254780981

254780981

hypothetical protein CLIBASIA_04410

GeneID in NCBI database:8210003Locus tag:CLIBASIA_04410
Protein GI in NCBI database:254780981Protein Accession:YP_003065394.1
Gene range:-(979331, 979699)Protein Length:122aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:not defined as a protein in SEED
Pathway involved in KEGG:not defined
Subsystem involved in KEGG:not defined
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNyes
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120--
MKKYFTILTMLFVSSAINPCGIEEDNLKSSPLPHIALESLSAENEKKELSEHEKKVIESQENPKKQFSEHEKKETDDPKSARKENIVMKKTFSQKSKKYTPYFDHYMTNGHLNLPQNNGHRY
ccHHHHHHHHHHHHcccccccccccccccccccHHHHHHHccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHccccccccccccccc
cccHHHHHHHHHHHcccccccccccccccccccHHEHHHccHHHHHHHHHHHHHHHHHcccccHHHccHHccccccccccHcHHHEEEEEccccccccccccccEccccccccccccccccc
MKKYFTILTMLFVSsainpcgieednlkssplphiaLESLSAENEKKELSEHEKKVIEsqenpkkqfsehekketddpksarkenIVMKKTFsqkskkytpyfdhymtnghlnlpqnnghry
MKKYFTILTMLFVSSAINPCGIEEDNLKSSPLPHIALESLSAENEKKELSEHEkkviesqenpkkqfsehekketddpksarkenivmkktfsqkskkytpyfdhymtnghlnlpqnnghry
MKKYFTILTMLFVSSAINPCGIEEDNLKSSPLPHIALESLSAENEKKELSEHEKKVIESQENPKKQFSEHEKKETDDPKSARKENIVMKKTFSQKSKKYTPYFDHYMTNGHLNLPQNNGHRY
**KYFTILTMLFVSSAINPCGIEEDNLKSSPLPHIAL*****************************************************TFSQKSKKYTPYFDHYMTNGHL**********
MKKYFTILTMLFVSSAINPCGIEEDNLKSSPLPHIALESLSA***************************************RKENIVMKKTFSQKSKKYTPYFDHYMTNGHLNLPQNNGHRY
*KKYFTILTMLFVSSAINPCGIEEDNLKSSPLPHIALESLSAENEKKELSEHEKKVIE*Q*****************PKSARKENIVMKKTFSQKSKKYTPYFDHYMTNGHLNLP*******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
MKKYFTILTMLFVSSAINPCGIEEDNLKSSPLPHIALESLSxxxxxxxxxxxxxxxxxxxxxPKKQFSEHEKKETDDPKSARKENIVMKKTFSQKSKKYTPYFDHYMTNGHLNLPQNNGHRY
MKKYFTILTMLFVSSAINPCGIEEDNLKSSPLPHIALESLSAENEKKELSEHEKKVIESQENPKKQFSEHEKKETDDPKSARKENIVMKKTFSQKSKKYTPYFDHYMTNGHLNLPQNNGHRY
MKKYFTILTMLFVSSAINPCGIEEDNLKSSPLPHIALESLSAENEKKELSEHEKKVIESQENPKKQFSEHEKKETDDPKSARKENIVMKKTFSQKSKKYTPYFDHYMTNGHLNLPQNNGHRY

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target122 hypothetical protein CLIBASIA_04410 [Candidatus Liberib
254780984125 hypothetical protein CLIBASIA_04425 [Candidatus Li 3e-07
254780537294 periplasmic solute binding protein [Candidatus Lib 0.011
>gi|254780984|ref|YP_003065397.1| hypothetical protein CLIBASIA_04425 [Candidatus Liberibacter asiaticus str. psy62] Length = 125 Back     alignment
 Score = 45.8 bits (107), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 33/90 (36%), Positives = 47/90 (52%), Gaps = 13/90 (14%)

Query: 1  MKKYFTILTMLFVSSAIN---------PCGIEEDNLKSSPLPHIA--LESLSAENEK--K 47
          MKKY T+LT+L +S+ +N         P    E+ + +   P  +  L  L AENEK  K
Sbjct: 1  MKKYITLLTVLLISNVLNLYDAKARRFPTYGSEERIATCAKPGYSSRLAQLCAENEKRLK 60

