254781000

254781000

tRNA (uracil-5-)-methyltransferase

GeneID in NCBI database:8210022Locus tag:CLIBASIA_04505
Protein GI in NCBI database:254781000Protein Accession:YP_003065413.1
Gene range:+(996499, 997614)Protein Length:371aa
Gene description:tRNA (uracil-5-)-methyltransferase
COG prediction:none
KEGG prediction:trmA; tRNA (uracil-5-)-methyltransferase (EC:2.1.1.35); K00557 tRNA (uracil-5-)-methyltransferase [EC:2.1.1.35]
SEED prediction:tRNA (Uracil54-C5-)-methyltransferase (EC 2.1.1.35)
Pathway involved in KEGG:not defined
Subsystem involved in SEED:tRNA modification Archaea
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-
MSGTLLIDQYEQQLAEKVDRLRQMMLAFQVPNLQIFRSEPIHYRMRAEFHIWHDGDDLYHIMFDQQTKERMRIDYFMPGSLLINALMIEMMATIRLEPLLRAKLFQIDYLTSQSDQAIVTLIYHRLLDDAWRECAIRLRDALHARKYQIQLIGRANKTKICLDRDYVDERLTVAGRTLIYRQIENSFTQPNAGINVHMLEWVLAATKGIQGDLLELYCGNGNFSLVLARHFDRVLAVEIAKPSVEAARYNIAANHVNNVKIVRMSSKEFTQAMRREREFNRLKDIDIHSYRFKTIFVDPPRSGLDDATVGMVQAYPHILYISCNPDSLCRDLSILSTTHTIERLALFDQFPYTRHMECGVLLVRKPSGWHQ
cccccccccHHHHHHHHHHHHHHHHHHccccccccccccccccEEEEEEEEEEEccEEEEEEEccccccEEEcHHcccccHHHHHHHHHHHHHHHHccccccEEEEEEEEEEccccEEEEEEEcccccHHHHHHHHHHHHHHHHccccHHccccccccEEEccccccEEEEEEccccEEEEEccccEEcccHHHHHHHHHHHHHHcccccccEEEEEccccHHHHHHHccccEEEEEEccHHHHHHHHHHHHHccccccEEEEccHHHHHHHHccccccccccccccccccccEEEEcccHHHHHHHHHHHHHHcccEEEEEccHHHHHHHHHHHccccEEEEEEEEEcccccccEEEEEEEEEccccccc
ccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHcccEEEEEcccccEEEEEEcccccccEcHHcccHHHHHHHHHHHHHHHHHcccHHHcccEEEEEEEEcccccEEEEEEEcccccHHHHHHHHHHHHHcccccEEEEEcccccccEEEEcccccccEEEcccccEEEEEcccccccccHHHHHHHHHHHHHHHHcccccEEEEEccccccHHHHHHHHHHHEEEEcccHHHHHHHHHHHHcccccEEEEEccHHHHHHHHHccccHHcccccccccccccEEEEccccccccHHHHHHHHccccEEEEEccHHHHHHHHHHHHcccEEEEEEEcccccccccEEEEEEEEEccccccc
MSGTLLIDQYEQQLAEKVDRLRQMMLAfqvpnlqifrsepihyrmraefhiwhdgddlYHIMFDQQTKermridyfmpgSLLINALMIEMMATIRLEPLLRAKLFQIDYLTSQSDQAIVTLIYHRLLDDAWRECAIRLRDALHARKYQIQLIGRAnktkicldrdyvDERLTVAGRTLIYRQIEnsftqpnagiNVHMLEWVLAATKGIQGDLLELYCGNGNFSLVLARHFDRVLAVEIAKPSVEAARYNIAANHVNNVKIVRMSSKEFTQAMRREREFnrlkdidihsyrfktifvdpprsglddatvgmvQAYPHILYiscnpdslcrdlsilstTHTIERlalfdqfpytrhmecgvllvrkpsgwhq
MSGTLLIDQYEQQLAEKVDRLRQMMLAFQVPNLQIFRSEPIHYRMRAEFHIWHDGDDLYHIMFDQQTKERMRIDYFMPGSLLINALMIEMMATIRLEPLLRAKLFQIDYLTSQSDQAIVTLIYHRLLDDAWRECAIRLRDALHARKYQIqligranktkicldrdyVDERLTVAGRTLIYRQIENSFTQPNAGINVHMLEWVLAATKGIQGDLLELYCGNGNFSLVLARHFDRVLAVEIAKPSVEAARYniaanhvnnvkivRMSSKEFTQAMRREREfnrlkdidihsyrfktifvdpprsGLDDATVGMVQAYPHILYISCNPDSLCRDLSILSTTHTIERLALFDQFPYTRHMECGVLLVRKPSGWHQ
MSGTLLIDQYEQQLAEKVDRLRQMMLAFQVPNLQIFRSEPIHYRMRAEFHIWHDGDDLYHIMFDQQTKERMRIDYFMPGSLLINALMIEMMATIRLEPLLRAKLFQIDYLTSQSDQAIVTLIYHRLLDDAWRECAIRLRDALHARKYQIQLIGRANKTKICLDRDYVDERLTVAGRTLIYRQIENSFTQPNAGINVHMLEWVLAATKGIQGDLLELYCGNGNFSLVLARHFDRVLAVEIAKPSVEAARYNIAANHVNNVKIVRMSSKEFTQAMRREREFNRLKDIDIHSYRFKTIFVDPPRSGLDDATVGMVQAYPHILYISCNPDSLCRDLSILSTTHTIERLALFDQFPYTRHMECGVLLVRKPSGWHQ
