254780930

254780930

nodulation protein (outer membrane efflux protein)

GeneID in NCBI database:8209951Locus tag:CLIBASIA_04145
Protein GI in NCBI database:254780930Protein Accession:YP_003065343.1
Gene range:-(917027, 918385)Protein Length:452aa
Gene description:nodulation protein (outer membrane efflux protein)
COG prediction:[M] [U] Outer membrane protein
KEGG prediction:nodT; nodulation protein (outer membrane efflux protein)
SEED prediction:RND efflux system, outer membrane lipoprotein CmeC
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450--
MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQLDSDWKIDLFGQRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP
ccHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccHHHHHHcccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHccccccEEEEEEEcccccccccccEEEEEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEEEcccccccccccEEEEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccc
ccccHHHHHHHHHHHcccccccccccccccccHHcccccccccccHHHcccHHHHcccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHccccccccHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEccccccccccccccccccccccccEccEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccc
MNILRAIFSLFIVLLAGctvgpeytkphmpllptqfsignsknlinidtlKWWESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVradlfpssyasishrfipnlktnstgqldsdwkidlfgQRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIesdiptlekSFRMNVHNistllgypateFLHYMQKqsnnfqpnlyipinigipadlirnrpdirYQEKKLADSVAKIGiaksdlypslslngsialthdnsfpgynthwsfgpklylpifdkgkikSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP
MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASIShrfipnlktnstgqldsDWKIDLFGQRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIesdiptleksFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDlsiakrqlaksyVDLYIAIGSGYNP
MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQLDSDWKIDLFGQRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP
****RAIFSLFIVLLAGCTVGPEYTKPHMPLL*****************LKWWESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFP**********************DSDWKIDLFGQRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATEFLH**********PNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIV************SMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN*
MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQLDSDWKIDLFGQRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP
*NILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQLDSDWKIDLFGQRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQ*****FQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLTxxxxxxxxxxxxxxxxxxxxxLFPSSYASISHRFIPNLKTNSTGQLDSDWKIDLFGQRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSxxxxxxxxxxxxxxxxxxxxxFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP
MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQLDSDWKIDLFGQRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP
MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQLDSDWKIDLFGQRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target452 nodulation protein (outer membrane efflux protein) [Can
315122644452 nodulation protein (outer membrane efflux protein) [Can 1 0.0
86359005478 nodulation protein (outer membrane efflux protein) [Rhi 1 1e-103
209550733480 RND efflux system, outer membrane lipoprotein, NodT fam 1 1e-102
190893232478 nodulation protein (outer membrane efflux protein) [Rhi 1 1e-102
58294348479 NodTch [Rhizobium etli] Length = 479 1 1e-102
327188981478 nodulation protein (outer membrane efflux protein) [Rhi 1 1e-102
325293923480 nodulation protein T precursor [Agrobacterium sp. H13-3 1 1e-101
159185264484 nodulation protein T precursor [Agrobacterium tumefacie 1 2e-99
116254733484 nodulation protein NodT [Rhizobium leguminosarum bv. vi 1 1e-98
241206136477 RND efflux system, outer membrane lipoprotein, NodT fam 1 2e-97
>gi|315122644|ref|YP_004063133.1| nodulation protein (outer membrane efflux protein) [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 452 Back     alignment and organism information
 Score =  709 bits (1830), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/452 (74%), Positives = 398/452 (88%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTS 60
           MNIL+  FS+ +VLLAGC VGPEYTKP MP LPTQFSIG S + IN+DTLKWWESFNDT 
Sbjct: 1   MNILKINFSILVVLLAGCAVGPEYTKPQMPRLPTQFSIGKSNSPINVDTLKWWESFNDTC 60

Query: 61  LNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQL 120
           LNKLV IALQQNLTIL+ATERIN+AKENIL+V+ADLFPS   S+S++ +P   TNSTG++
Sbjct: 61  LNKLVNIALQQNLTILKATERINSAKENILAVKADLFPSLQTSVSYQIMPKSDTNSTGRV 120

Query: 121 DSDWKIDLFGQRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQI 180
            SDWKIDLFGQ+R +ES+LAN DS YAQ +IAKL +I+KLI +YIDARHF+ERISIAH+I
Sbjct: 121 HSDWKIDLFGQKRRMESALANFDSVYAQSEIAKLTIIAKLISTYIDARHFQERISIAHKI 180

Query: 181 LDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYP 240
           LDLYK+N++L+ LK  +GA SKL L+KLEAE+KSIES+IP LEK FR+NVHNISTLLG+ 
Sbjct: 181 LDLYKRNLKLTRLKLFEGAISKLPLIKLEAELKSIESEIPNLEKGFRVNVHNISTLLGHS 240

Query: 241 ATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLY 300
           AT+FL Y+QKQ   FQPNLY+ INIGIPADLIRNRPDIRY+EK +ADS+AKIGIAK+DLY
Sbjct: 241 ATDFLAYIQKQKKPFQPNLYMKINIGIPADLIRNRPDIRYREKNIADSIAKIGIAKADLY 300

Query: 301 PSLSLNGSIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQE 360
           P++SLNG I+LTHDN  PGY++ WSFGPKLY+PIFD  KI+SNIRRAES A EQYI WQE
Sbjct: 301 PAISLNGFISLTHDNISPGYHSGWSFGPKLYVPIFDGQKIRSNIRRAESFAHEQYIAWQE 360

Query: 361 TVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERA 420
           TVLNA+KEVE+AL SIN+DKK+VT LQ+ VEL+K++MSLS I+YRQG+YSL+D+LDIE+ 
Sbjct: 361 TVLNAVKEVEDALISINQDKKVVTALQNTVELYKQAMSLSTISYRQGKYSLIDLLDIEKT 420

Query: 421 TAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
           TAK EVDLSIAKRQLAKSYVDLY+AIGSGYNP
Sbjct: 421 TAKAEVDLSIAKRQLAKSYVDLYVAIGSGYNP 452


