254780982

254780982

putative homoserine/homoserine lactoneefflux protein

GeneID in NCBI database:8210004Locus tag:CLIBASIA_04415
Protein GI in NCBI database:254780982Protein Accession:YP_003065395.1
Gene range:+(980390, 980998)Protein Length:202aa
Gene description:putative homoserine/homoserine lactoneefflux protein
COG prediction:[E] Putative threonine efflux protein
KEGG prediction:putative homoserine/homoserine lactoneefflux protein; K05834 homoserine/homoserine lactone efflux protein
SEED prediction:putative homoserine/homoserine lactone efflux protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM5 TM-Helix
TOPPRED5 TM-Helix
HMMTOP6 TM-Helix
MEMSAT6 TM-Helix
MEMSAT_SVM6 TM-Helix
PHOBIUS6 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200--
MTLETWIHFLIFTLIITSAPGPGNILTINHALQHGWRPNKILILGQETAVFIIMLSITMGTKFLSQLAYTMLIIKFLGVAWLIYSAWSAWYSPFNDLPLGEIPLSSKSKLFVKGFITDITNGKAWAFFMAMVPAYLNMNHYILPQSLILSLTMVSVDAMVLMTFSLICSKLRTLFSSSKFVKIQNRVSAVVFLLLALRIVAN
ccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHcc
ccHHHHHHHHHHHHHHHccccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHcHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHcc
MTLETWIHFLIFTLIitsapgpgnilTINHAlqhgwrpnkililGQETAVFIIMLSITMGTKFLSQLAYTMLIIKFLGVAWLIYSAWSawyspfndlplgeiplsskskLFVKGFITDITNGKAWAFFMAMVPAYLNmnhyilpqSLILSLTMVSVDAMVLMTFSLICSKLRTLFSSSKFVKIQNRVSAVVFLLLALRIVAN
MTLETWIHFLIFTLIITSAPGPGNILTINHALQHGWRPNKILILGQETAVFIIMLSITMGTKFLSQLAYTMLIIKFLGVAWLIYSAWSAWYSPFNDLPLGEIPLSSKSKLFVKGFITDITNGKAWAFFMAMVPAYLNMNHYILPQSLILSLTMVSVDAMVLMTFSLICSKLRTLFSSSKFVKIQNRVSAVVFLLLALRIVAN
MTLETWIHFLIFTLIITSAPGPGNILTINHALQHGWRPNKILILGQETAVFIIMLSITMGTKFLSQLAYTMLIIKFLGVAWLIYSAWSAWYSPFNDLPLGEIPLSSKSKLFVKGFITDITNGKAWAFFMAMVPAYLNMNHYILPQSLILSLTMVSVDAMVLMTFSLICSKLRTLFSSSKFVKIQNRVSAVVFLLLALRIVAN
MTLETWIHFLIFTLIITSAPGPGNILTINHALQHGWRPNKILILGQETAVFIIMLSITMGTKFLSQLAYTMLIIKFLGVAWLIYSAWSAW*******************LFVKGFITDITNGKAWAFFMAMVPAYLNMNHYILPQSLILSLTMVSVDAMVLMTFSLICSKLRTLFSSSKFVKIQNRVSAVVFLLLALRIVAN
MTLETWIHFLIFTLIITSAPGPGNILTINHALQHGWRPNKILILGQETAVFIIMLSITMGTKFLSQLAYTMLIIKFLGVAWLIYSAWSAWYSPFNDLPLGEIPLSSKSKLFVKGFITDITNGKAWAFFMAMVPAYLNMNHYILPQSLILSLTMVSVDAMVLMTFSLICSKLRTLFSSSKFVKIQNRVSAVVFLLLALRIVAN
*TLETWIHFLIFTLIITSAPGPGNILTINHALQHGWRPNKILILGQETAVFIIMLSITMGTKFLSQLAYTMLIIKFLGVAWLIYSAWSAWYSPFNDLP***IPLSSKSKLFVKGFITDITNGKAWAFFMAMVPAYLNMNHYILPQSLILSLTMVSVDAMVLMTFSLICSKLRTLFSSSKFVKIQNRVSAVVFLLLALRIVAN
oooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHo
oooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoo
ooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooo
oooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTLETWIHFLIFTLIITSAPGPGNILTINHALQHGWRPNKILILGQETAVFIIMLSITMGTKFLSQLAYTMLIIKFLGVAWLIYSAWSAWYSPFNDLPLGEIPLSSKSKLFVKGFITDITNGKAWAFFMAMVPAYLNMNHYILPQSLILSLTMVSVDAMVLMTFSLICSKLRTLFSSSKFVKIQNRVSAVVFLLLALRIVAN
MTLETWIHFLIFTLIITSAPGPGNILTINHALQHGWRPNKILILGQETAVFIIMLSITMGTKFLSQLAYTMLIIKFLGVAWLIYSAWSAWYSPFNDLPLGEIPLSSKSKLFVKGFITDITNGKAWAFFMAMVPAYLNMNHYILPQSLILSLTMVSVDAMVLMTFSLICSKLRTLFSSSKFVKIQNRVSAVVFLLLALRIVAN
MTLETWIHFLIFTLIITSAPGPGNILTINHALQHGWRPNKILILGQETAVFIIMLSITMGTKFLSQLAYTMLIIKFLGVAWLIYSAWSAWYSPFNDLPLGEIPLSSKSKLFVKGFITDITNGKAWAFFMAMVPAYLNMNHYILPQSLILSLTMVSVDAMVLMTFSLICSKLRTLFSSSKFVKIQNRVSAVVFLLLALRIVAN

