063147.1| formyltetrahydrofolate deformylase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 289 Back     alignment and organism information
 Score =  416 bits (1068), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 197/288 (68%), Positives = 242/288 (84%), Gaps = 3/288 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVF--NTCMK 58
           MS +ILT+T PS++EI S++  YLS + C+ILD++QFND +T K FMR SF    +TCMK
Sbjct: 1   MSIHILTVTSPSHKEIISVLSGYLSGK-CDILDLAQFNDSNTRKFFMRASFTLKKHTCMK 59

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
            F+ DFQPI+QQFSL+ SIRN KE  KTLILVS+ DHCL+DLLY+WN  TLA++I G+VS
Sbjct: 60  NFLIDFQPIIQQFSLKISIRNAKERMKTLILVSRFDHCLHDLLYQWNARTLAMDIAGIVS 119

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  H+KL  +YQ+PFYY+P+T+QNKI+ E++LINIIEKNNV+L+ILARYMQILS+ +C 
Sbjct: 120 NHPIHQKLATDYQIPFYYIPITKQNKIKCEEELINIIEKNNVKLLILARYMQILSEKICQ 179

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           KM+GRIINIHHSFLPSFKG NPYKQAYEYGVKIIGATAHY    LD GPIIEQDVV +TH
Sbjct: 180 KMSGRIINIHHSFLPSFKGGNPYKQAYEYGVKIIGATAHYVTPALDEGPIIEQDVVHITH 239

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ +++YI+IG+NIE KVL+ AVNAHIQ RVFIN+RKT+VFP   N+Y
Sbjct: 240 AQNVKNYISIGRNIETKVLSNAVNAHIQHRVFINERKTVVFPTQSNDY 287



Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222084490|ref|YP_002543019.1| formyltetrahydrofolate deformylase [Agrobacterium radiobacter K84] Length = 294 Back     alignment and organism information
>gi|222082165|ref|YP_002541530.1| formyltetrahydrofolate deformylase [Agrobacterium radiobacter K84] Length = 294 Back     alignment and organism information
>gi|222081891|ref|YP_002541256.1| formyltetrahydrofolate deformylase [Agrobacterium radiobacter K84] Length = 294 Back     alignment and organism information
>gi|325293815|ref|YP_004279679.1| formyltetrahydrofolate deformylase [Agrobacterium sp. H13-3] Length = 294 Back     alignment and organism information
>gi|153008789|ref|YP_001370004.1| formyltetrahydrofolate deformylase [Ochrobactrum anthropi ATCC 49188] Length = 294 Back     alignment and organism information
>gi|294677927|ref|YP_003578542.1| formyltetrahydrofolate deformylase [Rhodobacter capsulatus SB 1003] Length = 294 Back     alignment and organism information
>gi|239832558|ref|ZP_04680887.1| formyltetrahydrofolate deformylase [Ochrobactrum intermedium LMG 3301] Length = 294 Back     alignment and organism information
>gi|209551777|ref|YP_002283694.1| formyltetrahydrofolate deformylase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 294 Back     alignment and organism information
>gi|209546027|ref|YP_002277917.1| formyltetrahydrofolate deformylase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 294 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

Original result of RPS-BLASTagainst CDD database part II

IdentityAlignment graphLength Definition E-value
Target288 formyltetrahydrofolate deformylase [Candidatus Liberiba
PRK06027286 PRK06027, purU, formyltetrahydrofolate deformylase; Rev 1e-112
PRK13011286 PRK13011, PRK13011, formyltetrahydrofolate deformylase; 1e-111
PRK13010289 PRK13010, purU, formyltetrahydrofolate deformylase; Rev 2e-99
TIGR00655280 TIGR00655, PurU, formyltetrahydrofolate deformylase 8e-76
PLN02828268 PLN02828, PLN02828, formyltetrahydrofolate deformylase 3e-56
COG0788287 COG0788, PurU, Formyltetrahydrofolate hydrolase [Nucleo 1e-103
COG0299200 COG0299, PurN, Folate-dependent phosphoribosylglycinami 1e-30
pfam00551181 pfam00551, Formyl_trans_N, Formyl transferase 1e-28
KOG3076206 KOG3076, KOG3076, KOG3076, 5'-phosphoribosylglycinamide 2e-28
PRK05647200 PRK05647, purN, phosphoribosylglycinamide formyltransfe 5e-28
COG0223307 COG0223, Fmt, Methionyl-tRNA formyltransferase [Transla 1e-10
TIGR00639190 TIGR00639, PurN, phosphoribosylglycinamide formyltransf 8e-23
PLN02331207 PLN02331, PLN02331, phosphoribosylglycinamide formyltra 7e-12
TIGR00460 313 TIGR00460, fmt, methionyl-tRNA formyltransferase 6e-09
KOG3082 338 KOG3082, KOG3082, KOG3082, Methionyl-tRNA formyltransfe 4e-05
PRK00005 309 PRK00005, fmt, methionyl-tRNA formyltransferase; Review 2e-04
PRK08125 660 PRK08125, PRK08125, bifunctional UDP-glucuronic acid de 0.001
PRK07579245 PRK07579, PRK07579, hypothetical protein; Provisional 0.003
cd0487574 cd04875, ACT_F4HF-DF, N-terminal ACT domain of formylte 6e-12
PLN02285 334 PLN02285, PLN02285, methionyl-tRNA formyltransferase 2e-09
PRK06988 312 PRK06988, PRK06988, putative formyltransferase; Provisi 7e-05
>gnl|CDD|180354 PRK06027, purU, formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>gnl|CDD|183839 PRK13011, PRK13011, formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>gnl|CDD|139334 PRK13010, purU, formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>gnl|CDD|161980 TIGR00655, PurU, formyltetrahydrofolate deformylase Back     alignment and domain information
>gnl|CDD|178422 PLN02828, PLN02828, formyltetrahydrofolate deformylase Back     alignment and domain information
>gnl|CDD|31131 COG0788, PurU, Formyltetrahydrofolate hydrolase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|30647 COG0299, PurN, Folate-dependent phosphoribosylglycinamide formyltransferase PurN [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|144222 pfam00551, Formyl_trans_N, Formyl transferase Back     alignment and domain information
>gnl|CDD|38286 KOG3076, KOG3076, KOG3076, 5'-phosphoribosylglycinamide formyltransferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|180182 PRK05647, purN, phosphoribosylglycinamide formyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|30572 COG0223, Fmt, Methionyl-tRNA formyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|161973 TIGR00639, PurN, phosphoribosylglycinamide formyltransferase, formyltetrahydrofolate-dependent Back     alignment and domain information
>gnl|CDD|177965 PLN02331, PLN02331, phosphoribosylglycinamide formyltransferase Back     alignment and domain information
>gnl|CDD|161888 TIGR00460, fmt, methionyl-tRNA formyltransferase Back     alignment and domain information
>gnl|CDD|38292 KOG3082, KOG3082, KOG3082, Methionyl-tRNA formyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|178787 PRK00005, fmt, methionyl-tRNA formyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|181239 PRK08125, PRK08125, bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated Back     alignment and domain information
>gnl|CDD|181046 PRK07579, PRK07579, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|153147 cd04875, ACT_F4HF-DF, N-terminal ACT domain of formyltetrahydrofolate deformylase (F4HF-DF; formyltetrahydrofolate hydrolase) Back     alignment and domain information
>gnl|CDD|177923 PLN02285, PLN02285, methionyl-tRNA formyltransferase Back     alignment and domain information
>gnl|CDD|180785 PRK06988, PRK06988, putative formyltransferase; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