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|86359005|ref|YP_470897.1| nodulation protein (outer membrane efflux protein) [Rhizobium etli CFN 42] Length = 478 Back     alignment and organism information
>gi|209550733|ref|YP_002282650.1| RND efflux system, outer membrane lipoprotein, NodT family [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 480 Back     alignment and organism information
>gi|190893232|ref|YP_001979774.1| nodulation protein (outer membrane efflux protein) [Rhizobium etli CIAT 652] Length = 478 Back     alignment and organism information
>gi|58294348|gb|AAW70092.1| NodTch [Rhizobium etli] Length = 479 Back     alignment and organism information
>gi|327188981|gb|EGE56170.1| nodulation protein (outer membrane efflux protein) [Rhizobium etli CNPAF512] Length = 478 Back     alignment and organism information
>gi|325293923|ref|YP_004279787.1| nodulation protein T precursor [Agrobacterium sp. H13-3] Length = 480 Back     alignment and organism information
>gi|159185264|ref|NP_355492.2| nodulation protein T precursor [Agrobacterium tumefaciens str. C58] Length = 484 Back     alignment and organism information
>gi|116254733|ref|YP_770569.1| nodulation protein NodT [Rhizobium leguminosarum bv. viciae 3841] Length = 484 Back     alignment and organism information
>gi|241206136|ref|YP_002977232.1| RND efflux system, outer membrane lipoprotein, NodT family [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 477 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target452 nodulation protein (outer membrane efflux protein) [Can
TIGR01845454 TIGR01845, outer_NodT, efflux transporter, outer membra 9e-86
PRK09837461 PRK09837, PRK09837, copper/silver efflux system outer m 2e-29
PRK09915488 PRK09915, PRK09915, putative outer membrane efflux prot 1e-21
COG1538457 COG1538, TolC, Outer membrane protein [Cell envelope bi 1e-61
pfam02321186 pfam02321, OEP, Outer membrane efflux protein 3e-17
pfam02321186 pfam02321, OEP, Outer membrane efflux protein 2e-15
TIGR01844415 TIGR01844, type_I_sec_TolC, type I secretion outer memb 8e-14
PRK11459478 PRK11459, PRK11459, multidrug resistance outer membrane 6e-07
>gnl|CDD|162557 TIGR01845, outer_NodT, efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family Back     alignment and domain information
>gnl|CDD|182103 PRK09837, PRK09837, copper/silver efflux system outer membrane protein CusC; Provisional Back     alignment and domain information
>gnl|CDD|182142 PRK09915, PRK09915, putative outer membrane efflux protein MdtP; Provisional Back     alignment and domain information
>gnl|CDD|31727 COG1538, TolC, Outer membrane protein [Cell envelope biogenesis, outer membrane / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|145461 pfam02321, OEP, Outer membrane efflux protein Back     alignment and domain information
>gnl|CDD|145461 pfam02321, OEP, Outer membrane efflux protein Back     alignment and domain information
>gnl|CDD|162556 TIGR01844, type_I_sec_TolC, type I secretion outer membrane protein, TolC family Back     alignment and domain information
>gnl|CDD|183143 PRK11459, PRK11459, multidrug resistance outer membrane protein MdtQ; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 452 nodulation protein (outer membrane efflux protein) [Can
PRK09837460 copper/silver efflux system outer membrane protein CusC 100.0
PRK09915488 putative outer membrane efflux protein MdtP; Provisiona 100.0
TIGR01845477 outer_NodT efflux transporter, outer membrane factor (O 100.0
PRK11459478 multidrug resistance outer membrane protein MdtQ; Provi 100.0
COG1538457 TolC Outer membrane protein [Cell envelope biogenesis, 100.0
PRK09465446 tolC outer membrane channel protein; Reviewed 100.0
TIGR01844437 type_I_sec_TolC type I secretion outer membrane protein 100.0
pfam02321186 OEP Outer membrane efflux protein. The OEP family (Oute 99.93
PRK09837 460 copper/silver efflux system outer membrane protein CusC 99.79
pfam02321186 OEP Outer membrane efflux protein. The OEP family (Oute 99.89
PRK09465446 tolC outer membrane channel protein; Reviewed 99.85
TIGR01844437 type_I_sec_TolC type I secretion outer membrane protein 99.82
COG1538457 TolC Outer membrane protein [Cell envelope biogenesis, 99.8
TIGR01845477 outer_NodT efflux transporter, outer membrane factor (O 99.66
PRK09915488 putative outer membrane efflux protein MdtP; Provisiona 99.72
PRK11459478 multidrug resistance outer membrane protein MdtQ; Provi 99.66
PRK03598331 hypothetical protein; Provisional 96.87
PRK12698224 flgH flagellar basal body L-ring protein; Reviewed 95.28
PRK12701230 flgH flagellar basal body L-ring protein; Reviewed 95.09
PRK10760357 murein hydrolase B; Provisional 94.29
PRK00249231 flgH flagellar basal body L-ring protein; Reviewed 94.01
PRK12696238 flgH flagellar basal body L-ring protein; Reviewed 93.7
PRK00022203 lolB outer membrane lipoprotein LolB; Provisional 93.33
PRK13616 590 lipoprotein LpqB; Provisional 92.44
PRK12700230 flgH flagellar basal body L-ring protein; Reviewed 92.11
COG3417200 FlgN Collagen-binding surface adhesin SpaP (antigen I/I 91.09
PRK12788231 flgH flagellar basal body L-ring protein; Reviewed 90.94
pfam0647493 MLTD_N MLTD_N. 90.53
COG3065191 Slp Starvation-inducible outer membrane lipoprotein [Ce 90.23
TIGR01843434 type_I_hlyD type I secretion membrane fusion protein, H 96.49
PRK10476348 multidrug resistance protein MdtN; Provisional 96.25
PRK09859385 multidrug efflux system protein MdtE; Provisional 95.71
PRK10476348 multidrug resistance protein MdtN; Provisional 95.54
PRK11556415 multidrug efflux system subunit MdtA; Provisional 95.34
PRK09578385 periplasmic multidrug efflux lipoprotein precursor; Rev 95.13
PRK11578347 macrolide transporter subunit MacA; Provisional 91.31
TIGR01843434 type_I_hlyD type I secretion membrane fusion protein, H 95.53
PRK11023191 hypothetical protein; Provisional 93.59
TIGR03007510 pepcterm_ChnLen polysaccharide chain length determinant 91.93
>PRK09837 copper/silver efflux system outer membrane protein CusC; Provisional Back     alignment and domain information
>PRK09915 putative outer membrane efflux protein MdtP; Provisional Back     alignment and domain information
>TIGR01845 outer_NodT efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family; InterPro: IPR010131 Members of group are outer membrane lipoproteins from the NodT family of the RND (Resistance-Nodulation-cell Division) type efflux systems Back     alignment and domain information
>PRK11459 multidrug resistance outer membrane protein MdtQ; Provisional Back     alignment and domain information
>COG1538 TolC Outer membrane protein [Cell envelope biogenesis, outer membrane / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK09465 tolC outer membrane channel protein; Reviewed Back     alignment and domain information
>TIGR01844 type_I_sec_TolC type I secretion outer membrane protein, TolC family; InterPro: IPR010130 Members of group of are outer membrane proteins from the TolC family within the RND (Resistance-Nodulation-cell Division) efflux systems Back     alignment and domain information
>pfam02321 OEP Outer membrane efflux protein Back     alignment and domain information
>PRK09837 copper/silver efflux system outer membrane protein CusC; Provisional Back     alignment and domain information
>pfam02321 OEP Outer membrane efflux protein Back     alignment and domain information
>PRK09465 tolC outer membrane channel protein; Reviewed Back     alignment and domain information
>TIGR01844 type_I_sec_TolC type I secretion outer membrane protein, TolC family; InterPro: IPR010130 Members of group of are outer membrane proteins from the TolC family within the RND (Resistance-Nodulation-cell Division) efflux systems Back     alignment and domain information
>COG1538 TolC Outer membrane protein [Cell envelope biogenesis, outer membrane / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR01845 outer_NodT efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family; InterPro: IPR010131 Members of group are outer membrane lipoproteins from the NodT family of the RND (Resistance-Nodulation-cell Division) type efflux systems Back     alignment and domain information
>PRK09915 putative outer membrane efflux protein MdtP; Provisional Back     alignment and domain information
>PRK11459 multidrug resistance outer membrane protein MdtQ; Provisional Back     alignment and domain information
>PRK03598 hypothetical protein; Provisional Back     alignment and domain information
>PRK12698 flgH flagellar basal body L-ring protein; Reviewed Back     alignment and domain information
>PRK12701 flgH flagellar basal body L-ring protein; Reviewed Back     alignment and domain information
>PRK10760 murein hydrolase B; Provisional Back     alignment and domain information
>PRK00249 flgH flagellar basal body L-ring protein; Reviewed Back     alignment and domain information
>PRK12696 flgH flagellar basal body L-ring protein; Reviewed Back     alignment and domain information
>PRK00022 lolB outer membrane lipoprotein LolB; Provisional Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>PRK12700 flgH flagellar basal body L-ring protein; Reviewed Back     alignment and domain information
>COG3417 FlgN Collagen-binding surface adhesin SpaP (antigen I/II family) [General function prediction only] Back     alignment and domain information
>PRK12788 flgH flagellar basal body L-ring protein; Reviewed Back     alignment and domain information
>pfam06474 MLTD_N MLTD_N Back     alignment and domain information
>COG3065 Slp Starvation-inducible outer membrane lipoprotein [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family; InterPro: IPR010129 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>PRK10476 multidrug resistance protein MdtN; Provisional Back     alignment and domain information
>PRK09859 multidrug efflux system protein MdtE; Provisional Back     alignment and domain information
>PRK10476 multidrug resistance protein MdtN; Provisional Back     alignment and domain information
>PRK11556 multidrug efflux system subunit MdtA; Provisional Back     alignment and domain information
>PRK09578 periplasmic multidrug efflux lipoprotein precursor; Reviewed Back     alignment and domain information
>PRK11578 macrolide transporter subunit MacA; Provisional Back     alignment and domain information
>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family; InterPro: IPR010129 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>PRK11023 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily; InterPro: IPR014345 Members of this entry belong to the family of polysaccharide chain length determinant proteins Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target452 nodulation protein (outer membrane efflux protein) [Can
1wp1_A474 Crystal Structure Of The Drug-Discharge Outer Membr 1e-49
3d5k_A474 Crystal Structure Of The Oprm Channel In A Non-Symm 3e-48
3pik_A446 Outer Membrane Protein Cusc Length = 446 1e-39
1yc9_A442 The Crystal Structure Of The Outer Membrane Protein 2e-30
1ek9_A428 2.1a X-Ray Structure Of Tolc: An Integral Outer Mem 4e-23
1tqq_A471 Structure Of Tolc In Complex With Hexamminecobalt L 4e-23
2wmz_A428 Structure Of A Mutated Tolc Length = 428 5e-23
2xmn_A428 High Resolution Snapshots Of Defined Tolc Open Stat 1e-22
2vdd_A460 Crystal Structure Of The Open State Of Tolc Outer M 2e-22
>gi|56554391|pdb|1WP1|A Chain A, Crystal Structure Of The Drug-Discharge Outer Membrane Protein, Oprm Length = 474 Back     alignment and structure
 Score =  202 bits (513), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 97/455 (21%), Positives = 189/455 (41%), Gaps = 25/455 (5%)