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target202 putative homoserine/homoserine lactoneefflux protein [C
315122518203 putative homoserine/homoserine lactoneefflux protein [C 1 2e-75
54309235217 putative homoserine/homoserine lactoneefflux protein [P 1 6e-23
90410428207 putative homoserine/homoserine lactone efflux protein [ 1 6e-23
91788522217 lysine exporter protein LysE/YggA [Polaromonas sp. JS66 1 1e-21
329911438213 putative homoserine/homoserine lactone efflux protein [ 1 4e-20
300692691213 neutral amino-acid efflux system efflux protein, homose 1 5e-20
226952202208 homoserine/homoserine lactone efflux protein [Acinetoba 1 2e-19
294648859208 homoserine/homoserine lactone efflux protein [Acinetoba 1 2e-19
260551332208 homoserine/homoserine lactone efflux protein [Acinetoba 1 3e-19
184156486208 putative threonine efflux protein [Acinetobacter bauman 1 2e-18
>gi|315122518|ref|YP_004063007.1| putative homoserine/homoserine lactoneefflux protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 203 Back     alignment and organism information
 Score =  285 bits (730), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 132/202 (65%), Positives = 167/202 (82%)

Query: 1   MTLETWIHFLIFTLIITSAPGPGNILTINHALQHGWRPNKILILGQETAVFIIMLSITMG 60
           M L+TWI F IFTL++TSAPG G ILTINH+LQHGW+P +++ILGQE AV ++M S+T+G
Sbjct: 1   MDLQTWISFAIFTLLLTSAPGAGCILTINHSLQHGWKPTRVMILGQEIAVLVLMFSVTLG 60

Query: 61  TKFLSQLAYTMLIIKFLGVAWLIYSAWSAWYSPFNDLPLGEIPLSSKSKLFVKGFITDIT 120
            K L+ L  TML+IKF+GVAWLIY+AWSAW SPFNDLP+ +IPL+S S  F+KGF+TDIT
Sbjct: 61  AKALANLTNTMLVIKFVGVAWLIYTAWSAWTSPFNDLPVDQIPLASVSHRFIKGFVTDIT 120

Query: 121 NGKAWAFFMAMVPAYLNMNHYILPQSLILSLTMVSVDAMVLMTFSLICSKLRTLFSSSKF 180
           NGKAWAFF+AMVP+YLNM H ILPQS ILS TM  +D +VL+ +S++CS LR  F+S  F
Sbjct: 121 NGKAWAFFIAMVPSYLNMEHSILPQSFILSCTMAGIDTIVLLFYSILCSYLRQYFTSPSF 180