Original result of HHsearch against CDD database

IdentityAlignment graphLength Definition Probability
Target 288 formyltetrahydrofolate deformylase [Candidatus Liberiba
TIGR00655294 PurU formyltetrahydrofolate deformylase; InterPro: IPR0 100.0
PRK06027285 purU formyltetrahydrofolate deformylase; Reviewed 100.0
PRK13011287 formyltetrahydrofolate deformylase; Reviewed 100.0
PRK13010289 purU formyltetrahydrofolate deformylase; Reviewed 100.0
COG0788287 PurU Formyltetrahydrofolate hydrolase [Nucleotide trans 100.0
PRK10538248 3-hydroxy acid dehydrogenase; Provisional 90.69
TIGR00639215 PurN phosphoribosylglycinamide formyltransferase; Inter 100.0
PRK05647200 purN phosphoribosylglycinamide formyltransferase; Revie 100.0
COG0299200 PurN Folate-dependent phosphoribosylglycinamide formylt 100.0
KOG3076206 consensus 100.0
pfam00551181 Formyl_trans_N Formyl transferase. This family includes 100.0
PRK00005 309 fmt methionyl-tRNA formyltransferase; Reviewed 99.96
PRK06988 313 putative formyltransferase; Provisional 99.95
PRK08125 660 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-am 99.95
COG0223307 Fmt Methionyl-tRNA formyltransferase [Translation, ribo 99.95
KOG2452 881 consensus 99.34
TIGR00460 385 fmt methionyl-tRNA formyltransferase; InterPro: IPR0057 99.89
PRK07579245 hypothetical protein; Provisional 99.84
KOG3082 338 consensus 99.7
cd0487574 ACT_F4HF-DF N-terminal ACT domain of formyltetrahydrofo 99.84
PRK0019490 hypothetical protein; Validated 99.43
cd0487288 ACT_1ZPV ACT domain proteins similar to the yet unchara 99.33
COG383090 ACT domain-containing protein [Signal transduction mech 98.94
cd0487075 ACT_PSP_1 CT domains found N-terminal of phosphoserine 98.87
cd0486981 ACT_GcvR_2 ACT domains that comprise the Glycine Cleava 98.86
PRK11589183 gcvR glycine cleavage system transcriptional repressor; 98.56
cd0489377 ACT_GcvR_1 ACT domains that comprise the Glycine Cleava 98.53
pfam0184266 ACT ACT domain. This family of domains generally have a 98.0
cd0487472 ACT_Af1403 N-terminal ACT domain of the yet uncharacter 97.93
COG2716176 GcvR Glycine cleavage system regulatory protein [Amino 97.58
LOAD_ACT76 consensus 97.3
cd0211660 ACT ACT domains are commonly involved in specifically b 97.07
cd0490969 ACT_PDH-BS C-terminal ACT domain of the monofunctional, 96.85
cd0487671 ACT_RelA-SpoT ACT domain found C-terminal of the RelA/S 96.82
cd0488673 ACT_ThrD-II-like C-terminal ACT domain of biodegradativ 96.72
cd0489970 ACT_ACR-UUR-like_2 C-terminal ACT domains of the bacter 96.55
cd0488372 ACT_AcuB C-terminal ACT domain of the Bacillus subtilis 96.37
cd0492574 ACT_ACR_2 ACT domain-containing protein which is compos 96.21
PRK0817896 acetolactate synthase 1 regulatory subunit; Reviewed 96.13
cd0492672 ACT_ACR_4 C-terminal ACT domain, of a novel type of ACT 96.0
cd0490371 ACT_LSD C-terminal ACT domain of the L-serine dehydrata 95.72
cd0487184 ACT_PSP_2 ACT domains found N-terminal of phosphoserine 95.68
PRK0673776 acetolactate synthase 1 regulatory subunit; Validated 95.67
cd0488179 ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-terminal AC 95.57
cd0490273 ACT_3PGDH-xct C-terminal ACT (regulatory) domain of D-3 95.37
cd0490580 ACT_CM-PDT C-terminal ACT domain of the bifunctional ch 95.36
cd0487971 ACT_3PGDH-like ACT_3PGDH-like CD includes the C-termina 95.15
PRK08577135 hypothetical protein; Provisional 94.83
cd0487872 ACT_AHAS N-terminal ACT domain of the Escherichia coli 94.81
cd0491375 ACT_AKii-LysC-BS-like_1 ACT domains of the lysine-sensi 94.74
cd0488075 ACT_AAAH-PDT-like ACT domain of the nonheme iron-depend 94.56
KOG2663309 consensus 94.45
) and D-serine dehydratase () catalyze the dehydratation of L-serine (respectively D-serine) into ammonia and pyruvate. Threonine dehydratase () (TDH) catalyzes the dehydratation of threonine into alpha-ketobutarate and ammonia. In Escherichia coli and other microorganisms, two classes of TDH are known to exist. One is involved in the biosynthesis of isoleucine, the other in hydroxamino acid catabolism. Threonine synthase () is also a pyridoxal-phosphate enzyme, it catalyzes the transformation of homoserine-phosphate into threonine. It has been shown that threonine synthase is distantly related to the serine/threonine dehydratases. In all these enzymes, the pyridoxal-phosphate group is attached to a lysine residue. A form of threonine dehydratase with two copies of the C-terminal domain is described by . This model describes a phylogenetically distinct which branches with the catabolic threonine dehydratase of E. coli; many members are designated as catabolic for this reason. However, the catabolic form lacks any domain. Many members of this model are found in species with other isoleucine biosynthetic enzymes.; GO: 0004794 L-threonine ammonia-lyase activity." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR01127">TIGR01127381 ilvA_1Cterm threonine dehydratase; InterPro: IPR005789 94.05
cd0488774 ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-termina 93.93
CHL00100172 ilvH acetohydroxyacid synthase small subunit 93.28
PRK11895161 ilvH acetolactate synthase 3 regulatory subunit; Review 93.26
cd0490169 ACT_3PGDH C-terminal ACT (regulatory) domain of D-3-Pho 93.08
COG2150167 Predicted regulator of amino acid metabolism, contains 92.91
cd0488472 ACT_CBS C-terminal ACT domain of the cystathionine beta 92.86
PRK04435146 hypothetical protein; Provisional 92.66
PRK1356284 acetolactate synthase 1 regulatory subunit; Provisional 92.35
cd0488876 ACT_PheB-BS C-terminal ACT domain of a small (~147 a.a. 91.84
COG4492150 PheB ACT domain-containing protein [General function pr 90.57
cd0488956 ACT_PDH-BS-like C-terminal ACT domain of the monofuncti 90.56
PRK1115276 ilvM acetolactate synthase 2 regulatory subunit; Provis 90.08
PRK11589183 gcvR glycine cleavage system transcriptional repressor; 98.62
COG2716176 GcvR Glycine cleavage system regulatory protein [Amino 97.96
COG1707218 ACT domain-containing protein [General function predict 97.48
cd0487370 ACT_UUR-ACR-like ACT domains of the bacterial signal-tr 96.81
PRK03381781 PII uridylyl-transferase; Provisional 96.64
cd0490073 ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, inclu 96.2
TIGR01693903 UTase_glnD protein-P-II uridylyltransferase; InterPro: 95.67
PRK05092934 PII uridylyl-transferase; Provisional 95.63
PRK00275894 glnD PII uridylyl-transferase; Provisional 95.58
PRK01759862 glnD PII uridylyl-transferase; Provisional 95.27
cd0489469 ACT_ACR-like_1 ACT domain-containing protein which is c 94.9
PRK04374869 PII uridylyl-transferase; Provisional 94.86
PRK05007881 PII uridylyl-transferase; Provisional 94.73
cd0492868 ACT_TyrKc Uncharacterized, N-terminal ACT domain of an 94.61
PRK03059857 PII uridylyl-transferase; Provisional 94.33
cd0489572 ACT_ACR_1 ACT domain-containing protein which is compos 94.01
COG2844867 GlnD UTP:GlnB (protein PII) uridylyltransferase [Posttr 91.51
cd0492776 ACT_ACR-like_2 Second ACT domain, of a novel type of AC 91.07
cd0488265 ACT_Bt0572_2 C-terminal ACT domain of a novel protein c 90.2
PRK11092 702 bifunctional (p)ppGpp synthetase II/ guanosine-3',5'-bi 96.48
COG0317 701 SpoT Guanosine polyphosphate pyrophosphohydrolases/synt 92.75
PRK13581 524 D-3-phosphoglycerate dehydrogenase; Provisional 91.28
PRK10820 513 DNA-binding transcriptional regulator TyrR; Provisional 95.95
COG0440163 IlvH Acetolactate synthase, small (regulatory) subunit 95.23
PRK08198 406 threonine dehydratase; Provisional 95.91
PRK07334 399 threonine dehydratase; Provisional 95.5
TIGR00289227 TIGR00289 conserved hypothetical protein TIGR00289; Int 94.65
pfam01902219 ATP_bind_4 ATP-binding region. This family of proteins 94.24
PRK08639 418 threonine dehydratase; Validated 92.69
TIGR03590280 PseG pseudaminic acid biosynthesis-associated protein P 92.5
cd01994194 Alpha_ANH_like_IV This is a subfamily of Adenine nucleo 92.09
cd00887394 MoeA MoeA family. Members of this family are involved i 90.02
PRK06349432 homoserine dehydrogenase; Provisional 95.58
PRK03059857 PII uridylyl-transferase; Provisional 92.53
PRK06545357 prephenate dehydrogenase; Validated 95.51
PRK06382 400 threonine dehydratase; Provisional 95.36
PRK08526 403 threonine dehydratase; Provisional 93.95
PRK05007881 PII uridylyl-transferase; Provisional 93.79
PRK05092 934 PII uridylyl-transferase; Provisional 94.57
COG0707357 MurG UDP-N-acetylglucosamine:LPS N-acetylglucosamine tr 91.09
pfam01171182 ATP_bind_3 PP-loop family. This family of proteins belo 94.11
cd01992185 PP-ATPase N-terminal domain of predicted ATPase of the 93.54
cd01993185 Alpha_ANH_like_II This is a subfamily of Adenine nucleo 92.62
cd02009175 TPP_SHCHC_synthase Thiamine pyrophosphate (TPP) family, 92.26
cd00568168 TPP_enzymes Thiamine pyrophosphate (TPP) enzyme family, 91.57
PRK10680411 molybdopterin biosynthesis protein MoeA; Provisional 91.55
cd05017119 SIS_PGI_PMI_1 The members of this protein family contai 90.18
>TIGR00655 PurU formyltetrahydrofolate deformylase; InterPro: IPR004810 An Escherichia coli gene designated purU has been identified and characterised Back     alignment and domain information
>PRK06027 purU formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>PRK13011 formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>PRK13010 purU formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>COG0788 PurU Formyltetrahydrofolate hydrolase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK10538 3-hydroxy acid dehydrogenase; Provisional Back     alignment and domain information
>TIGR00639 PurN phosphoribosylglycinamide formyltransferase; InterPro: IPR004607 This family describes phosphoribosylglycinamide formyltransferase (GAR transformylase), one of several proteins found in formyltransferase Back     alignment and domain information
>PRK05647 purN phosphoribosylglycinamide formyltransferase; Reviewed Back     alignment and domain information
>COG0299 PurN Folate-dependent phosphoribosylglycinamide formyltransferase PurN [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG3076 consensus Back     alignment and domain information
>pfam00551 Formyl_trans_N Formyl transferase Back     alignment and domain information
>PRK00005 fmt methionyl-tRNA formyltransferase; Reviewed Back     alignment and domain information
>PRK06988 putative formyltransferase; Provisional Back     alignment and domain information
>PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated Back     alignment and domain information
>COG0223 Fmt Methionyl-tRNA formyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2452 consensus Back     alignment and domain information
>TIGR00460 fmt methionyl-tRNA formyltransferase; InterPro: IPR005794 Methionyl-tRNA formyltransferase (2 Back     alignment and domain information
>PRK07579 hypothetical protein; Provisional Back     alignment and domain information
>KOG3082 consensus Back     alignment and domain information
>cd04875 ACT_F4HF-DF N-terminal ACT domain of formyltetrahydrofolate deformylase (F4HF-DF; formyltetrahydrofolate hydrolase) Back     alignment and domain information
>PRK00194 hypothetical protein; Validated Back     alignment and domain information