Query: 18  CTVGPEYTKPHMPLLPTQ-----FSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQN 72
           C++ P+Y +P  P+         +        +    + W E F D  L +L+ +AL+ N
Sbjct: 1   CSLIPDYQRPEAPVAAAYPQGQAYGQNTGAAAVPAADIGWREFFRDPQLQQLIGVALENN 60

Query: 73  LTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQLDS---------- 122
             +  A   + A +      RADLFP      S          ST    +          
Sbjct: 61  RDLRVAALNVEAFRAQYRIQRADLFPRIGVDGSGTRQRLPGDLSTTGSPAISSQYGVTLG 120

Query: 123 --DWKIDLFGQRRHIE-SSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQ 179
              W++DLFG+ R +   +L    +       A+  +++ +  +Y+  +  + ++ +   
Sbjct: 121 TTAWELDLFGRLRSLRDQALEQYLATEQAQRSAQTTLVASVATAYLTLKADQAQLQLTKD 180

Query: 180 ILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGY 239
            L  Y+K+ +L+   +  G  S L L + +  ++   + +    +    + + +  LLG 
Sbjct: 181 TLGTYQKSFDLTQRSYDVGVASALDLRQAQTAVEGARATLAQYTRLVAQDQNALVLLLG- 239

Query: 240 PATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDL 299
                +     Q       L   +  G+P+DL++ RPDI   E +L  + A IG A++  
Sbjct: 240 ---SGIPANLPQGLGLDQTLLTEVPAGLPSDLLQRRPDILEAEHQLMAANASIGAARAAF 296

Query: 300 YPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYI 356
           +PS+SL  +           F   +  W F P + LPIF  G +++++  A+        
Sbjct: 297 FPSISLTANAGTMSRQLSGLFDAGSGSWLFQPSINLPIFTAGSLRASLDYAKIQKDINVA 356

Query: 357 TWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILD 416
            +++ +  A +EV + L +     + +   +  V+   +   L+   YR G  + L +LD
Sbjct: 357 QYEKAIQTAFQEVADGLAARGTFTEQLQAQRDLVKASDEYYQLADKRYRTGVDNYLTLLD 416

Query: 417 IERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
            +R+    +  L   +     S V+LY A+G G+N
Sbjct: 417 AQRSLFTAQQQLITDRLNQLTSEVNLYKALGGGWN 451


>gi|238828134|pdb|3D5K|A Chain A, Crystal Structure Of The Oprm Channel In A Non-Symmetrical Space Group Length = 474 Back     alignment and structure
>gi|321159981|pdb|3PIK|A Chain A, Outer Membrane Protein Cusc Length = 446 Back     alignment and structure
>gi|61680586|pdb|1YC9|A Chain A, The Crystal Structure Of The Outer Membrane Protein Vcec From The Bacterial Pathogen Vibrio Cholerae At 1.8 Resolution Length = 442 Back     alignment and structure
>gi|9256952|pdb|1EK9|A Chain A, 2.1a X-Ray Structure Of Tolc: An Integral Outer Membrane Protein And Efflux Pump Component From Escherichia Coli Length = 428 Back     alignment and structure
>gi|51247720|pdb|1TQQ|A Chain A, Structure Of Tolc In Complex With Hexamminecobalt Length = 471 Back     alignment and structure
>gi|320089665|pdb|2WMZ|A Chain A, Structure Of A Mutated Tolc Length = 428 Back     alignment and structure
>gi|320089697|pdb|2XMN|A Chain A, High Resolution Snapshots Of Defined Tolc Open States Present An Iris-Like Movement Of Periplasmic Entrance Helices Length = 428 Back     alignment and structure
>gi|185177612|pdb|2VDD|A Chain A, Crystal Structure Of The Open State Of Tolc Outer Membrane Component Of Mutlidrug Efflux Pumps Length = 460 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target452 nodulation protein (outer membrane efflux protein) [Can
3d5k_A474 OPRM, outer membrane protein OPRM; channel, beta-alpha- 2e-46
1ek9_A428 Outer membrane protein TOLC; integral membrane protein, 6e-45
1yc9_A442 VCEC, multidrug resistance protein; outer membrane prot 2e-36
>3d5k_A OPRM, outer membrane protein OPRM; channel, beta-alpha-barrel, antibiotic resistance, lipoprotein, palmitate, transmembrane, transport; 2.40A {Pseudomonas aeruginosa} PDB: 1wp1_A Length = 474 Back     alignment and structure
 Score =  182 bits (461), Expect = 2e-46
 Identities = 96/457 (21%), Positives = 190/457 (41%), Gaps = 27/457 (5%)

Query: 18  CTVGPEYTKPHMPLLPTQFSIG------NSKNLINIDTLKWWESFNDTSLNKLVKIALQQ 71
           C++ P+Y +P  P+    +  G           +    + W E F D  L +L+ +AL+ 
Sbjct: 1   CSLIPDYQRPEAPV-AAAYPQGQAYGQNTGAAAVPAADIGWREFFRDPQLQQLIGVALEN 59