Query: 181 VKIQNRVSAVVFLLLALRIVAN 202
           VKIQNR+S+VV +LLA +IV +
Sbjct: 181 VKIQNRISSVVLMLLAWKIVVS 202


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|54309235|ref|YP_130255.1| putative homoserine/homoserine lactoneefflux protein [Photobacterium profundum SS9] Length = 217 Back     alignment and organism information
>gi|90410428|ref|ZP_01218444.1| putative homoserine/homoserine lactone efflux protein [Photobacterium profundum 3TCK] Length = 207 Back     alignment and organism information
>gi|91788522|ref|YP_549474.1| lysine exporter protein LysE/YggA [Polaromonas sp. JS666] Length = 217 Back     alignment and organism information
>gi|329911438|ref|ZP_08275534.1| putative homoserine/homoserine lactone efflux protein [Oxalobacteraceae bacterium IMCC9480] Length = 213 Back     alignment and organism information
>gi|300692691|ref|YP_003753686.1| neutral amino-acid efflux system efflux protein, homoserine/homoserine lactone efflux protein [Ralstonia solanacearum PSI07] Length = 213 Back     alignment and organism information
>gi|226952202|ref|ZP_03822666.1| homoserine/homoserine lactone efflux protein [Acinetobacter sp. ATCC 27244] Length = 208 Back     alignment and organism information
>gi|294648859|ref|ZP_06726315.1| homoserine/homoserine lactone efflux protein [Acinetobacter haemolyticus ATCC 19194] Length = 208 Back     alignment and organism information
>gi|260551332|ref|ZP_05825533.1| homoserine/homoserine lactone efflux protein [Acinetobacter sp. RUH2624] Length = 208 Back     alignment and organism information
>gi|184156486|ref|YP_001844825.1| putative threonine efflux protein [Acinetobacter baumannii ACICU] Length = 208 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target202 putative homoserine/homoserine lactoneefflux protein [C
PRK10520205 PRK10520, rhtB, homoserine/homoserine lactone efflux pr 1e-16
pfam01810191 pfam01810, LysE, LysE type translocator 6e-12
TIGR00949185 TIGR00949, 2A76, The Resistance to Homoserine/Threonine 6e-10
COG1279202 COG1279, COG1279, Lysine efflux permease [General funct 3e-04
COG1280208 COG1280, RhtB, Putative threonine efflux protein [Amino 1e-19
PRK10323195 PRK10323, PRK10323, cysteine/O-acetylserine exporter; P 4e-04
>gnl|CDD|182514 PRK10520, rhtB, homoserine/homoserine lactone efflux protein; Provisional Back     alignment and domain information
>gnl|CDD|110783 pfam01810, LysE, LysE type translocator Back     alignment and domain information
>gnl|CDD|162127 TIGR00949, 2A76, The Resistance to Homoserine/Threonine (RhtB) Family protein Back     alignment and domain information
>gnl|CDD|31470 COG1279, COG1279, Lysine efflux permease [General function prediction only] Back     alignment and domain information
>gnl|CDD|31471 COG1280, RhtB, Putative threonine efflux protein [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|182377 PRK10323, PRK10323, cysteine/O-acetylserine exporter; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 202 putative homoserine/homoserine lactoneefflux protein [C
PRK10520205 rhtB homoserine/homoserine lactone efflux protein; Prov 100.0
PRK10958213 leucine export protein LeuE; Provisional 100.0
PRK10229206 threonine efflux system; Provisional 100.0
COG1280208 RhtB Putative threonine efflux protein [Amino acid tran 100.0
pfam01810191 LysE LysE type translocator. This family consists of va 100.0
PRK10323195 neutral amino-acid efflux protein; Provisional 100.0
TIGR00949194 2A76 Homoserine/Threonine efflux protein; InterPro: IPR 100.0
COG1279202 Lysine efflux permease [General function prediction onl 100.0
PRK09304197 arginine exporter protein; Provisional 99.97
TIGR00948213 2a75 L-lysine exporter; InterPro: IPR004777 L-lysine ex 99.96
pfam11139212 DUF2910 Protein of unknown function (DUF2910). Some mem 99.28
PRK11111214 hypothetical protein; Provisional 99.0
PRK10995222 multiple drug resistance protein MarC; Provisional 98.86
pfam01914203 MarC MarC family integral membrane protein. Integral me 98.58
PRK10739197 putative dITP- and XTP- hydrolase; Provisional 98.54
COG2095203 MarC Multiple antibiotic transporter [Intracellular tra 98.21
TIGR00427206 TIGR00427 conserved hypothetical protein TIGR00427; Int 98.07
PRK00293 577 dipZ thiol:disulfide interchange protein precursor; Pro 97.83
COG0785220 CcdA Cytochrome c biogenesis protein [Posttranslational 97.66