*SGTLLIDQYEQQLAEKVDRLRQMMLAFQVPNLQIFRSEPIHYRMRAEFHIWHDGDDLYHIMFDQQTKERMRIDYFMPGSLLINALMIEMMATIRLEPLLRAKLFQIDYLTSQSDQAIVTLIYHRLLDDAWRECAIRLRDALHARKYQIQLIGRANKTKICLDRDYVDERLTVAGRTLIYRQIENSFTQPNAGINVHMLEWVLAATKGIQGDLLELYCGNGNFSLVLARHFDRVLAVEIAKPSVEAARYNIAANHVNNVKIVRMSSKEFTQAMRREREFNRLKDIDIHSYRFKTIFVDPPRSGLDDATVGMVQAYPHILYISCNPDSLCRDLSILSTTHTIERLALFDQFPYTRHMECGVL***K******
MSGTLLIDQYEQQLAEKVDRLRQMMLAFQVPNLQIFRSEPIHYRMRAEFHIWHDGDDLYHIMFDQQTKERMRIDYFMPGSLLINALMIEMMATIRLEPLLRAKLFQIDYLTSQSDQAIVTLIYHRLLDDAWRECAIRLRDALHARKYQIQLIGRANKTKICLDRDYVDERLTVAGRTLIYRQIENSFTQPNAGINVHMLEWVLAATKGIQGDLLELYCGNGNFSLVLARHFDRVLAVEIAKPSVEAARYNIAANHVNNVKIVRMSSKEFTQAMRREREFNRLKDIDIHSYRFKTIFVDPPRSGLDDATVGMVQAYPHILYISCNPDSLCRDLSILSTTHTIERLALFDQFPYTRHMECGVLLVRKPSGWHQ
**GTLLIDQYEQQLAEKVDRLRQMMLAFQVPNLQIFRSEPIHYRMRAEFHIWHDGDDLYHIMFDQQTKERMRIDYFMPGSLLINALMIEMMATIRLEPLLRAKLFQIDYLTSQSDQAIVTLIYHRLLDDAWRECAIRLRDALHARKYQIQLIGRANKTKICLDRDYVDERLTVAGRTLIYRQIENSFTQPNAGINVHMLEWVLAATKGIQGDLLELYCGNGNFSLVLARHFDRVLAVEIAKPSVEAARYNIAANHVNNVKIVRMSSKEFTQAMRREREFNRLKDIDIHSYRFKTIFVDPPRSGLDDATVGMVQAYPHILYISCNPDSLCRDLSILSTTHTIERLALFDQFPYTRHMECGVLLVRKP*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSGTLLxxxxxxxxxxxxxxxxxxxxxFQVPNLQIFRSEPIHYRMRAEFHIWHDGDDLYHIMFDQQTKERMRIDYFMPGSLLINALMIEMMATIRLEPLLRAKLFQIDYLTSQSDQAIVTLIYHRLLDDAWRECAIRLRDALHARKYQIQLIGRANKTKICLDRDYVDERLTVAGRTLIYRQIENSFTQPNAGINVHMLEWVLAATKGIQGDLLELYCGNGNFSLVLARHFDRVLAVEIAKPSVEAARYNIAANHVNNVKIVRMSSKEFTQAMRREREFNRLKDIDIHSYRFKTIFVDPPRSGLDDATVGMVQAYPHILYISCNPDSLCRDLSILSTTHTIERLALFDQFPYTRHMECGVLLVRKPSGWHQ
MSGTLLIDQYEQQLAEKVDRLRQMMLAFQVPNLQIFRSEPIHYRMRAEFHIWHDGDDLYHIMFDQQTKERMRIDYFMPGSLLINALMIEMMATIRLEPLLRAKLFQIDYLTSQSDQAIVTLIYHRLLDDAWRECAIRLRDALHARKYQIQLIGRANKTKICLDRDYVDERLTVAGRTLIYRQIENSFTQPNAGINVHMLEWVLAATKGIQGDLLELYCGNGNFSLVLARHFDRVLAVEIAKPSVEAARYNIAANHVNNVKIVRMSSKEFTQAMRREREFNRLKDIDIHSYRFKTIFVDPPRSGLDDATVGMVQAYPHILYISCNPDSLCRDLSILSTTHTIERLALFDQFPYTRHMECGVLLVRKPSGWHQ
MSGTLLIDQYEQQLAEKVDRLRQMMLAFQVPNLQIFRSEPIHYRMRAEFHIWHDGDDLYHIMFDQQTKERMRIDYFMPGSLLINALMIEMMATIRLEPLLRAKLFQIDYLTSQSDQAIVTLIYHRLLDDAWRECAIRLRDALHARKYQIQLIGRANKTKICLDRDYVDERLTVAGRTLIYRQIENSFTQPNAGINVHMLEWVLAATKGIQGDLLELYCGNGNFSLVLARHFDRVLAVEIAKPSVEAARYNIAANHVNNVKIVRMSSKEFTQAMRREREFNRLKDIDIHSYRFKTIFVDPPRSGLDDATVGMVQAYPHILYISCNPDSLCRDLSILSTTHTIERLALFDQFPYTRHMECGVLLVRKPSGWHQ

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target371 tRNA (uracil-5-)-methyltransferase [Candidatus Liberiba
85060132370 tRNA (uracil-5-)-methyltransferase [Sodalis glossinidiu 1 1e-180
156935907367 tRNA (uracil-5-)-methyltransferase [Cronobacter sakazak 1 1e-148
171769880366 RecName: Full=tRNA (uracil-5-)-methyltransferase; AltNa 1 1e-147
238892362366 tRNA (uracil-5-)-methyltransferase [Klebsiella pneumoni 1 1e-147
261343029366 tRNA (uracil-5-)-methyltransferase [Enterobacter cancer 1 1e-147
152972754366 tRNA (uracil-5-)-methyltransferase [Klebsiella pneumoni 1 1e-146
262041733366 tRNA (uracil-5-)-methyltransferase [Klebsiella pneumoni 1 1e-146
290513037366 tRNA (uracil-5-)-methyltransferase [Klebsiella sp. 1_1_ 1 1e-146
332998394366 tRNA (uracil-5-)-methyltransferase [Shigella flexneri K 1 1e-146
24115259366 tRNA (uracil-5-)-methyltransferase [Shigella flexneri 2 1 1e-146