Query: 72  NLTILQATERINAAKENILSVRADLFPSSYASISH---RFIPNLKTNSTGQLDSDWKIDL 128
           N  +  A   + A +      RADLFP      S    R   +L T  +  + S + + L
Sbjct: 60  NRDLRVAALNVEAFRAQYRIQRADLFPRIGVDGSGTRQRLPGDLSTTGSPAISSQYGVTL 119

Query: 129 ----------FGQRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAH 178
                        R   + +L    +       A+  +++ +  +Y+  +  + ++ +  
Sbjct: 120 GTTAWELDLFGRLRSLRDQALEQYLATEQAQRSAQTTLVASVATAYLTLKADQAQLQLTK 179

Query: 179 QILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLG 238
             L  Y+K+ +L+   +  G  S L L + +  ++   + +    +    + + +  LLG
Sbjct: 180 DTLGTYQKSFDLTQRSYDVGVASALDLRQAQTAVEGARATLAQYTRLVAQDQNALVLLLG 239

Query: 239 YPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSD 298
                 L                 +  G+P+DL++ RPDI   E +L  + A IG A++ 
Sbjct: 240 SGIPANLPQGLGLDQTLLT----EVPAGLPSDLLQRRPDILEAEHQLMAANASIGAARAA 295

Query: 299 LYPSLSLN---GSIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQY 355
            +PS+SL    G+++      F   +  W F P + LPIF  G +++++  A+       
Sbjct: 296 FFPSISLTANAGTMSRQLSGLFDAGSGSWLFQPSINLPIFTAGSLRASLDYAKIQKDINV 355

Query: 356 ITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDIL 415
             +++ +  A +EV + L +     + +   +  V+   +   L+   YR G  + L +L
Sbjct: 356 AQYEKAIQTAFQEVADGLAARGTFTEQLQAQRDLVKASDEYYQLADKRYRTGVDNYLTLL 415

Query: 416 DIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
           D +R+    +  L   +     S V+LY A+G G+N 
Sbjct: 416 DAQRSLFTAQQQLITDRLNQLTSEVNLYKALGGGWNQ 452


>1ek9_A Outer membrane protein TOLC; integral membrane protein, alpha helical barrel, beta barrel; 2.10A {Escherichia coli} SCOP: f.5.1.1 PDB: 1tqq_A 2vde_A 2vdd_A Length = 428 Back     alignment and structure
>1yc9_A VCEC, multidrug resistance protein; outer membrane protein; HET: BOG; 1.80A {Vibrio cholerae} Length = 442 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target452 nodulation protein (outer membrane efflux protein) [Can
3d5k_A474 OPRM, outer membrane protein OPRM; channel, beta-alpha- 100.0
1yc9_A442 VCEC, multidrug resistance protein; outer membrane prot 100.0
1ek9_A428 Outer membrane protein TOLC; integral membrane protein, 100.0
1ek9_A428 Outer membrane protein TOLC; integral membrane protein, 99.83
3d5k_A474 OPRM, outer membrane protein OPRM; channel, beta-alpha- 99.75
1yc9_A 442 VCEC, multidrug resistance protein; outer membrane prot 99.8
>3d5k_A OPRM, outer membrane protein OPRM; channel, beta-alpha-barrel, antibiotic resistance, lipoprotein, palmitate, transmembrane, transport; 2.40A {Pseudomonas aeruginosa} PDB: 1wp1_A Back     alignment and structure
Probab=100.00  E-value=0  Score=456.88  Aligned_cols=431  Identities=22%  Similarity=0.385  Sum_probs=374.0

Q ss_pred             HCCCCCCCCCCCCCCCCCCC-----CCCCCCCCCCCCHHHHHHHCCHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             02689999999564750102-----4677666676862343660998799999999970899899999999999999987
Q gi|254780930|r   18 CTVGPEYTKPHMPLLPTQFS-----IGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSV   92 (452)
Q Consensus        18 C~~~p~~~~p~~~~~~~~~~-----~~~~~~~~~~~~~~ww~~~~d~~L~~~i~~Al~~np~l~~a~~~i~~a~~~~~~a   92 (452)
                      |++.|++.+|+.|+.+....     .....+..+.....||..|+||||+++|+.|++|||+|++++.+++++++++..+
T Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~w~~~~~d~tL~~~I~~Al~nnp~l~~a~~~i~~a~~~~~~a   80 (474)
T 3d5k_A            1 CSLIPDYQRPEAPVAAAYPQGQAYGQNTGAAAVPAADIGWREFFRDPQLQQLIGVALENNRDLRVAALNVEAFRAQYRIQ   80 (474)
T ss_dssp             CCCCCCCCCCCCCSCSSCCCSTTCCCCCCSCSSCTTTSCHHHHBCCHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999979998665666655455677656776653699865988899999999970999999999999999999997


Q ss_pred             HHHHCCCHHHCCCCCCCCCCC---------CCC---CCCCCCCCCCCHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             542053011101124566555---------444---443211101100123457-7888877765556799999999999
Q gi|254780930|r   93 RADLFPSSYASISHRFIPNLK---------TNS---TGQLDSDWKIDLFGQRRH-IESSLANLDSAYAQVDIAKLNVISK  159 (452)
Q Consensus        93 ~a~~~P~~~~~~~~~~~~~~~---------~~~---~~~~~~s~~ldl~G~~~~-~~~a~~~~~~~~~~~~~~~~~l~~~  159 (452)
                      ++.++|++++++++.+.....         ...   .......|++++||++.. ++.+....+.++..++.++.+++.+
T Consensus        81 ~a~~~P~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~a~~~~~~~~~~~~~~~~~l~~~  160 (474)
T 3d5k_A           81 RADLFPRIGVDGSGTRQRLPGDLSTTGSPAISSQYGVTLGTTAWELDLFGRLRSLRDQALEQYLATEQAQRSAQTTLVAS  160 (474)
T ss_dssp             HHTTSCCEEEEEEEEEEEECTTTSSSSSCEEEEEEEEEEEEEEEEECTTSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHCCCCCEEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCEEEEEHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             43408804676334311467655678887765431112342122005200020499999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             99876666777889999999999999999878765543234567776532223557989999998568888768776399
Q gi|254780930|r  160 LIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGY  239 (452)
Q Consensus       160 v~~aY~~~~~~~~~~~i~~~~~~~~~~~~~~~~~r~~~G~~~~~d~~~a~~~~~~~~~~l~~~~~~~~~a~~~L~~l~G~  239 (452)
                      +.++||+++.+++.+++.++.++..++.++.++.+++.|.++..|+.+++..+..++..+..++.++..++..|..++|.
T Consensus       161 v~~aY~~~~~~~~~l~i~~~~~~~~~~~~~~~~~r~~~G~~~~~d~~~a~~~l~~~~~~l~~a~~~l~~a~~~L~~llg~  240 (474)
T 3d5k_A          161 VATAYLTLKADQAQLQLTKDTLGTYQKSFDLTQRSYDVGVASALDLRQAQTAVEGARATLAQYTRLVAQDQNALVLLLGS  240 (474)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTSSCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTS
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             99999999999999999999999999999999999986886087899999998877789999999999999999998389