>cd04872 ACT_1ZPV ACT domain proteins similar to the yet uncharacterized Streptococcus pneumoniae ACT domain protein Back     alignment and domain information
>COG3830 ACT domain-containing protein [Signal transduction mechanisms] Back     alignment and domain information
>cd04870 ACT_PSP_1 CT domains found N-terminal of phosphoserine phosphatase (PSP, SerB) Back     alignment and domain information
>cd04869 ACT_GcvR_2 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains Back     alignment and domain information
>PRK11589 gcvR glycine cleavage system transcriptional repressor; Provisional Back     alignment and domain information
>cd04893 ACT_GcvR_1 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains Back     alignment and domain information
>pfam01842 ACT ACT domain Back     alignment and domain information
>cd04874 ACT_Af1403 N-terminal ACT domain of the yet uncharacterized, small (~133 a Back     alignment and domain information
>COG2716 GcvR Glycine cleavage system regulatory protein [Amino acid transport and metabolism] Back     alignment and domain information
>LOAD_ACT consensus Back     alignment and domain information
>cd02116 ACT ACT domains are commonly involved in specifically binding an amino acid or other small ligand leading to regulation of the enzyme Back     alignment and domain information
>cd04909 ACT_PDH-BS C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) Back     alignment and domain information
>cd04876 ACT_RelA-SpoT ACT domain found C-terminal of the RelA/SpoT domains Back     alignment and domain information
>cd04886 ACT_ThrD-II-like C-terminal ACT domain of biodegradative (catabolic) threonine dehydratase II (ThrD-II) and other related ACT domains Back     alignment and domain information
>cd04899 ACT_ACR-UUR-like_2 C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains Back     alignment and domain information
>cd04883 ACT_AcuB C-terminal ACT domain of the Bacillus subtilis acetoin utilization protein, AcuB Back     alignment and domain information
>cd04925 ACT_ACR_2 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>PRK08178 acetolactate synthase 1 regulatory subunit; Reviewed Back     alignment and domain information
>cd04926 ACT_ACR_4 C-terminal ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04903 ACT_LSD C-terminal ACT domain of the L-serine dehydratase (LSD), iron-sulfur-dependent, beta subunit Back     alignment and domain information
>cd04871 ACT_PSP_2 ACT domains found N-terminal of phosphoserine phosphatase (PSP, SerB) Back     alignment and domain information
>PRK06737 acetolactate synthase 1 regulatory subunit; Validated Back     alignment and domain information
>cd04881 ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-terminal ACT domain of the NAD(P)H-dependent, homoserine dehydrogenase (HSDH) and related domains Back     alignment and domain information
>cd04902 ACT_3PGDH-xct C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) Back     alignment and domain information
>cd04905 ACT_CM-PDT C-terminal ACT domain of the bifunctional chorismate mutase-prephenate dehydratase (CM-PDT) enzyme and the prephenate dehydratase (PDT) enzyme Back     alignment and domain information
>cd04879 ACT_3PGDH-like ACT_3PGDH-like CD includes the C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) Back     alignment and domain information
>PRK08577 hypothetical protein; Provisional Back     alignment and domain information
>cd04878 ACT_AHAS N-terminal ACT domain of the Escherichia coli IlvH-like regulatory subunit of acetohydroxyacid synthase (AHAS) Back     alignment and domain information
>cd04913 ACT_AKii-LysC-BS-like_1 ACT domains of the lysine-sensitive aspartokinase isoenzyme AKII of Bacillus subtilis (BS) strain 168 and related proteins Back     alignment and domain information
>cd04880 ACT_AAAH-PDT-like ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) Back     alignment and domain information
>KOG2663 consensus Back     alignment and domain information
>TIGR01127 ilvA_1Cterm threonine dehydratase; InterPro: IPR005789 Serine and threonine dehydratases , are functionally and structurally related pyridoxal-phosphate dependent enzymes Back     alignment and domain information
>cd04887 ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-terminal ACT domain of putative NAD-dependent malic enzyme 1, Bacillus subtilis YqkI and related domains Back     alignment and domain information
>CHL00100 ilvH acetohydroxyacid synthase small subunit Back     alignment and domain information
>PRK11895 ilvH acetolactate synthase 3 regulatory subunit; Reviewed Back     alignment and domain information
>cd04901 ACT_3PGDH C-terminal ACT (regulatory) domain of D-3-Phosphoglycerate Dehydrogenase (3PGDH) found in fungi and bacteria Back     alignment and domain information
>COG2150 Predicted regulator of amino acid metabolism, contains ACT domain [General function prediction only] Back     alignment and domain information
>cd04884 ACT_CBS C-terminal ACT domain of the cystathionine beta-synthase (CBS) domain protein found in Thermotoga maritima, Tm0935, and delta proteobacteria Back     alignment and domain information
>PRK04435 hypothetical protein; Provisional Back     alignment and domain information
>PRK13562 acetolactate synthase 1 regulatory subunit; Provisional Back     alignment and domain information
>cd04888 ACT_PheB-BS C-terminal ACT domain of a small (~147 a Back     alignment and domain information
>COG4492 PheB ACT domain-containing protein [General function prediction only] Back     alignment and domain information
>cd04889 ACT_PDH-BS-like C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) enzyme that catalyzes the formation of 4-hydroxyphenylpyruvate from prephenate Back     alignment and domain information
>PRK11152 ilvM acetolactate synthase 2 regulatory subunit; Provisional Back     alignment and domain information
>PRK11589 gcvR glycine cleavage system transcriptional repressor; Provisional Back     alignment and domain information
>COG2716 GcvR Glycine cleavage system regulatory protein [Amino acid transport and metabolism] Back     alignment and domain information
>COG1707 ACT domain-containing protein [General function prediction only] Back     alignment and domain information
>cd04873 ACT_UUR-ACR-like ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD Back     alignment and domain information
>PRK03381 PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd04900 ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, includes the first of two C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains Back     alignment and domain information
>TIGR01693 UTase_glnD protein-P-II uridylyltransferase; InterPro: IPR010043 This entry describes GlnD, the uridylyltransferase/uridylyl-removing enzyme for signal-transduction protein PII, and acts as the sensory component of the nitrogen regulation (ntr) system Back     alignment and domain information
>PRK05092 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK00275 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK01759 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd04894 ACT_ACR-like_1 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>PRK04374 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK05007 PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd04928 ACT_TyrKc Uncharacterized, N-terminal ACT domain of an Arabidopsis/Oryza predicted tyrosine kinase and other related ACT domains Back     alignment and domain information
>PRK03059 PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd04895 ACT_ACR_1 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>COG2844 GlnD UTP:GlnB (protein PII) uridylyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd04927 ACT_ACR-like_2 Second ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04882 ACT_Bt0572_2 C-terminal ACT domain of a novel protein composed of just two ACT domains Back     alignment and domain information
>PRK11092 bifunctional (p)ppGpp synthetase II/ guanosine-3',5'-bis pyrophosphate 3'-pyrophosphohydrolase; Provisional Back     alignment and domain information
>COG0317 SpoT Guanosine polyphosphate pyrophosphohydrolases/synthetases [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional Back     alignment and domain information
>COG0440 IlvH Acetolactate synthase, small (regulatory) subunit [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08198 threonine dehydratase; Provisional Back     alignment and domain information
>PRK07334 threonine dehydratase; Provisional Back     alignment and domain information
>TIGR00289 TIGR00289 conserved hypothetical protein TIGR00289; InterPro: IPR005237 This family of conserved hypothetical proteins has no known function Back     alignment and domain information
>pfam01902 ATP_bind_4 ATP-binding region Back     alignment and domain information
>PRK08639 threonine dehydratase; Validated Back     alignment and domain information
>TIGR03590 PseG pseudaminic acid biosynthesis-associated protein PseG Back     alignment and domain information
>cd01994 Alpha_ANH_like_IV This is a subfamily of Adenine nucleotide alpha hydrolases superfamily Back     alignment and domain information
>cd00887 MoeA MoeA family Back     alignment and domain information
>PRK06349 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PRK03059 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK06545 prephenate dehydrogenase; Validated Back     alignment and domain information
>PRK06382 threonine dehydratase; Provisional Back     alignment and domain information
>PRK08526 threonine dehydratase; Provisional Back     alignment and domain information
>PRK05007 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK05092 PII uridylyl-transferase; Provisional Back     alignment and domain information
>COG0707 MurG UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>pfam01171 ATP_bind_3 PP-loop family Back     alignment and domain information
>cd01992 PP-ATPase N-terminal domain of predicted ATPase of the PP-loop faimly implicated in cell cycle control [Cell division and chromosome partitioning] Back     alignment and domain information
>cd01993 Alpha_ANH_like_II This is a subfamily of Adenine nucleotide alpha hydrolases superfamily Back     alignment and domain information
>cd02009 TPP_SHCHC_synthase Thiamine pyrophosphate (TPP) family, SHCHC synthase subfamily, TPP-binding module; composed of proteins similar to Escherichia coli 2-succinyl-6-hydroxyl-2,4-cyclohexadiene-1-carboxylic acid (SHCHC) synthase (also called MenD) Back     alignment and domain information
>cd00568 TPP_enzymes Thiamine pyrophosphate (TPP) enzyme family, TPP-binding module; found in many key metabolic enzymes which use TPP (also known as thiamine diphosphate) as a cofactor Back     alignment and domain information
>PRK10680 molybdopterin biosynthesis protein MoeA; Provisional Back     alignment and domain information
>cd05017 SIS_PGI_PMI_1 The members of this protein family contain the SIS (Sugar ISomerase) domain and have both the phosphoglucose isomerase (PGI) and the phosphomannose isomerase (PMI) functions Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