>gi|85060132|ref|YP_455834.1| tRNA (uracil-5-)-methyltransferase [Sodalis glossinidius str. 'morsitans'] Length = 370 Back     alignment and organism information
 Score =  637 bits (1642), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 305/365 (83%), Positives = 325/365 (89%)

Query: 4   TLLIDQYEQQLAEKVDRLRQMMLAFQVPNLQIFRSEPIHYRMRAEFHIWHDGDDLYHIMF 63
           TL IDQYEQQLAEK  RLRQMMLAFQ P  QIFRS+P HYRMRAEF IWHD DDLYHIMF
Sbjct: 5   TLPIDQYEQQLAEKAARLRQMMLAFQAPEAQIFRSQPAHYRMRAEFRIWHDEDDLYHIMF 64

Query: 64  DQQTKERMRIDYFMPGSLLINALMIEMMATIRLEPLLRAKLFQIDYLTSQSDQAIVTLIY 123
           D QTK R+RID+FMPGS LINALM EMM  IR EPLLRAKLFQIDYLT+QS +A+VTLIY
Sbjct: 65  DPQTKARIRIDHFMPGSPLINALMAEMMTAIRPEPLLRAKLFQIDYLTTQSGEAVVTLIY 124

Query: 124 HRLLDDAWRECAIRLRDALHARKYQIQLIGRANKTKICLDRDYVDERLTVAGRTLIYRQI 183
           HR LDDAWRECA  LRDAL AR Y IQ IGRANKTKI LDRDYVDERLTVAGRTLIY+QI
Sbjct: 125 HRPLDDAWRECAAGLRDALRARGYHIQFIGRANKTKIYLDRDYVDERLTVAGRTLIYQQI 184

Query: 184 ENSFTQPNAGINVHMLEWVLAATKGIQGDLLELYCGNGNFSLVLARHFDRVLAVEIAKPS 243
           ENSFTQPNAGINVHMLEW LAAT+G QGDLLELYCGNGNFSL LARHFDRVLA EIAK S
Sbjct: 185 ENSFTQPNAGINVHMLEWALAATEGAQGDLLELYCGNGNFSLALARHFDRVLATEIAKLS 244

Query: 244 VEAARYNIAANHVNNVKIVRMSSKEFTQAMRREREFNRLKDIDIHSYRFKTIFVDPPRSG 303
           VEAA YNIAANH++NV+IVRMS++EFTQAMR+EREF RLK+ID+ SYR +TIFVDPPRSG
Sbjct: 245 VEAAHYNIAANHIDNVQIVRMSAEEFTQAMRKEREFTRLKEIDLQSYRCETIFVDPPRSG 304

Query: 304 LDDATVGMVQAYPHILYISCNPDSLCRDLSILSTTHTIERLALFDQFPYTRHMECGVLLV 363
           LD+ATV MVQAYP ILYISCNPDSLCR+LS LSTTHTIERLALFDQFPYT HMECGVLLV
Sbjct: 305 LDEATVSMVQAYPQILYISCNPDSLCRNLSTLSTTHTIERLALFDQFPYTHHMECGVLLV 364

Query: 364 RKPSG 368
           RK + 
Sbjct: 365 RKATA 369


Species: Sodalis glossinidius
Genus: Sodalis
Family: Enterobacteriaceae
Order: Enterobacteriales
Class: Gammaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|156935907|ref|YP_001439823.1| tRNA (uracil-5-)-methyltransferase [Cronobacter sakazakii ATCC BAA-894] Length = 367 Back     alignment and organism information
>gi|171769880|sp|A7ML95|TRMA_ENTS8 RecName: Full=tRNA (uracil-5-)-methyltransferase; AltName: Full=tRNA(M-5-U54)-methyltransferase; Short=RUMT Length = 366 Back     alignment and organism information
>gi|238892362|ref|YP_002917096.1| tRNA (uracil-5-)-methyltransferase [Klebsiella pneumoniae NTUH-K2044] Length = 366 Back     alignment and organism information
>gi|261343029|ref|ZP_05970887.1| tRNA (uracil-5-)-methyltransferase [Enterobacter cancerogenus ATCC 35316] Length = 366 Back     alignment and organism information
>gi|152972754|ref|YP_001337900.1| tRNA (uracil-5-)-methyltransferase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] Length = 366 Back     alignment and organism information
>gi|262041733|ref|ZP_06014924.1| tRNA (uracil-5-)-methyltransferase [Klebsiella pneumoniae subsp. rhinoscleromatis ATCC 13884] Length = 366 Back     alignment and organism information
>gi|290513037|ref|ZP_06552400.1| tRNA (uracil-5-)-methyltransferase [Klebsiella sp. 1_1_55] Length = 366 Back     alignment and organism information