Q ss_pred             CHHHHCCCCCCCCCCCCCCHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHCCCCCCCCCCCCC---C
Q ss_conf             9213000123455443310012210488789973023455655589999643010112222100112222112234---4
Q gi|254780930|r  240 PATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHDN---S  316 (452)
Q Consensus       240 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~RPdi~~a~~~~~~a~~~i~~a~a~~~P~i~l~~~~~~~~~~---~  316 (452)
                      ++...........    +......+..+...++.+||||+.++..++.++.+++.+++.++|+|++++++++...+   .
T Consensus       241 ~~~~~~~~~~~~~----~~~~~~~~~~~~~~a~~~~p~l~~~~~~~~~a~~~~~~ak~~~~P~l~l~~~~~~~~~~~~~~  316 (474)
T 3d5k_A          241 GIPANLPQGLGLD----QTLLTEVPAGLPSDLLQRRPDILEAEHQLMAANASIGAARAAFFPSISLTANAGTMSRQLSGL  316 (474)
T ss_dssp             CCCTTCCCCCCTT----SCCBCCCCCCCGGGHHHHCHHHHHHHHHHHHHHHHHHHHHTTSSCEEEEEEEEEEEESSSTTS
T ss_pred             CCCCCCCCCCCCC----CCCCCCCCHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEEECCCCCCCCCC
T ss_conf             9863211111112----246877853669999973879999999999999999998885379556897522345654334


Q ss_pred             CCCCCCEEEEECCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             54454104431122345101245665677999999999999999999999999999999999999999999999999999
Q gi|254780930|r  317 FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKS  396 (452)
Q Consensus       317 ~~~~~~~~~~g~~l~~Pif~gg~~~a~i~~a~~~~~~a~~~~~~~~~~a~~ev~~a~~~~~~~~~~~~~~~~~~~~a~~~  396 (452)
                      +......|.+|++++||||+||+++++++.++++.+++..+++++++++..+|++++.++....+++..+++.++.+++.
T Consensus       317 ~~~~~~~~~~g~~ls~plf~~~~~~~~~~~a~~~~~~a~~~~~~~~~~~~~ev~~a~~~~~~~~~~~~~~~~~~~~a~~~  396 (474)
T 3d5k_A          317 FDAGSGSWLFQPSINLPIFTAGSLRASLDYAKIQKDINVAQYEKAIQTAFQEVADGLAARGTFTEQLQAQRDLVKASDEY  396 (474)
T ss_dssp             SSTTCEEEEEEEEEEEEEECSSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCCCCCCEEEEEEEECCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             56765540132343011122220222799999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCC
Q ss_conf             99999998718832899999999999999999999999999999999984999998
Q gi|254780930|r  397 MSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP  452 (452)
Q Consensus       397 ~~~~~~~y~~G~~~~~dll~a~~~~~~a~~~~~~a~~~~~~a~~~L~~AlGGg~~~  452 (452)
                      ++.++.+|+.|.++++||+++++++++++.++++++++++.+.++|++|+||||+|
T Consensus       397 l~~~~~~y~~G~~s~~dll~A~~~l~~a~~~~~~a~~~~~~a~~~L~~AlGG~~~~  452 (474)
T 3d5k_A          397 YQLADKRYRTGVDNYLTLLDAQRSLFTAQQQLITDRLNQLTSEVNLYKALGGGWNQ  452 (474)
T ss_dssp             HHHHHHHHHTTSSCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTCSCCS
T ss_pred             HHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCC
T ss_conf             99999999869960999999999999999999999999999999999970799999



>1yc9_A VCEC, multidrug resistance protein; outer membrane protein; HET: BOG; 1.80A {Vibrio cholerae} Back     alignment and structure
>1ek9_A Outer membrane protein TOLC; integral membrane protein, alpha helical barrel, beta barrel; 2.10A {Escherichia coli} SCOP: f.5.1.1 PDB: 1tqq_A 2vde_A 2vdd_A Back     alignment and structure
>1ek9_A Outer membrane protein TOLC; integral membrane protein, alpha helical barrel, beta barrel; 2.10A {Escherichia coli} SCOP: f.5.1.1 PDB: 1tqq_A 2vde_A 2vdd_A Back     alignment and structure
>3d5k_A OPRM, outer membrane protein OPRM; channel, beta-alpha-barrel, antibiotic resistance, lipoprotein, palmitate, transmembrane, transport; 2.40A {Pseudomonas aeruginosa} PDB: 1wp1_A Back     alignment and structure
>1yc9_A VCEC, multidrug resistance protein; outer membrane protein; HET: BOG; 1.80A {Vibrio cholerae} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 452 nodulation protein (outer membrane efflux protein) [Can
d1wp1a_456 f.5.1.1 (A:) Outer membrane protein OprM {Pseudomonas a 6e-45
d1ek9a_428 f.5.1.1 (A:) Integral outer membrane protein TolC, effl 2e-28
>d1wp1a_ f.5.1.1 (A:) Outer membrane protein OprM {Pseudomonas aeruginosa [TaxId: 287]} Length = 456 Back     information, alignment and structure

class: Membrane and cell surface proteins and peptides
fold: Outer membrane efflux proteins (OEP)
superfamily: Outer membrane efflux proteins (OEP)
family: Outer membrane efflux proteins (OEP)
domain: Outer membrane protein OprM
species: Pseudomonas aeruginosa [TaxId: 287]
 Score =  175 bits (444), Expect = 6e-45
 Identities = 98/457 (21%), Positives = 192/457 (42%), Gaps = 27/457 (5%)

Query: 18  CTVGPEYTKPHMPLLPTQFSIG------NSKNLINIDTLKWWESFNDTSLNKLVKIALQQ 71
           C++ P+Y +P  P+    +  G           +    + W E F D  L +L+ +AL+ 
Sbjct: 1   CSLIPDYQRPEAPV-AAAYPQGQAYGQNTGAAAVPAADIGWREFFRDPQLQQLIGVALEN 59

Query: 72  NLTILQATERINAAKENILSVRADLFPSSYASISH---RFIPNLKTNSTGQLDSDWKIDL 128
           N  +  A   + A +      RADLFP      S    R   +L T  +  + S + + L
Sbjct: 60  NRDLRVAALNVEAFRAQYRIQRADLFPRIGVDGSGTRQRLPGDLSTTGSPAISSQYGVTL 119

Query: 129 ----------FGQRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAH 178
                        R   + +L    +       A+  +++ +  +Y+  +  + ++ +  
Sbjct: 120 GTTAWELDLFGRLRSLRDQALEQYLATEQAQRSAQTTLVASVATAYLTLKADQAQLQLTK 179

Query: 179 QILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLG 238
             L  Y+K+ +L+   +  G  S L L + +  ++   + +    +    + + +  LLG
Sbjct: 180 DTLGTYQKSFDLTQRSYDVGVASALDLRQAQTAVEGARATLAQYTRLVAQDQNALVLLLG 239

Query: 239 YPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSD 298
                 L     Q       L   +  G+P+DL++ RPDI   E +L  + A IG A++ 
Sbjct: 240 SGIPANL----PQGLGLDQTLLTEVPAGLPSDLLQRRPDILEAEHQLMAANASIGAARAA 295

Query: 299 LYPSLSLN---GSIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQY 355
            +PS+SL    G+++      F   +  W F P + LPIF  G +++++  A+       
Sbjct: 296 FFPSISLTANAGTMSRQLSGLFDAGSGSWLFQPSINLPIFTAGSLRASLDYAKIQKDINV 355