pfam03741184 TerC Integral membrane protein TerC family. This family 96.89
COG1971190 Predicted membrane protein [Function unknown] 96.48
COG4232 569 Thiol:disulfide interchange protein [Posttranslational 91.86
pfam02683206 DsbD Cytochrome C biogenesis protein transmembrane regi 98.52
TIGR02840215 spore_YtaF putative sporulation protein YtaF; InterPro: 94.66
pfam03596192 Cad Cadmium resistance transporter. 94.01
PRK11469206 hypothetical protein; Provisional 97.79
pfam05758 832 Ycf1 Ycf1. The chloroplast genomes of most higher plant 96.36
pfam01306 413 LacY_symp LacY proton/sugar symporter. This family is c 92.06
PRK10019278 nickel/cobalt efflux protein RcnA; Provisional 91.03
>PRK10520 rhtB homoserine/homoserine lactone efflux protein; Provisional Back     alignment and domain information
>PRK10958 leucine export protein LeuE; Provisional Back     alignment and domain information
>PRK10229 threonine efflux system; Provisional Back     alignment and domain information
>COG1280 RhtB Putative threonine efflux protein [Amino acid transport and metabolism] Back     alignment and domain information
>pfam01810 LysE LysE type translocator Back     alignment and domain information
>PRK10323 neutral amino-acid efflux protein; Provisional Back     alignment and domain information
>TIGR00949 2A76 Homoserine/Threonine efflux protein; InterPro: IPR004778 Proteins in this group include, A chemotactic transduction protein from Pseudomonas aeruginosa Back     alignment and domain information
>COG1279 Lysine efflux permease [General function prediction only] Back     alignment and domain information
>PRK09304 arginine exporter protein; Provisional Back     alignment and domain information
>TIGR00948 2a75 L-lysine exporter; InterPro: IPR004777 L-lysine exporter, LysE is an exporter, which: (i) structurally represents a new type of translocator; (ii) demonstrates that exporters are also present for primary metabolites such as amino acids; and (iii) serves in one physiological function to link import with export activity Back     alignment and domain information
>pfam11139 DUF2910 Protein of unknown function (DUF2910) Back     alignment and domain information
>PRK11111 hypothetical protein; Provisional Back     alignment and domain information
>PRK10995 multiple drug resistance protein MarC; Provisional Back     alignment and domain information
>pfam01914 MarC MarC family integral membrane protein Back     alignment and domain information
>PRK10739 putative dITP- and XTP- hydrolase; Provisional Back     alignment and domain information
>COG2095 MarC Multiple antibiotic transporter [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR00427 TIGR00427 conserved hypothetical protein TIGR00427; InterPro: IPR002771 Members of this family are integral membrane proteins that includes the antibiotic resistance protein MarC Back     alignment and domain information
>PRK00293 dipZ thiol:disulfide interchange protein precursor; Provisional Back     alignment and domain information
>COG0785 CcdA Cytochrome c biogenesis protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>pfam03741 TerC Integral membrane protein TerC family Back     alignment and domain information
>COG1971 Predicted membrane protein [Function unknown] Back     alignment and domain information
>COG4232 Thiol:disulfide interchange protein [Posttranslational modification, protein turnover, chaperones / Energy production and conversion] Back     alignment and domain information
>pfam02683 DsbD Cytochrome C biogenesis protein transmembrane region Back     alignment and domain information
>TIGR02840 spore_YtaF putative sporulation protein YtaF; InterPro: IPR014205 This entry represents YtaF, which represents a protein family identified, at the time of the publication of the Carboxydothermus hydrogenoformans genome Back     alignment and domain information
>pfam03596 Cad Cadmium resistance transporter Back     alignment and domain information
>PRK11469 hypothetical protein; Provisional Back     alignment and domain information
>pfam05758 Ycf1 Ycf1 Back     alignment and domain information
>pfam01306 LacY_symp LacY proton/sugar symporter Back     alignment and domain information
>PRK10019 nickel/cobalt efflux protein RcnA; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00