Original result of PSI-BLAST

IdentityAlignment graphLength Definition E-value
Target288 formyltetrahydrofolate deformylase [Candidatus Liberiba
3obi_A288 Crystal Structure Of A Formyltetrahydrofolate Defor 9e-76
3o1l_A302 Crystal Structure Of A Formyltetrahydrofolate Defor 1e-74
3nrb_A287 Crystal Structure Of A Formyltetrahydrofolate Defor 6e-73
3lou_A292 Crystal Structure Of Formyltetrahydrofolate Deformy 3e-68
3n0v_A286 Crystal Structure Of A Formyltetrahydrofolate Defor 2e-66
2ywr_A216 Crystal Structure Of Gar Transformylase From Aquife 2e-41
3kcq_A215 Crystal Structure Of Phosphoribosylglycinamide Form 1e-38
1cdd_A212 Structures Of Apo And Complexed Escherichia Coli Gl 1e-36
1grc_A212 Crystal Structure Of Glycinamide Ribonucleotide Tra 1e-36
1c3e_A209 New Insights Into Inhibitor Design From The Crystal 1e-36
2gar_A212 A Ph-Dependent Stablization Of An Active Site Loop 1e-36
1zly_A203 The Structure Of Human Glycinamide Ribonucleotide T 1e-35
1meo_A209 Human Glycinamide Ribonucleotide Transformylase At 1e-35
1zlx_A203 The Apo Structure Of Human Glycinamide Ribonucleoti 3e-35
1mej_B223 Human Glycinamide Ribonucleotide Transformylase Dom 4e-35
3p9x_A211 Crystal Structure Of Phosphoribosylglycinamide Form 2e-34
3da8_A215 Crystal Structure Of Purn From Mycobacterium Tuberc 5e-23
1s3i_A 310 Crystal Structure Of The N Terminal Hydrolase Domai 3e-12
2bw0_A329 Crystal Structure Of The Hydrolase Domain Of Human 1e-11
3rfo_A 317 Crystal Structure Of Methyionyl-Trna Formyltransfer 7e-11
2bln_A 305 N-Terminal Formyltransferase Domain Of Arna In Comp 1e-09
1yrw_A302 Crystal Structure Of E.Coli Arna Transformylase Dom 1e-09
1z7e_A 660 Crystal Structure Of Full Length Arna Length = 660 2e-09
3r8x_A 318 Crystal Structure Of Methionyl-Trna Formyltransfera 2e-09
1fmt_A 314 Methionyl-Trnafmet Formyltransferase From Escherich 1e-08
3q0i_A 318 Methionyl-Trna Formyltransferase From Vibrio Choler 2e-07
1zpv_A91 Act Domain Protein From Streptococcus Pneumoniae Le 2e-04
>gi|303325207|pdb|3OBI|A Chain A, Crystal Structure Of A Formyltetrahydrofolate Deformylase (Np_949368) From Rhodopseudomonas Palustris Cga009 At 1.95 A Resolution Length = 288 Back     alignment and structure 
 Score =  288 bits (736), Expect = 9e-76,   Method: Composition-based stats.
 Identities = 116/281 (41%), Positives = 169/281 (60%), Gaps = 4/281 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT---CMKL 59
            Y+LT++CP    I S +  +L   G NILD  Q+ND ++   F R+ F        +  
Sbjct: 6   QYVLTLSCPDRAGIVSAVSTFLFENGQNILDAQQYNDTESGHFFXRVVFNAAAKVIPLAS 65