Query: 356 ITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDIL 415
             +++ +  A +EV + L +     + +   +  V+   +   L+   YR G  + L +L
Sbjct: 356 AQYEKAIQTAFQEVADGLAARGTFTEQLQAQRDLVKASDEYYQLADKRYRTGVDNYLTLL 415

Query: 416 DIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
           D +R+    +  L   +     S V+LY A+G G+N 
Sbjct: 416 DAQRSLFTAQQQLITDRLNQLTSEVNLYKALGGGWNQ 452


>d1ek9a_ f.5.1.1 (A:) Integral outer membrane protein TolC, efflux pump component {Escherichia coli [TaxId: 562]} Length = 428 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target452 nodulation protein (outer membrane efflux protein) [Can
d1wp1a_456 Outer membrane protein OprM {Pseudomonas aeruginosa [Ta 100.0
d1ek9a_428 Integral outer membrane protein TolC, efflux pump compo 100.0
d1ek9a_428 Integral outer membrane protein TolC, efflux pump compo 99.81
d1wp1a_ 456 Outer membrane protein OprM {Pseudomonas aeruginosa [Ta 99.77
>d1wp1a_ f.5.1.1 (A:) Outer membrane protein OprM {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: Outer membrane efflux proteins (OEP)
superfamily: Outer membrane efflux proteins (OEP)
family: Outer membrane efflux proteins (OEP)
domain: Outer membrane protein OprM
species: Pseudomonas aeruginosa [TaxId: 287]
Probab=100.00  E-value=0  Score=454.75  Aligned_cols=430  Identities=22%  Similarity=0.384  Sum_probs=374.9

Q ss_pred             HCCCCCCCCCCCCCCCCCCCCCC-----CCCCCCCCCHHHHHHHCCHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             02689999999564750102467-----7666676862343660998799999999970899899999999999999987
Q gi|254780930|r   18 CTVGPEYTKPHMPLLPTQFSIGN-----SKNLINIDTLKWWESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSV   92 (452)
Q Consensus        18 C~~~p~~~~p~~~~~~~~~~~~~-----~~~~~~~~~~~ww~~~~d~~L~~~i~~Al~~np~l~~a~~~i~~a~~~~~~a   92 (452)
                      |++.|++.+|..|+.+.......     ..+..++...+||..|+||||+++|++|++|||+|++++.+++++++++..+
T Consensus         1 ~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~w~~~~~d~tL~~~i~~Al~nnp~l~~a~~~~~~a~~~~~~a   80 (456)
T d1wp1a_           1 CSLIPDYQRPEAPVAAAYPQGQAYGQNTGAAAVPAADIGWREFFRDPQLQQLIGVALENNRDLRVAALNVEAFRAQYRIQ   80 (456)
T ss_dssp             CCCCCCCCCCCCCSCSSCCCSTTCCCCCCSCSSCGGGSCHHHHBCCHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999979998765666655455677656765652599865988899999999970999999999999999999997


Q ss_pred             HHHHCCCHHHCCCCCCCCCCCC---------CC---CCCCCCCCCCCHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             5420530111011245665554---------44---443211101100123457-7888877765556799999999999
Q gi|254780930|r   93 RADLFPSSYASISHRFIPNLKT---------NS---TGQLDSDWKIDLFGQRRH-IESSLANLDSAYAQVDIAKLNVISK  159 (452)
Q Consensus        93 ~a~~~P~~~~~~~~~~~~~~~~---------~~---~~~~~~s~~ldl~G~~~~-~~~a~~~~~~~~~~~~~~~~~l~~~  159 (452)
                      ++.++|++++++++.+......         ..   .......|.+++||++.. ++.+....+.++..+..++.+++.+
T Consensus        81 ~a~~~P~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~g~~~~~~~~a~~~~~~~~~~~~~~~~~l~~~  160 (456)
T d1wp1a_          81 RADLFPRIGVDGSGTRQRLPGDLSTTGSPAISSQYGVTLGTTAWELDLFGRLRSLRDQALEQYLATEQAQRSAQTTLVAS  160 (456)
T ss_dssp             HHTTSCCCBCCCBCCCCBCCTTTSSSSSCCBCCCEEEECBEEEEECCTTCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHCCCCEEEEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             42408805786223320366655678887766432112220112334335677788888888888899999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             99876666777889999999999999999878765543234567776532223557989999998568888768776399
Q gi|254780930|r  160 LIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGY  239 (452)
Q Consensus       160 v~~aY~~~~~~~~~~~i~~~~~~~~~~~~~~~~~r~~~G~~~~~d~~~a~~~~~~~~~~l~~~~~~~~~a~~~L~~l~G~  239 (452)
                      |.++||+++.+++.+++.++.++.+++.++.++.+++.|.++..|+.+++.++...+..+..++.++..++..|..++|.
T Consensus       161 v~~aY~~~~~a~~~~~~~~~~~~~~~~~~~~~~~r~~~G~~~~~d~~~a~~~l~~~~~~l~~~~~~~~~a~~~L~~llg~  240 (456)
T d1wp1a_         161 VATAYLTLKADQAQLQLTKDTLGTYQKSFDLTQRSYDVGVASALDLRQAQTAVEGARATLAQYTRLVAQDQNALVLLLGS  240 (456)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCSCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTS
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             99999999998777899999999999999999888637852010004788999999889999999999999999998289


Q ss_pred             CHHHHCCCCCCCCCCCCCCHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHCCCCCCCCCCCCC---C
Q ss_conf             9213000123455443310012210488789973023455655589999643010112222100112222112234---4
Q gi|254780930|r  240 PATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHDN---S  316 (452)
Q Consensus       240 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~RPdi~~a~~~~~~a~~~i~~a~a~~~P~i~l~~~~~~~~~~---~  316 (452)
                      ++............    ....+.+..+...++.+||||++++..+++++..++.+++.++|+|++++++++...+   .
T Consensus       241 ~~~~~~~~~~~~~~----~~~~~~~~~~~~~a~~~~pdl~~~~~~~~~a~~~~~~a~~~~~P~l~l~~~~~~~~~~~~~~  316 (456)
T d1wp1a_         241 GIPANLPQGLGLDQ----TLLTEVPAGLPSDLLQRRPDILEAEHQLMAANASIGAARAAFFPSISLTANAGTMSRQLSGL  316 (456)
T ss_dssp             CCCSSCCCCCCTTS----CCBCCCCCCCTTHHHHHCHHHHHHHHHHHHHHHHHHHHHHTTSCCCEEEECCEEEESSGGGT
T ss_pred             CCCCCCCCCCCCCC----CCCCCCCHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCC
T ss_conf             97532100124211----36877854679999985100267899999889999999975301321000034454456644