>gi|332998394|gb|EGK17992.1| tRNA (uracil-5-)-methyltransferase [Shigella flexneri K-272] Length = 366 Back     alignment and organism information
>gi|24115259|ref|NP_709769.1| tRNA (uracil-5-)-methyltransferase [Shigella flexneri 2a str. 301] Length = 366 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target371 tRNA (uracil-5-)-methyltransferase [Candidatus Liberiba
PRK05031362 PRK05031, PRK05031, tRNA (uracil-5-)-methyltransferase; 0.0
TIGR02143353 TIGR02143, trmA_only, tRNA (uracil-5-)-methyltransferas 1e-162
pfam05958353 pfam05958, tRNA_U5-meth_tr, tRNA (Uracil-5-)-methyltran 1e-162
TIGR00479431 TIGR00479, rumA, 23S rRNA (uracil-5-)-methyltransferase 8e-24
COG2265432 COG2265, TrmA, SAM-dependent methyltransferases related 9e-73
PRK13168443 PRK13168, rumA, 23S rRNA m(5)U1939 methyltransferase; R 5e-21
PRK03522315 PRK03522, rumB, 23S rRNA methyluridine methyltransferas 3e-17
KOG2187534 KOG2187, KOG2187, KOG2187, tRNA uracil-5-methyltransfer 6e-16
TIGR02085374 TIGR02085, meth_trns_rumB, 23S rRNA (uracil-5-)-methylt 1e-14
COG2813300 COG2813, RsmC, 16S RNA G1207 methylase RsmC [Translatio 1e-05
cd02440107 cd02440, AdoMet_MTases, S-adenosylmethionine-dependent 8e-05
TIGR03534251 TIGR03534, RF_mod_PrmC, protein-(glutamine-N5) methyltr 9e-05
pfam05175170 pfam05175, MTS, Methyltransferase small domain 1e-04
COG0220227 COG0220, COG0220, Predicted S-adenosylmethionine-depend 0.002
COG2520341 COG2520, COG2520, Predicted methyltransferase [General 0.003
pfam02475199 pfam02475, Met_10, Met-10+ like-protein 0.004
COG0742187 COG0742, COG0742, N6-adenine-specific methylase [DNA re 3e-04
COG1092393 COG1092, COG1092, Predicted SAM-dependent methyltransfe 3e-04
COG4123248 COG4123, COG4123, Predicted O-methyltransferase [Genera 8e-04
>gnl|CDD|179917 PRK05031, PRK05031, tRNA (uracil-5-)-methyltransferase; Validated Back     alignment and domain information
>gnl|CDD|131198 TIGR02143, trmA_only, tRNA (uracil-5-)-methyltransferase Back     alignment and domain information
>gnl|CDD|114667 pfam05958, tRNA_U5-meth_tr, tRNA (Uracil-5-)-methyltransferase Back     alignment and domain information
>gnl|CDD|129571 TIGR00479, rumA, 23S rRNA (uracil-5-)-methyltransferase RumA Back     alignment and domain information
>gnl|CDD|32446 COG2265, TrmA, SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|183875 PRK13168, rumA, 23S rRNA m(5)U1939 methyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|179588 PRK03522, rumB, 23S rRNA methyluridine methyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|37398 KOG2187, KOG2187, KOG2187, tRNA uracil-5-methyltransferase and related tRNA-modifying enzymes [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|131140 TIGR02085, meth_trns_rumB, 23S rRNA (uracil-5-)-methyltransferase RumB Back     alignment and domain information