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
               F  I  +F+  +  R+ +   K  +LVSQ DHCL D+LYRW +G L      +VSN
Sbjct: 66  LRTGFGVIAAKFTXGWHXRDRETRRKVXLLVSQSDHCLADILYRWRVGDLHXIPTAIVSN 125

Query: 120 HTTHKKLVENYQ-LPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           H        ++  +PFY+ P+ +  + + E  +  +I + + +L++LARY QILSD    
Sbjct: 126 HPRETFSGFDFGDIPFYHFPVNKDTRRQQEAAITALIAQTHTDLVVLARYXQILSDEXSA 185

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           ++ GR INIHHSFLP FKGA PY QA++ GVK+IGATAHY    LD GPII+QDV R++H
Sbjct: 186 RLAGRCINIHHSFLPGFKGAKPYHQAFDRGVKLIGATAHYVTSALDEGPIIDQDVERISH 245

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             T  D +  G++IE +VL++A++ H+  RV +N RKT+VF
Sbjct: 246 RDTPADLVRKGRDIERRVLSRALHYHLDDRVILNGRKTVVF 286
>gi|306991895|pdb|3O1L|A Chain A, Crystal Structure Of A Formyltetrahydrofolate Deformylase (Pspto_4314) From Pseudomonas Syringae Pv. Tomato Str. Dc3000 At 2.20 A Resolution Length = 302 Back     alignment and structure
>gi|301598784|pdb|3NRB|A Chain A, Crystal Structure Of A Formyltetrahydrofolate Deformylase (Puru, Pp_1943) From Pseudomonas Putida Kt2440 At 2.05 A Resolution Length = 287 Back     alignment and structure
>gi|289526942|pdb|3LOU|A Chain A, Crystal Structure Of Formyltetrahydrofolate Deformylase (Yp_105254.1) From Burkholderia Mallei Atcc 23344 At 1.90 A Resolution Length = 292 Back     alignment and structure
>gi|298508708|pdb|3N0V|A Chain A, Crystal Structure Of A Formyltetrahydrofolate Deformylase (P From Pseudomonas Putida Kt2440 At 2.25 A Resolution Length = 286 Back     alignment and structure
>gi|159795629|pdb|2YWR|A Chain A, Crystal Structure Of Gar Transformylase From Aquifex Aeolicus Length = 216 Back     alignment and structure
>gi|281307158|pdb|3KCQ|A Chain A, Crystal Structure Of Phosphoribosylglycinamide Formyltransferase From Anaplasma Phagocytophilum Length = 215 Back     alignment and structure
>gi|809280|pdb|1CDD|A Chain A, Structures Of Apo And Complexed Escherichia Coli Glycinamide Ribonucleotide Transformylase Length = 212 Back     alignment and structure
gi|442965|pdb|1GRC|A Chain A, Crystal Structure Of Glycinamide Ribonucleotide Transformylase From Escherichia Coli At 3.0 Angstroms Resolution: A Target Enzyme For Chemotherapy Length = 212 Back     alignment and structure
>gi|6730124|pdb|1C3E|A Chain A, New Insights Into Inhibitor Design From The Crystal Structure And Nmr Studies Of E. Coli Gar Transformylate In Complex With Beta-Gar And 10-Formyl-5,8,10-Trideazafolic Acid. Length = 209 Back     alignment and structure
>gi|157835027|pdb|2GAR|A Chain A, A Ph-Dependent Stablization Of An Active Site Loop Observed From Low And High Ph Crystal Structures Of Mutant Monomeric Glycinamide Ribonucleotide Transformylase Length = 212 Back     alignment and structure
>gi|75765818|pdb|1ZLY|A Chain A, The Structure Of Human Glycinamide Ribonucleotide Transformylase In Complex With Alpha,Beta-N- (Hydroxyacetyl)-D-Ribofuranosylamine And 10-Formyl-5,8, Dideazafolate Length = 203 Back     alignment and structure
>gi|27573895|pdb|1MEO|A Chain A, Human Glycinamide Ribonucleotide Transformylase At Ph 4.2 Length = 209 Back     alignment and structure
>gi|75765817|pdb|1ZLX|A Chain A, The Apo Structure Of Human Glycinamide Ribonucleotide Transformylase Length = 203 Back     alignment and structure
>gi|27573889|pdb|1MEJ|B Chain B, Human Glycinamide Ribonucleotide Transformylase Domain At Ph 8.5 Length = 223 Back     alignment and structure
>gi|319443711|pdb|3P9X|A Chain A, Crystal Structure Of Phosphoribosylglycinamide Formyltransferase From Bacillus Halodurans Length = 211 Back     alignment and structure
>gi|237640472|pdb|3DA8|A Chain A, Crystal Structure Of Purn From Mycobacterium Tuberculosis Length = 215 Back     alignment and structure
>gi|42543697|pdb|1S3I|A Chain A, Crystal Structure Of The N Terminal Hydrolase Domain Of 10- Formyltetrahydrofolate Dehydrogenase Length = 310 Back     alignment and structure
>gi|73536304|pdb|2BW0|A Chain A, Crystal Structure Of The Hydrolase Domain Of Human 10- Formyltetrahydrofolate 2 Dehydrogenase Length = 329 Back     alignment and structure
>gi|329666301|pdb|3RFO|A Chain A, Crystal Structure Of Methyionyl-Trna Formyltransferase From Bacillus Anthracis Length = 317 Back     alignment and structure
>gi|66361563|pdb|2BLN|A Chain A, N-Terminal Formyltransferase Domain Of Arna In Complex With N-5-Formyltetrahydrofolate And Ump Length = 305 Back     alignment and structure
>gi|66361188|pdb|1YRW|A Chain A, Crystal Structure Of E.Coli Arna Transformylase Domain Length = 302 Back     alignment and structure
gi|71042200|pdb|1Z7E|A Chain A, Crystal Structure Of Full Length Arna Length = 660 Back     alignment and structure
>gi|328877395|pdb|3R8X|A Chain A, Crystal Structure Of Methionyl-Trna Formyltransferase From Yersinia Pestis Complexed With L-Methionine Length = 318 Back     alignment and structure
>gi|2914332|pdb|1FMT|A Chain A, Methionyl-Trnafmet Formyltransferase From Escherichia Coli Length = 314 Back     alignment and structure
>gi|315583678|pdb|3Q0I|A Chain A, Methionyl-Trna Formyltransferase From Vibrio Cholerae Length = 318 Back     alignment and structure
>gi|71042427|pdb|1ZPV|A Chain A, Act Domain Protein From Streptococcus Pneumoniae Length = 91 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