Q ss_pred             CCCCCCEEEEECCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             54454104431122345101245665677999999999999999999999999999999999999999999999999999
Q gi|254780930|r  317 FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKS  396 (452)
Q Consensus       317 ~~~~~~~~~~g~~l~~Pif~gg~~~a~i~~a~~~~~~a~~~~~~~~~~a~~ev~~a~~~~~~~~~~~~~~~~~~~~a~~~  396 (452)
                      +......|.+|++++||||+||+++++++.++++.+++..+++++.+++..+|++++.++..+.+++...++.++.+++.
T Consensus       317 ~~~~~~~~~~g~~~~~pl~~g~~~~~~~~~a~~~~~~a~~~~~~~~~~i~~~v~~~~~~~~~~~~~l~~~~~~~~~a~~~  396 (456)
T d1wp1a_         317 FDAGSGSWLFQPSINLPIFTAGSLRASLDYAKIQKDINVAQYEKAIQTAFQEVADGLAARGTFTEQLQAQRDLVKASDEY  396 (456)
T ss_dssp             TSTTCEECCEEECCCCCCCCSSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTHHHHHHHHHHHHHHHHHH
T ss_pred             CCCCCCCCCCCCCCCCCCHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             45665432213011232000000111256899999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             9999999871883289999999999999999999999999999999998499999
Q gi|254780930|r  397 MSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN  451 (452)
Q Consensus       397 ~~~~~~~y~~G~~~~~dll~a~~~~~~a~~~~~~a~~~~~~a~~~L~~AlGGg~~  451 (452)
                      ++..+.+|+.|.++++||+++++++++++.+++++++++..+.++|++|+||||+
T Consensus       397 ~~~~~~~y~~G~~s~~dll~a~~~l~~a~~~~~~a~~~~~~a~~~L~~alGg~~~  451 (456)
T d1wp1a_         397 YQLADKRYRTGVDNYLTLLDAQRSLFTAQQQLITDRLNQLTSEVNLYKALGGGWN  451 (456)
T ss_dssp             HHHHHHHHHTTSSCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTCSCC
T ss_pred             HHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCC
T ss_conf             9999999987996199999999999999999999999999999999998379998



>d1ek9a_ f.5.1.1 (A:) Integral outer membrane protein TolC, efflux pump component {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ek9a_ f.5.1.1 (A:) Integral outer membrane protein TolC, efflux pump component {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wp1a_ f.5.1.1 (A:) Outer membrane protein OprM {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 452 nodulation protein (outer membrane efflux protein)
1yc9_A_1-69_115-283238 (A:1-69,A:115-283) VCEC, multidrug resistance prot 1e-25
3d5k_A_44-85_128-296211 (A:44-85,A:128-296) OPRM, outer membrane protein O 5e-24
1yc9_A_323-442120 (A:323-442) VCEC, multidrug resistance protein; ou 1e-17
1ek9_A_203-243_295-406153 (A:203-243,A:295-406) Outer membrane protein TOLC; 5e-16
3d5k_A_336-449114 (A:336-449) OPRM, outer membrane protein OPRM; cha 5e-16
1ek9_A_1-34_78-202_407-428181 (A:1-34,A:78-202,A:407-428) Outer membrane protein 1e-12
1yc9_A_70-114_284-32284 (A:70-114,A:284-322) VCEC, multidrug resistance pr 8e-05
3d5k_A_86-127_297-33581 (A:86-127,A:297-335) OPRM, outer membrane protein 0.001
>1yc9_A (A:1-69,A:115-283) VCEC, multidrug resistance protein; outer membrane protein; HET: BOG; 1.80A {Vibrio cholerae}Length = 238 Back     alignment and structure
 Score =  111 bits (279), Expect = 1e-25
 Identities = 41/249 (16%), Positives = 97/249 (38%), Gaps = 37/249 (14%)

Query: 52  WWESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPN 111
           WW+ + D  LN L++ ALQ + ++  A  R+  A+       A                 
Sbjct: 26  WWQRYQDAQLNHLIEEALQHSPSLCMAMARLKGAQGFARQAGA----------------- 68

Query: 112 LKTNSTGQLDSDWKIDLFGQRRH-IESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHF 170
                           ++G+ R  + ++ + L +A A+   A+L + + +  +Y +    
Sbjct: 69  ----------------IWGKNRAAVVAATSELAAAEAESVAARLMISTSIANAYAELARL 112

Query: 171 KERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNV 230
                  H  L +  K +EL   ++  G  +  S+ + +A   S+E+++  +++S ++  
Sbjct: 113 YANQETVHAALQVRNKTVELLEKRYANGLETLGSVSQAKAVAASVEAELLGIQESIQLQK 172

Query: 231 HNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVA 290
           + ++ L+G            +  +        +       L+ +R DI     +   +  
Sbjct: 173 NALAALVGQGPDRAA---SIEEPHITLTSRYGLPSEAGVGLLGHRADITAARWRAEAAAQ 229

Query: 291 KIGIAKSDL 299
           ++GIA++  
Sbjct: 230 QVGIAQAQF 238


>3d5k_A (A:44-85,A:128-296) OPRM, outer membrane protein OPRM; channel, beta-alpha-barrel, antibiotic resistance, lipoprotein, palmitate, transmembrane, transport; 2.40A {Pseudomonas aeruginosa} PDB: 1wp1_ALength = 211 Back     alignment and structure
>1yc9_A (A:323-442) VCEC, multidrug resistance protein; outer membrane protein; HET: BOG; 1.80A {Vibrio cholerae}Length = 120 Back     alignment and structure
>1ek9_A (A:203-243,A:295-406) Outer membrane protein TOLC; integral membrane protein, alpha helical barrel, beta barrel; 2.10A {Escherichia coli}Length = 153 Back     alignment and structure
>3d5k_A (A:336-449) OPRM, outer membrane protein OPRM; channel, beta-alpha-barrel, antibiotic resistance, lipoprotein, palmitate, transmembrane, transport; 2.40A {Pseudomonas aeruginosa} PDB: 1wp1_ALength = 114 Back     alignment and structure
>1ek9_A (A:1-34,A:78-202,A:407-428) Outer membrane protein TOLC; integral membrane protein, alpha helical barrel, beta barrel; 2.10A {Escherichia coli}Length = 181 Back     alignment and structure
>1yc9_A (A:70-114,A:284-322) VCEC, multidrug resistance protein; outer membrane protein; HET: BOG; 1.80A {Vibrio cholerae}Length = 84 Back     alignment and structure
>3d5k_A (A:86-127,A:297-335) OPRM, outer membrane protein OPRM; channel, beta-alpha-barrel, antibiotic resistance, lipoprotein, palmitate, transmembrane, transport; 2.40A {Pseudomonas aeruginosa} PDB: 1wp1_ALength = 81 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target452 nodulation protein (outer membrane efflux protein) [Can
1yc9_A_1-69_115-283238 VCEC, multidrug resistance protein; outer membrane 99.97
3d5k_A_44-85_128-296211 OPRM, outer membrane protein OPRM; channel, beta-a 99.93
1ek9_A_1-34_78-202_407-428181 Outer membrane protein TOLC; integral membrane pro 99.65
1yc9_A_323-442120 VCEC, multidrug resistance protein; outer membrane 99.73
3d5k_A_336-449114 OPRM, outer membrane protein OPRM; channel, beta-a 99.67
1ek9_A_203-243_295-406153 Outer membrane protein TOLC; integral membrane pro 99.62
1ek9_A_1-34_78-202_407-428181 Outer membrane protein TOLC; integral membrane pro 98.98
1yc9_A_1-69_115-283238 VCEC, multidrug resistance protein; outer membrane 99.33
3d5k_A_44-85_128-296211 OPRM, outer membrane protein OPRM; channel, beta-a 99.32
1ek9_A_203-243_295-406153 Outer membrane protein TOLC; integral membrane pro 99.2
1yc9_A_323-442120 VCEC, multidrug resistance protein; outer membrane 99.15
3d5k_A_336-449114 OPRM, outer membrane protein OPRM; channel, beta-a 99.14
1yc9_A_70-114_284-32284 VCEC, multidrug resistance protein; outer membrane 97.25
3d5k_A_86-127_297-33581 OPRM, outer membrane protein OPRM; channel, beta-a 96.81
>1yc9_A (A:1-69,A:115-283) VCEC, multidrug resistance protein; outer membrane protein; HET: BOG; 1.80A {Vibrio cholerae} Back     alignment and structure
Probab=99.97  E-value=2.1e-28  Score=202.94  Aligned_cols=219  Identities=19%  Similarity=0.339  Sum_probs=193.8