>gnl|CDD|32642 COG2813, RsmC, 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|100107 cd02440, AdoMet_MTases, S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>gnl|CDD|163311 TIGR03534, RF_mod_PrmC, protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>gnl|CDD|147386 pfam05175, MTS, Methyltransferase small domain Back     alignment and domain information
>gnl|CDD|30569 COG0220, COG0220, Predicted S-adenosylmethionine-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>gnl|CDD|32590 COG2520, COG2520, Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>gnl|CDD|145554 pfam02475, Met_10, Met-10+ like-protein Back     alignment and domain information
>gnl|CDD|31085 COG0742, COG0742, N6-adenine-specific methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|31289 COG1092, COG1092, Predicted SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>gnl|CDD|33880 COG4123, COG4123, Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 371 tRNA (uracil-5-)-methyltransferase [Candidatus Liberiba
PRK05031363 tRNA (uracil-5-)-methyltransferase; Validated 100.0
pfam05958353 tRNA_U5-meth_tr tRNA (Uracil-5-)-methyltransferase. Thi 100.0
TIGR00479434 rumA 23S rRNA (uracil-5-)-methyltransferase RumA; Inter 100.0
PRK03522375 rumB 23S rRNA methyluridine methyltransferase; Reviewed 100.0
TIGR02143361 trmA_only tRNA (uracil-5-)-methyltransferase; InterPro: 100.0
PRK13168440 rumA 23S rRNA 5-methyluridine methyltransferase; Review 100.0
COG2265432 TrmA SAM-dependent methyltransferases related to tRNA ( 100.0
TIGR02085386 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase R 100.0
KOG2187534 consensus 100.0
pfam02475199 Met_10 Met-10+ like-protein. The methionine-10 mutant a 99.77
pfam10672286 Methyltrans_SAM S-adenosylmethionine-dependent methyltr 99.57
TIGR03534251 RF_mod_HemK protein-(glutamine-N5) methyltransferase, r 99.49
pfam05175170 MTS Methyltransferase small domain. This domain is foun 99.47
PRK09328277 N5-glutamine S-adenosyl-L-methionine-dependent methyltr 99.45
COG2890280 HemK Methylase of polypeptide chain release factors [Tr 99.35
TIGR03533284 L3_gln_methyl protein-(glutamine-N5) methyltransferase, 99.32
PRK11805307 N5-glutamine S-adenosyl-L-methionine-dependent methyltr 99.3
COG2813300 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosom 99.11
PRK09489342 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provi 98.99
KOG2730263 consensus 98.79
KOG2904328 consensus 98.77
KOG3191209 consensus 97.48
COG1092393 Predicted SAM-dependent methyltransferases [General fun 99.67
pfam09445165 Methyltransf_15 RNA cap guanine-N2 methyltransferase. R 99.6
pfam03602181 Cons_hypoth95 Conserved hypothetical protein 95. 99.43
COG0742187 N6-adenine-specific methylase [DNA replication, recombi 99.31
PRK01544 503 bifunctional N5-glutamine S-adenosyl-L-methionine-depen 99.18
TIGR00537183 hemK_rel_arch methylase, putative; InterPro: IPR004557 98.89
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methyltran 98.79
COG0116381 Predicted N6-adenine-specific DNA methylase [DNA replic 98.79
TIGR01983275 UbiG ubiquinone biosynthesis O-methyltransferase; Inter 98.74
pfam01135205 PCMT Protein-L-isoaspartate(D-aspartate) O-methyltransf 98.49