IdentityAlignment graphLength Definition E-value
Target288 formyltetrahydrofolate deformylase [Candidatus Liberiba
3lou_A292 Formyltetrahydrofolate deformylase; structural genomics 2e-73
3o1l_A302 Formyltetrahydrofolate deformylase; structural genomics 1e-62
3obi_A288 Formyltetrahydrofolate deformylase; structural genomics 7e-61
3n0v_A286 Formyltetrahydrofolate deformylase; formyl transferase, 2e-59
3nrb_A287 Formyltetrahydrofolate deformylase; N-terminal ACT doma 2e-59
1jkx_A212 GART;, phosphoribosylglycinamide formyltransferase; pur 8e-36
3kcq_A215 Phosphoribosylglycinamide formyltransferase; structural 2e-34
1meo_A209 Phosophoribosylglycinamide formyltransferase; purine bi 6e-32
2ywr_A216 Phosphoribosylglycinamide formyltransferase; rossmann f 8e-27
1fmt_A 314 Methionyl-tRNA FMet formyltransferase; initiator tRNA, 2e-25
3da8_A215 Probable 5'-phosphoribosylglycinamide formyltransferase 3e-18
1z7e_A 660 Protein aRNA; rossmann fold, OB-like fold, hydrolase; H 3e-17
1zpv_A91 ACT domain protein; structural genomics, PSI, protein s 7e-08
2bw0_A 329 10-FTHFDH, 10-formyltetrahydrofolate dehydrogenase; nuc 3e-06
1zgh_A260 Methionyl-tRNA formyltransferase; southeast collaborato 6e-05
1u8s_A192 Glycine cleavage system transcriptional repressor, puta 3e-04
2nyi_A195 Unknown protein; protein structure initiative, PSI, cen 0.002
>3lou_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Burkholderia mallei} Length = 292 Back     alignment and structure
 Score =  271 bits (693), Expect = 2e-73
 Identities = 116/282 (41%), Positives = 175/282 (62%), Gaps = 5/282 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIA 62
            ++LT++CPS     + +   L    C + +++ F+D  +++ F+R  F           
Sbjct: 10  QFVLTLSCPSAAGQVAAVVGLLDRHRCYVDELTVFDDDLSARFFVRCVFHATDDADALRV 69

Query: 63  D-----FQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
           D     F+PI ++F +Q++I +     K LI+VS+ +HCL DLL+RW +G L ++IVG+V
Sbjct: 70  DALRREFEPIAERFRMQWAIHDVAARPKVLIMVSKLEHCLADLLFRWKMGELKMDIVGIV 129

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH     L   + LPF + P+T   K + E + +++ E +  EL+ILARYMQ+LS    
Sbjct: 130 SNHPDFAPLAAQHGLPFRHFPITADTKAQQEAQWLDVFETSGAELVILARYMQVLSPEAS 189

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            ++  R INIHHSFLP FKGA PY QA+  GVK+IGATAH+   +LD GPIIEQ V RV 
Sbjct: 190 ARLANRAINIHHSFLPGFKGAKPYHQAHARGVKLIGATAHFVTDDLDEGPIIEQVVERVD 249

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H+   E  +A+G+++E   L +AV A I++RVF+N  +T+VF
Sbjct: 250 HSYRPEQLLAVGRDVECITLARAVKAFIERRVFLNGDRTVVF 291
>3o1l_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 2.20A {Pseudomonas syringae PV} Length = 302 Back     alignment and structure
>3obi_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.95A {Rhodopseudomonas palustris} Length = 288 Back     alignment and structure
>3n0v_A Formyltetrahydrofolate deformylase; formyl transferase, ACT domain, structural genomics, joint C structural genomics, JCSG; HET: MSE; 2.25A {Pseudomonas putida} Length = 286 Back     alignment and structure
>3nrb_A Formyltetrahydrofolate deformylase; N-terminal ACT domain, structural genomics, joint center for structural genomics, JCSG; HET: MSE FLC; 2.05A {Pseudomonas putida} Length = 287 Back     alignment and structure
>1jkx_A GART;, phosphoribosylglycinamide formyltransferase; purine biosynthesis, anti-cancer agent; HET: 138; 1.60A {Escherichia coli} SCOP: c.65.1.1 PDB: 1cdd_A 1cde_A* 1c2t_A* 1grc_A 1gar_A* 2gar_A 3gar_A 1c3e_A* Length = 212 Back     alignment and structure
>3kcq_A Phosphoribosylglycinamide formyltransferase; structural genomics, niaid, seattle structural genomics center for infectious disease; 2.20A {Anaplasma phagocytophilum HZ} Length = 215 Back     alignment and structure
>1meo_A Phosophoribosylglycinamide formyltransferase; purine biosynthesis; 1.72A {Homo sapiens} SCOP: c.65.1.1 PDB: 1njs_A* 1rbm_A* 1rbq_A* 1rby_A* 1rbz_A* 1rc0_A* 1rc1_A* 1zly_A* 1zlx_A* 1mej_B 1men_A* Length = 209 Back     alignment and structure
>2ywr_A Phosphoribosylglycinamide formyltransferase; rossmann fold, structural genomics, NPPSFA; 1.77A {Aquifex aeolicus} Length = 216 Back     alignment and structure
>1fmt_A Methionyl-tRNA FMet formyltransferase; initiator tRNA, translation initiation; 2.00A {Escherichia coli} SCOP: b.46.1.1 c.65.1.1 PDB: 2fmt_A* Length = 314 Back     alignment and structure
>3da8_A Probable 5'-phosphoribosylglycinamide formyltransferase PURN; glycinamide ribonucleotide transformylase, structure; 1.30A {Mycobacterium tuberculosis} PDB: 3dcj_A* Length = 215 Back     alignment and structure
>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 Length = 660 Back     alignment and structure
>1zpv_A ACT domain protein; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.90A {Streptococcus pneumoniae TIGR4} SCOP: d.58.18.7 Length = 91 Back     alignment and structure
>2bw0_A 10-FTHFDH, 10-formyltetrahydrofolate dehydrogenase; nucleotide biosynthesis, oxidoreductase; 1.7A {Homo sapiens} SCOP: b.46.1.1 c.65.1.1 PDB: 2cfi_A* 1s3i_A Length = 329 Back     alignment and structure
>1zgh_A Methionyl-tRNA formyltransferase; southeast collaboratory for structural genomics, PSI, protein structure initiative, secsg; 2.05A {Clostridium thermocellum atcc 27405} SCOP: b.46.1.1 c.65.1.1 Length = 260 Back     alignment and structure
>1u8s_A Glycine cleavage system transcriptional repressor, putative; structural genomics, protein structure initiative (PSI), domain swapping; 2.45A {Vibrio cholerae} SCOP: d.58.18.5 d.58.18.5 Length = 192 Back     alignment and structure
>2nyi_A Unknown protein; protein structure initiative, PSI, center for eukaryotic structural genomics, CESG, structural genomics; 1.80A {Galdieria sulphuraria} Length = 195 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