Q ss_pred             CCCCCHHHHHHHCCHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             67686234366099879999999997089989999999999999998754205301110112456655544444321110
Q gi|254780930|r   45 INIDTLKWWESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQLDSDW  124 (452)
Q Consensus        45 ~~~~~~~ww~~~~d~~L~~~i~~Al~~np~l~~a~~~i~~a~~~~~~a~a~~~P~~~~~~~~~~~~~~~~~~~~~~~~s~  124 (452)
                      ..++..+||+.|+||.|+.+|+.|+.+||+|.+|..+++.|++....+++                              
T Consensus        19 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~------------------------------   68 (238)
T 1yc9_A           19 MDWPSANWWQRYQDAQLNHLIEEALQHSPSLCMAMARLKGAQGFARQAGA------------------------------   68 (238)
T ss_dssp             --CCCTTGGGGGCCHHHHHHHHHHHHSCHHHHHHHHHHHHHHHHHHHHHG------------------------------
T ss_pred             CCCCCHHHHHHCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHCC------------------------------
T ss_conf             79981679876698889999999996399999999999999999999647------------------------------


Q ss_pred             CCCHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             110012345-7788887776555679999999999999876666777889999999999999999878765543234567
Q gi|254780930|r  125 KIDLFGQRR-HIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKL  203 (452)
Q Consensus       125 ~ldl~G~~~-~~~~a~~~~~~~~~~~~~~~~~l~~~v~~aY~~~~~~~~~~~i~~~~~~~~~~~~~~~~~r~~~G~~~~~  203 (452)
                         .||+++ .++.+....+.++.+++.++.++..+|.++|++++..++.+++.++.++..++.++.++.+++.|.++..
T Consensus        69 ---~~Gk~~a~~~~A~~~~~~a~~~~~~~~~~l~~~v~~aY~~ll~~q~~l~i~~~~l~~~~~~~~~~~~r~~~G~~s~~  145 (238)
T 1yc9_A           69 ---IWGKNRAAVVAATSELAAAEAESVAARLMISTSIANAYAELARLYANQETVHAALQVRNKTVELLEKRYANGLETLG  145 (238)
T ss_dssp             ---GTSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTSSCHH
T ss_pred             ---CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             ---47777788999999999999999999999999999999999999888999999999999999999988642101233


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHCCCCCCCCCCCCCCHHHHHCCCCHHHHHHHHHHHHHHHH
Q ss_conf             77653222355798999999856888876877639992130001234554433100122104887899730234556555
Q gi|254780930|r  204 SLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEK  283 (452)
Q Consensus       204 d~~~a~~~~~~~~~~l~~~~~~~~~a~~~L~~l~G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~RPdi~~a~~  283 (452)
                      |+.+++.++..++..+..++.++..++..|..++|.++.............+.+   .+....++..++.+||||+.++.
T Consensus       146 Dl~~aq~~l~~a~~~l~~ae~~~~~a~~~L~~LlG~~~~~~~~l~~~~~~~~~~---~~~~~~l~~~al~~rPdl~~a~~  222 (238)
T 1yc9_A          146 SVSQAKAVAASVEAELLGIQESIQLQKNALAALVGQGPDRAASIEEPHITLTSR---YGLPSEAGVGLLGHRADITAARW  222 (238)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCCGGGGGGCCCCCCCCCCC---C-------CGGGTTCHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCC---CCCCHHHHHHHHHHCCHHHHHHH
T ss_conf             556554444346668999999999999889998477874112345543222344---46806667778862100224677


Q ss_pred             HHHHHHHHHCCHHHHH
Q ss_conf             8999964301011222
Q gi|254780930|r  284 KLADSVAKIGIAKSDL  299 (452)
Q Consensus       284 ~~~~a~~~i~~a~a~~  299 (452)
                      ++++++.+++.++++|
T Consensus       223 ~i~aa~~~i~~aka~y  238 (238)
T 1yc9_A          223 RAEAAAQQVGIAQAQF  238 (238)
T ss_dssp             HHHHHHHHHHHHHHTT
T ss_pred             HHHHHHHHHHHHHHHH
T ss_conf             8999998676777631



>3d5k_A (A:44-85,A:128-296) OPRM, outer membrane protein OPRM; channel, beta-alpha-barrel, antibiotic resistance, lipoprotein, palmitate, transmembrane, transport; 2.40A {Pseudomonas aeruginosa} PDB: 1wp1_A Back     alignment and structure
>1ek9_A (A:1-34,A:78-202,A:407-428) Outer membrane protein TOLC; integral membrane protein, alpha helical barrel, beta barrel; 2.10A {Escherichia coli} Back     alignment and structure
>1yc9_A (A:323-442) VCEC, multidrug resistance protein; outer membrane protein; HET: BOG; 1.80A {Vibrio cholerae} Back     alignment and structure
>3d5k_A (A:336-449) OPRM, outer membrane protein OPRM; channel, beta-alpha-barrel, antibiotic resistance, lipoprotein, palmitate, transmembrane, transport; 2.40A {Pseudomonas aeruginosa} PDB: 1wp1_A Back     alignment and structure
>1ek9_A (A:203-243,A:295-406) Outer membrane protein TOLC; integral membrane protein, alpha helical barrel, beta barrel; 2.10A {Escherichia coli} Back     alignment and structure
>1ek9_A (A:1-34,A:78-202,A:407-428) Outer membrane protein TOLC; integral membrane protein, alpha helical barrel, beta barrel; 2.10A {Escherichia coli} Back     alignment and structure
>1yc9_A (A:1-69,A:115-283) VCEC, multidrug resistance protein; outer membrane protein; HET: BOG; 1.80A {Vibrio cholerae} Back     alignment and structure
>3d5k_A (A:44-85,A:128-296) OPRM, outer membrane protein OPRM; channel, beta-alpha-barrel, antibiotic resistance, lipoprotein, palmitate, transmembrane, transport; 2.40A {Pseudomonas aeruginosa} PDB: 1wp1_A Back     alignment and structure
>1ek9_A (A:203-243,A:295-406) Outer membrane protein TOLC; integral membrane protein, alpha helical barrel, beta barrel; 2.10A {Escherichia coli} Back     alignment and structure
>1yc9_A (A:323-442) VCEC, multidrug resistance protein; outer membrane protein; HET: BOG; 1.80A {Vibrio cholerae} Back     alignment and structure
>3d5k_A (A:336-449) OPRM, outer membrane protein OPRM; channel, beta-alpha-barrel, antibiotic resistance, lipoprotein, palmitate, transmembrane, transport; 2.40A {Pseudomonas aeruginosa} PDB: 1wp1_A Back     alignment and structure
>1yc9_A (A:70-114,A:284-322) VCEC, multidrug resistance protein; outer membrane protein; HET: BOG; 1.80A {Vibrio cholerae} Back     alignment and structure
>3d5k_A (A:86-127,A:297-335) OPRM, outer membrane protein OPRM; channel, beta-alpha-barrel, antibiotic resistance, lipoprotein, palmitate, transmembrane, transport; 2.40A {Pseudomonas aeruginosa} PDB: 1wp1_A Back     alignment and structure