Query: 48 ELSEHEKKVIESQENPKKQFSEHEKKETDD 77
          E  +  +++    EN KK F EHEKK T +
Sbjct: 61 EFDKITRELNTLSENEKKAFFEHEKKVTSN 90

>gi|254780537|ref|YP_003064950.1| periplasmic solute binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 294 Back     alignment
 Score = 30.4 bits (67), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 39/76 (51%), Gaps = 9/76 (11%)

Query: 3   KYFTILT----MLFVSSAINPCGIEED-NLKSSPLPHIALESLSA----ENEKKELSEHE 53
           KYFT L     ++ V+  INP G+ ED ++ S P PH  +   +A    EN +K L+  +
Sbjct: 89  KYFTNLKKGTKIITVTDGINPIGVSEDTSVDSEPNPHAWMSLTNAMIYIENIRKALTALD 148

Query: 54  KKVIESQENPKKQFSE 69
               +  E   +++SE
Sbjct: 149 PSNAKKYELNAREYSE 164

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target122 hypothetical protein CLIBASIA_04410 [Candidatus Liberib
254780984125 hypothetical protein CLIBASIA_04425 [Candidatus Liberib 1 0.002
>gi|254780984|ref|YP_003065397.1| hypothetical protein CLIBASIA_04425 [Candidatus Liberibacter asiaticus str. psy62] Length = 125 Back     alignment and organism information
 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/90 (36%), Positives = 47/90 (52%), Gaps = 13/90 (14%)

Query: 1  MKKYFTILTMLFVSSAIN---------PCGIEEDNLKSSPLPHIA--LESLSAENEK--K 47
          MKKY T+LT+L +S+ +N         P    E+ + +   P  +  L  L AENEK  K
Sbjct: 1  MKKYITLLTVLLISNVLNLYDAKARRFPTYGSEERIATCAKPGYSSRLAQLCAENEKRLK 60

Query: 48 ELSEHEKKVIESQENPKKQFSEHEKKETDD 77
          E  +  +++    EN KK F EHEKK T +
Sbjct: 61 EFDKITRELNTLSENEKKAFFEHEKKVTSN 90


Species: Candidatus Liberibacter asiaticus
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target122 hypothetical protein CLIBASIA_04410 [Candidatus Liberib
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated PIT, 3e-05
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
 Score = 42.2 bits (98), Expect = 3e-05
 Identities = 20/79 (25%), Positives = 36/79 (45%), Gaps = 12/79 (15%)

Query: 23  EEDNLKSSPLPHIALESLSA--ENEKKELSEHE--KKVIESQ--ENPKKQFSEHEKKETD 76
           + D L   P      ES+    E ++K L E +   KV+E +  E  KK   E  +++++
Sbjct: 76  QADRLTQEP------ESIRKWREEQRKRLQELDAASKVMEQEWREKAKKDLEEWNQRQSE 129

Query: 77  DPKSARKENIVMKKTFSQK 95
             +  +  N +  K F Q+
Sbjct: 130 QVEKNKINNRIADKAFYQQ 148


Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 122 hypothetical protein CLIBASIA_04410 [Candidatus Li
1m1j_A_119-491 373 (A:119-491) Fibrinogen alpha subunit; coiled coils 0.004
>1m1j_A (A:119-491) Fibrinogen alpha subunit; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus}Length = 373 Back     alignment and structure
 Score = 34.9 bits (78), Expect = 0.004
 Identities = 11/78 (14%), Positives = 27/78 (34%), Gaps = 1/78 (1%)

Query: 43  ENEKKELSEHEKKVIESQENPKKQFSEHEKKETD-DPKSARKENIVMKKTFSQKSKKYTP 101
              K+ ++    ++   Q + ++Q  E ++ E D D K    +    +    Q  K+   
Sbjct: 3   VTLKQRVATQVNRIKALQNSIQEQVVEMKRLEVDIDIKIRACKGSCARSFDYQVDKEGYD 62

Query: 102 YFDHYMTNGHLNLPQNNG 119
               ++T         + 
Sbjct: 63  NIQKHLTQASSIDMHPDF 80


Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00