PRK00312213 pcm protein-L-isoaspartate O-methyltransferase; Reviewe 98.47
PRK13942214 protein-L-isoaspartate O-methyltransferase; Provisional 98.44
PRK11783 716 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional 98.39
pfam02005 375 TRM N2,N2-dimethylguanosine tRNA methyltransferase. Thi 98.33
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provisional 98.17
PRK13943317 protein-L-isoaspartate O-methyltransferase; Provisional 98.11
COG2519256 GCD14 tRNA(1-methyladenosine) methyltransferase and rel 98.08
pfam07021193 MetW Methionine biosynthesis protein MetW. This family 98.06
pfam01596204 Methyltransf_3 O-methyltransferase. Members of this fam 98.03
COG2518209 Pcm Protein-L-isoaspartate carboxylmethyltransferase [P 98.02
COG1867 380 TRM1 N2,N2-dimethylguanosine tRNA methyltransferase [Tr 97.96
TIGR02469135 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylat 97.91
pfam05401201 NodS Nodulation protein S (NodS). This family consists 97.84
) (PCMT) (which is also known as L-isoaspartyl protein carboxyl methyltransferase) is an enzyme that catalyzes the transfer of a methyl group from S- adenosylmethionine to the free carboxyl groups of D-aspartyl or L-isoaspartyl residues in a variety of peptides and proteins. The enzyme does not act on normal L-aspartyl residues L-isoaspartyl and D-aspartyl are the products of the spontaneous deamidation and/or isomerization of normal L-aspartyl and L- asparaginyl residues in proteins. PCMT plays a role in the repair and/or degradation of these damaged proteins; the enzymatic methyl esterification of the abnormal residues can lead to their conversion to normal L-aspartyl residues. The SAM domain is present in most of these proteins.; GO: 0004719 protein-L-isoaspartate (D-aspartate) O-methyltransferase activity, 0006464 protein modification process." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR00080">TIGR00080228 pimt protein-L-isoaspartate O-methyltransferase; InterP 97.76
TIGR02081205 metW methionine biosynthesis protein MetW; InterPro: IP 97.64
PRK10742250 putative methyltransferase; Provisional 97.41
pfam04445235 DUF548 Protein of unknown function (DUF548). Protein of 97.35
pfam10294171 Methyltransf_16 Putative methyltransferase. 97.35
KOG1122460 consensus 97.19
pfam08123205 DOT1 Histone methylation protein DOT1. The DOT1 domain 97.18
COG4122219 Predicted O-methyltransferase [General function predict 97.17
KOG1663237 consensus 97.02
PRK03612516 spermidine synthase; Provisional 96.98
KOG1253 525 consensus 96.92
TIGR00536311 hemK_fam methyltransferase, HemK family; InterPro: IPR0 96.9
KOG1500 517 consensus 96.81
TIGR00563487 rsmB ribosomal RNA small subunit methyltransferase B; I 96.61
KOG0820 315 consensus 95.83
KOG1661237 consensus 95.55
COG1568354 Predicted methyltransferases [General function predicti 95.29
pfam05971254 Methyltransf_10 Protein of unknown function (DUF890). T 95.04
pfam04378245 DUF519 Protein of unknown function (DUF519). Bacterial 94.97
pfam12147311 Hydrolase_5 Putative lysophospholipase. This domain is 94.87