Original result of HHsearch against PDB70 database

IdentityAlignment graphLength Definition Probability
Target288 formyltetrahydrofolate deformylase [Candidatus Liberiba
3lou_A292 Formyltetrahydrofolate deformylase; structural genomics 100.0
3o1l_A302 Formyltetrahydrofolate deformylase; structural genomics 100.0
3n0v_A286 Formyltetrahydrofolate deformylase; formyl transferase, 100.0
3obi_A288 Formyltetrahydrofolate deformylase; structural genomics 100.0
3nrb_A287 Formyltetrahydrofolate deformylase; N-terminal ACT doma 100.0
2ywr_A216 Phosphoribosylglycinamide formyltransferase; rossmann f 100.0
1jkx_A212 GART;, phosphoribosylglycinamide formyltransferase; pur 100.0
3kcq_A215 Phosphoribosylglycinamide formyltransferase; structural 100.0
3da8_A215 Probable 5'-phosphoribosylglycinamide formyltransferase 100.0
1meo_A209 Phosophoribosylglycinamide formyltransferase; purine bi 100.0
1z7e_A 660 Protein aRNA; rossmann fold, OB-like fold, hydrolase; H 99.97
2bln_A 305 Protein YFBG; transferase, formyltransferase, L-ARA4N b 99.97
1fmt_A 314 Methionyl-tRNA FMet formyltransferase; initiator tRNA, 99.96
2bw0_A329 10-FTHFDH, 10-formyltetrahydrofolate dehydrogenase; nuc 99.96
1zgh_A260 Methionyl-tRNA formyltransferase; southeast collaborato 99.87
2c82_A 413 1-deoxy-D-xylulose 5-phosphate reductoisomerase; RV2870 90.31
2nyi_A195 Unknown protein; protein structure initiative, PSI, cen 99.71
1u8s_A192 Glycine cleavage system transcriptional repressor, puta 99.48
1y7p_A223 Hypothetical protein AF1403; structural genomics, prote 97.98
1zpv_A91 ACT domain protein; structural genomics, PSI, protein s 99.63
1u8s_A192 Glycine cleavage system transcriptional repressor, puta 98.88
2nyi_A195 Unknown protein; protein structure initiative, PSI, cen 98.52
2ko1_A88 CTR148A, GTP pyrophosphokinase; homodimer, alpha+beta, 97.79
3p96_A415 Phosphoserine phosphatase SERB; ssgcid, structural geno 97.66
2fgc_A193 Acetolactate synthase, small subunit; regulatory subuni 96.82
2f1f_A164 Acetolactate synthase isozyme III small subunit; ferred 96.7
2pc6_A165 Probable acetolactate synthase isozyme III (small subun 95.44
3p96_A 415 Phosphoserine phosphatase SERB; ssgcid, structural geno 98.96
3mtj_A 444 Homoserine dehydrogenase; rossmann-fold, PSI, MCSG, str 95.82
1ni5_A 433 Putative cell cycle protein MESJ; structural genomics, 93.16
2der_A 380 TRNA-specific 2-thiouridylase MNMA; protein-RNA complex 90.27
1ygy_A 529 PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductas 95.75
2yut_A207 Putative short-chain oxidoreductase; alpha and beta pro 91.98
2f06_A144 Conserved hypothetical protein; structural genomics hyp 94.36
1f0k_A364 MURG, UDP-N-acetylglucosamine-N-acetylmuramyl- (pentape 93.6
2qmx_A283 Prephenate dehydratase; APC86053, L-Phe inhibition, PDT 91.45
2f06_A144 Conserved hypothetical protein; structural genomics hyp 90.5
1wy5_A317 TILS, hypothetical UPF0072 protein AQ_1887; N-type ATP- 93.9
3a2k_A 464 TRNA(Ile)-lysidine synthase; ligase, pseudo-knot, ligas 91.31
3luy_A329 Probable chorismate mutase; structural genomics, APC380 91.5
>3lou_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Burkholderia mallei} Back     alignment and structure
Probab=100.00  E-value=0  Score=664.41  Aligned_cols=278  Identities=41%  Similarity=0.765  Sum_probs=272.5

Q ss_pred             EEEEEEECCCCCCHHHHHHHHHHHCCCCEEEEEEEECCCCCEEEEEEEEECCC-----CHHHHHHHHHHHHCCCCCCEEC
Q ss_conf             49999985998766888999998579818973444324368899999997288-----5277798889874002320201
Q gi|254780911|r    3 SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT-----CMKLFIADFQPIVQQFSLQYSI   77 (288)
Q Consensus         3 ~~iLti~CpD~~GIVA~VT~~La~~g~NI~~~~Q~~D~~~~~FFmRi~f~~~~-----~~~~l~~~f~~ia~~~~m~~~i   77 (288)
                      +||||++||||+||||+||+||+++||||++++||+|.++++||||++|+...     ..+.++++|.+++++|+|+|++
T Consensus        10 ~~iL~i~CpD~~GiVa~vs~~l~~~g~nI~~~~qf~D~~~~~FFmR~~f~~~~~~~~~~~~~l~~~~~~~a~~~~m~~~~   89 (292)
T 3lou_A           10 QFVLTLSCPSAAGQVAAVVGLLDRHRCYVDELTVFDDDLSARFFVRCVFHATDDADALRVDALRREFEPIAERFRMQWAI   89 (292)
T ss_dssp             EEEEEEEEESCSCHHHHHHHHHHHTTEEEEEEEEEEETTTTEEEEEEEEEECC----CCHHHHHHHHHHHHHHHTCEEEE
T ss_pred             EEEEEEECCCCCCHHHHHHHHHHHCCCCEEECCCCCCCCCCEEEEEEEEECCCCCCCCCHHHHHHHHHHHHHHCCCCEEC
T ss_conf             38999989998864999999999789999787344488888078989997268854338899999988666543872330


Q ss_pred             CCCCCCCCEEEEECCCCCCHHHHHHHHCCCCCEEEEEEEEECCHHHHHHHHHCCCCEEECCCCCCCHHHHHHHHHHHHHH
Q ss_conf             24456553899970886798999986204674158999997734667778860997474168733527767899999733
Q gi|254780911|r   78 RNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEK  157 (288)
Q Consensus        78 ~~~~~~~riailvSg~gsnL~~Ll~~~~~g~L~~eI~~VISN~~d~~~lA~~~gIP~~~i~~~~~~k~~~e~~il~~l~~  157 (288)
                      ++.+.|+|+|||+||+||||++||+++++|+|+++|++|||||++++++|+.+++|+++++.++.+|+++|+++++++++
T Consensus        90 ~~~~~~~riavlvSg~g~~L~~Ll~~~~~g~L~~eI~~ViSN~~~~~~l~~a~~ip~~~~~~~~~~~~~~e~~~~~~l~~  169 (292)
T 3lou_A           90 HDVAARPKVLIMVSKLEHCLADLLFRWKMGELKMDIVGIVSNHPDFAPLAAQHGLPFRHFPITADTKAQQEAQWLDVFET  169 (292)
T ss_dssp             EETTSCCEEEEEECSCCHHHHHHHHHHHHTSSCCEEEEEEESSSTTHHHHHHTTCCEEECCCCSSCHHHHHHHHHHHHHH
T ss_pred             CCCCCCCEEEEEECCCCCCHHHHHHHHHCCCCCEEEEEEECCCCCHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHH
T ss_conf             45456836999967998269999999976999817999974894279999975498478615876278899999999862


Q ss_pred             CCCEEEEECCCCCCCCHHHHHHCCCCEEEECCCCCCCCCCCCHHHHHHHCCCCEEEEEEEEEECCCCCCCEEEEEEEECC
Q ss_conf             39409998276754887786327784796133667678999958999742683762257753055688834444466518
Q gi|254780911|r  158 NNVELMILARYMQILSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT  237 (288)
Q Consensus       158 ~~~DlivLAgymril~~~~~~~~~~~iiNiHpslLP~f~G~~~y~~A~~~Gvk~~G~TvH~V~~~lD~GpII~Q~~~~v~  237 (288)
                      +++|||||||||||||++|+++|++++||+||||||+|+|++||++|+.+|+|.+|||+|||++++|+||||+|+.++|+
T Consensus       170 ~~~Dlivlagym~Il~~~~l~~~~~~iiNiHpSlLP~~~G~~~~~~ai~~g~k~~G~TvH~v~~~lD~GpII~Q~~~~I~  249 (292)
T 3lou_A          170 SGAELVILARYMQVLSPEASARLANRAINIHHSFLPGFKGAKPYHQAHARGVKLIGATAHFVTDDLDEGPIIEQVVERVD  249 (292)
T ss_dssp             HTCSEEEESSCCSCCCHHHHHHTTTSEEEEEEECSSCCCSSCHHHHHHHHTCSEEEEEEEECCSSTTCSCEEEEEEEECC
T ss_pred             CCCEEEEHHHHCCCCCCHHHHHCCCCEEEECCCCCCCCCCCCCHHHHHHCCCCEEEEEEEEEECCCCCCCEEEEEEEECC
T ss_conf             49809984781341770633216785599656866233788818899977995799999999489837980699998749


Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEECCEEEECC
Q ss_conf             8889999999999999999999999987691788688579808
Q gi|254780911|r  238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP  280 (288)
Q Consensus       238 ~~dt~~~l~~~~~~~E~~~l~~av~~~~e~rv~~~~~ktvvf~  280 (288)
                      ++||+++|.+|++++|+++|++||++++|+||+++|||||||.
T Consensus       250 ~~dt~~~L~~~~~~~E~~~l~~ai~~~~e~rv~~~~~ktvvF~  292 (292)
T 3lou_A          250 HSYRPEQLLAVGRDVECITLARAVKAFIERRVFLNGDRTVVFQ  292 (292)
T ss_dssp             TTCCHHHHHHHHHHHHHHHHHHHHHHHHTTCEEEETTEEEECC
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCEEECCCEEEEEC
T ss_conf             9999999999999999999999999998199899099889969
>3o1l_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 2.20A {Pseudomonas syringae PV} Back     alignment and structure
>3n0v_A Formyltetrahydrofolate deformylase; formyl transferase, ACT domain, structural genomics, joint C structural genomics, JCSG; HET: MSE; 2.25A {Pseudomonas putida} Back     alignment and structure
>3obi_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.95A {Rhodopseudomonas palustris} Back     alignment and structure
>3nrb_A Formyltetrahydrofolate deformylase; N-terminal ACT domain, structural genomics, joint center for structural genomics, JCSG; HET: MSE FLC; 2.05A {Pseudomonas putida} Back     alignment and structure
>2ywr_A Phosphoribosylglycinamide formyltransferase; rossmann fold, structural genomics, NPPSFA; 1.77A {Aquifex aeolicus} Back     alignment and structure
>1jkx_A GART;, phosphoribosylglycinamide formyltransferase; purine biosynthesis, anti-cancer agent; HET: 138; 1.60A {Escherichia coli} SCOP: c.65.1.1 PDB: 1cdd_A 1cde_A* 1c2t_A* 1grc_A 1gar_A* 2gar_A 3gar_A 1c3e_A* Back     alignment and structure
>3kcq_A Phosphoribosylglycinamide formyltransferase; structural genomics, niaid, seattle structural genomics center for infectious disease; 2.20A {Anaplasma phagocytophilum HZ} Back     alignment and structure
>3da8_A Probable 5'-phosphoribosylglycinamide formyltransferase PURN; glycinamide ribonucleotide transformylase, structure; 1.30A {Mycobacterium tuberculosis} PDB: 3dcj_A* Back     alignment and structure
>1meo_A Phosophoribosylglycinamide formyltransferase; purine biosynthesis; 1.72A {Homo sapiens} SCOP: c.65.1.1 PDB: 1njs_A* 1rbm_A* 1rbq_A* 1rby_A* 1rbz_A* 1rc0_A* 1rc1_A* 1zly_A* 1zlx_A* 1mej_B 1men_A* Back     alignment and structure
>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 Back     alignment and structure
>2bln_A Protein YFBG; transferase, formyltransferase, L-ARA4N biosynthesis, methyltransferase; HET: FON U5P; 1.2A {Escherichia coli} SCOP: b.46.1.1 c.65.1.1 PDB: 1yrw_A Back     alignment and structure
>1fmt_A Methionyl-tRNA FMet formyltransferase; initiator tRNA, translation initiation; 2.00A {Escherichia coli} SCOP: b.46.1.1 c.65.1.1 PDB: 2fmt_A* Back     alignment and structure
>2bw0_A 10-FTHFDH, 10-formyltetrahydrofolate dehydrogenase; nucleotide biosynthesis, oxidoreductase; 1.7A {Homo sapiens} SCOP: b.46.1.1 c.65.1.1 PDB: 2cfi_A* 1s3i_A Back     alignment and structure
>1zgh_A Methionyl-tRNA formyltransferase; southeast collaboratory for structural genomics, PSI, protein structure initiative, secsg; 2.05A {Clostridium thermocellum atcc 27405} SCOP: b.46.1.1 c.65.1.1 Back     alignment and structure
>2c82_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; RV2870C, DOXP/MEP pathway, oxidoreductase, isoprene biosynthesis, metal-binding; 1.9A {Mycobacterium tuberculosis} PDB: 2jd1_A* 2jcv_A* 2jcz_A* 2jd2_A 2jcx_A* 2jcy_A 2jd0_A* Back     alignment and structure
>2nyi_A Unknown protein; protein structure initiative, PSI, center for eukaryotic structural genomics, CESG, structural genomics; 1.80A {Galdieria sulphuraria} Back     alignment and structure
>1u8s_A Glycine cleavage system transcriptional repressor, putative; structural genomics, protein structure initiative (PSI), domain swapping; 2.45A {Vibrio cholerae} SCOP: d.58.18.5 d.58.18.5 Back     alignment and structure
>1y7p_A Hypothetical protein AF1403; structural genomics, protein structure initiative, PSI, alpha-beta-alpha sandwich; HET: RIP; 1.90A {Archaeoglobus fulgidus} SCOP: c.23.1.7 d.58.18.12 Back     alignment and structure
>1zpv_A ACT domain protein; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.90A {Streptococcus pneumoniae TIGR4} SCOP: d.58.18.7 Back     alignment and structure
>1u8s_A Glycine cleavage system transcriptional repressor, putative; structural genomics, protein structure initiative (PSI), domain swapping; 2.45A {Vibrio cholerae} SCOP: d.58.18.5 d.58.18.5 Back     alignment and structure
>2nyi_A Unknown protein; protein structure initiative, PSI, center for eukaryotic structural genomics, CESG, structural genomics; 1.80A {Galdieria sulphuraria} Back     alignment and structure
>2ko1_A CTR148A, GTP pyrophosphokinase; homodimer, alpha+beta, transferase, structural genomics, PSI-2, protein structure initiative; NMR {Chlorobaculum tepidum} PDB: 3ibw_A Back     alignment and structure
>3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} Back     alignment and structure
>2fgc_A Acetolactate synthase, small subunit; regulatory subunit, structural genomics, PSI, protein structure initiative; 2.30A {Thermotoga maritima MSB8} SCOP: d.58.18.6 d.58.18.6 Back     alignment and structure
>2f1f_A Acetolactate synthase isozyme III small subunit; ferredoxin fold, ACT domain, transferase; HET: P33 1PE; 1.75A {Escherichia coli} SCOP: d.58.18.6 d.58.18.6 Back     alignment and structure
>2pc6_A Probable acetolactate synthase isozyme III (small subunit); regulatory subunit, structural genomics, PSI; HET: MSE; 2.50A {Nitrosomonas europaea atcc 19718} SCOP: d.58.18.6 d.58.18.6 Back     alignment and structure
>3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} Back     alignment and structure
>3mtj_A Homoserine dehydrogenase; rossmann-fold, PSI, MCSG, structural genomics, midwest cente structural genomics; 2.15A {Thiobacillus denitrificans} Back     alignment and structure
>1ni5_A Putative cell cycle protein MESJ; structural genomics, ATP, ATPase, PP-type, PSI, protein structure initiative; 2.65A {Escherichia coli} SCOP: b.153.1.2 c.26.2.5 d.229.1.1 Back     alignment and structure
>2der_A TRNA-specific 2-thiouridylase MNMA; protein-RNA complex, transferase/RNA complex; 3.10A {Escherichia coli} PDB: 2det_A 2deu_A* Back     alignment and structure