254780984

254780984

hypothetical protein CLIBASIA_04425

GeneID in NCBI database:8210006Locus tag:CLIBASIA_04425
Protein GI in NCBI database:254780984Protein Accession:YP_003065397.1
Gene range:-(982362, 982739)Protein Length:125aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:not defined as a protein in SEED
Pathway involved in KEGG:not defined
Subsystem involved in KEGG:not defined
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMyes
SignalP_NNyes
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-----
MKKYITLLTVLLISNVLNLYDAKARRFPTYGSEERIATCAKPGYSSRLAQLCAENEKRLKEFDKITRELNTLSENEKKAFFEHEKKVTSNLNYNARDRKHNINQFYEARGKYRYGNGYYRNYRSQ
cHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccEEccccHHHHHccc
ccHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccccccHcccccHHHHHHHcccEEcccccEEccccc
MKKYITLLTVLLISNVLnlydakarrfptygseeriatcakpgyssRLAQLCAENEKRLKEFDKITRELNTLSENEKKAFFEHEKKVTSNLNYNARDRKHNINQFYEArgkyrygngyyrnyrsq
MKKYITLLTVLLISNVLNLYDAKARrfptygseeriatcakpgysSRLAQLCAENEKRLKEFDKITRELntlsenekkaffehekkvtsnlnynardrkhninqfyeargkyrygngyyrnyrsq
MKKYITLLTVLLISNVLNLYDAKARRFPTYGSEERIATCAKPGYSSRLAQLCAENEKRLKEFDKITRELNTLSENEKKAFFEHEKKVTSNLNYNARDRKHNINQFYEArgkyrygngyyrnyrSQ
**KYITLLTVLLISNVLNLYDAKARRFPTYGSEERIATCAKPGYSSRLAQLCAENEKRLKEFDKITREL***********FEHEKKVTSNLNYNARDRKHNINQFYEARGKYRYGNGYY******
MKKYITLLTVLLISNVLNLYDAKARRFPTYGSEERIATCAKPGYSSRLAQLCAENEKRLKEFDKITRELNTLSENEKKAFFEHEKKVTSNLNYNARDRKHNINQFYEARGKYRYGNGYYRNYRSQ
MKKYITLLTVLLISNVLNLYDAKARRFPTYGSEERIATCAKPGYSSRLAQLCAENEKRLKEFDKITRELNTLSENEKKAFFEHEKKVTSNLNYNARDRKHNINQFYEARGKYRYGNGYYRNYR**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
MKKYITLLTVLLISNVLNLYDAKARRFPTYGSEERIATCAKPGYSSRLAQLCAENEKRLKEFDKITRELNTLSENEKKAFFEHEKKVTSNLNYNARDRKHNINQFYEARGKYRYGNGYYRNYRSQ
MKKYITLLTVLLISNVLNLYDAKARRFPTYGSEERIATCAKPGYSSRLAQLCAENEKRLKEFDKITRELNTLSENEKKAFFEHEKKVTSNLNYNARDRKHNINQFYEARGKYRYGNGYYRNYRSQ
MKKYITLLTVLLISNVLNLYDAKARRFPTYGSEERIATCAKPGYSSRLAQLCAENEKRLKEFDKITRELNTLSENEKKAFFEHEKKVTSNLNYNARDRKHNINQFYEARGKYRYGNGYYRNYRSQ

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target125 hypothetical protein CLIBASIA_04425 [Candidatus Liberib
25478112685 hypothetical protein CLIBASIA_05140 [Candidatus Li 1e-12
254780981122 hypothetical protein CLIBASIA_04410 [Candidatus Li 3e-07
>gi|254781126|ref|YP_003065539.1| hypothetical protein CLIBASIA_05140 [Candidatus Liberibacter asiaticus str. psy62] Length = 85 Back     alignment
 Score = 63.5 bits (153), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 38/49 (77%)

Query: 65  ITRELNTLSENEKKAFFEHEKKVTSNLNYNARDRKHNINQFYEARGKYR 113
           ITR +  L +++KKAFF HEKKV  +LNYNA DRK NI++ Y+AR KYR
Sbjct: 18  ITRGVARLPKDQKKAFFRHEKKVADHLNYNAGDRKSNIDKLYKARCKYR 66

>gi|254780981|ref|YP_003065394.1| hypothetical protein CLIBASIA_04410 [Candidatus Liberibacter asiaticus str. psy62] Length = 122 Back     alignment
 Score = 45.8 bits (107), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 33/90 (36%), Positives = 47/90 (52%), Gaps = 13/90 (14%)

Query: 1  MKKYITLLTVLLISNVLNLYDAKARRFPTYGSEERIATCAKPGYSSRLAQLCAENEKRLK 60
          MKKY T+LT+L +S+ +N         P    E+ + +   P  +  L  L AENEK  K
Sbjct: 1  MKKYFTILTMLFVSSAIN---------PCGIEEDNLKSSPLPHIA--LESLSAENEK--K 47

Query: 61 EFDKITRELNTLSENEKKAFFEHEKKVTSN 90
          E  +  +++    EN KK F EHEKK T +
Sbjct: 48 ELSEHEKKVIESQENPKKQFSEHEKKETDD 77

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target125 hypothetical protein CLIBASIA_04425 [Candidatus Liberib
25478112685 hypothetical protein CLIBASIA_05140 [Candidatus Liberib 1 1e-08
254780981122 hypothetical protein CLIBASIA_04410 [Candidatus Liberib 1 0.002
>gi|254781126|ref|YP_003065539.1| hypothetical protein CLIBASIA_05140 [Candidatus Liberibacter asiaticus str. psy62] Length = 85 Back     alignment and organism information
 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 38/49 (77%)

Query: 65  ITRELNTLSENEKKAFFEHEKKVTSNLNYNARDRKHNINQFYEARGKYR 113
           ITR +  L +++KKAFF HEKKV  +LNYNA DRK NI++ Y+AR KYR
Sbjct: 18  ITRGVARLPKDQKKAFFRHEKKVADHLNYNAGDRKSNIDKLYKARCKYR 66


Species: Candidatus Liberibacter asiaticus
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|254780981|ref|YP_003065394.1| hypothetical protein CLIBASIA_04410 [Candidatus Liberibacter asiaticus str. psy62] Length = 122 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00