PRK11727326 putative SAM-dependent methyltransferase; Provisional 94.84
PRK11188209 rrmJ 23S rRNA methyltransferase J; Provisional 94.76
pfam01728176 FtsJ FtsJ-like methyltransferase. This family consists 94.72
PRK01581363 speE spermidine synthase; Validated 93.88
COG0421282 SpeE Spermidine synthase [Amino acid transport and meta 92.65
pfam07091248 FmrO Ribosomal RNA methyltransferase (FmrO). This famil 91.96
PRK00811283 spermidine synthase; Provisional 91.83
COG2520341 Predicted methyltransferase [General function predictio 99.55
PRK10909198 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional 99.42
COG2263198 Predicted RNA methylase [Translation, ribosomal structu 99.36
PRK09329285 N5-glutamine S-adenosyl-L-methionine-dependent methyltr 99.28
COG4123248 Predicted O-methyltransferase [General function predict 99.19
PRK10901428 16S rRNA methyltransferase B; Provisional 98.92
pfam06325294 PrmA Ribosomal protein L11 methyltransferase (PrmA). Th 98.88
PRK07402196 precorrin-6B methylase; Provisional 98.87
COG2242187 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] 98.87
PRK00517298 prmA ribosomal protein L11 methyltransferase; Reviewed 98.85
COG2264300 PrmA Ribosomal protein L11 methylase [Translation, ribo 98.84
pfam01189277 Nol1_Nop2_Fmu NOL1/NOP2/sun family. 98.81
PRK08287186 cobalt-precorrin-6Y C(15)-methyltransferase; Validated 98.69
COG1041347 Predicted DNA modification methylase [DNA replication, 98.67
COG0144355 Sun tRNA and rRNA cytosine-C5-methylases [Translation, 98.62
PRK11933 471 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Revi 98.54
PRK04338 376 N(2),N(2)-dimethylguanosine tRNA methyltransferase; Pro 98.48
PRK11207198 tellurite resistance protein TehB; Provisional 98.42
pfam08704309 GCD14 tRNA methyltransferase complex GCD14 subunit. GCD 98.37
KOG3420185 consensus 98.31
cd00315 275 Cyt_C5_DNA_methylase Cytosine-C5 specific DNA methylase 98.13
pfam02384312 N6_Mtase N-6 DNA Methylase. Restriction-modification (R 98.09
KOG2671421 consensus 98.07
pfam05724203 TPMT Thiopurine S-methyltransferase (TPMT). This family 97.93
PRK06202233 hypothetical protein; Provisional 97.91
COG0030259 KsgA Dimethyladenosine transferase (rRNA methylation) [ 97.82
smart00650169 rADc Ribosomal RNA adenine dimethylases. 97.72
KOG1271227 consensus 97.72
pfam00398258 RrnaAD Ribosomal RNA adenine dimethylase. 97.72
pfam00145 319 DNA_methylase C-5 cytosine-specific DNA methylase. 97.71
PTZ00338296 dimethyladenosine transferase; Provisional 97.6
pfam02390199 Methyltransf_4 Putative methyltransferase. This is a fa 97.33
TIGR00755277 ksgA dimethyladenosine transferase; InterPro: IPR011530 97.19
PRK00274267 ksgA dimethyladenosine transferase; Reviewed 97.17
PRK13255218 thiopurine S-methyltransferase; Reviewed 96.99
pfam02527184 GidB rRNA small subunit methyltransferase G. This is a 96.64
KOG2915314 consensus 96.41
pfam05219265 DREV DREV methyltransferase. This family contains DREV 96.39
PRK00107216 gidB glucose-inhibited division protein B; Reviewed 96.37
COG0357215 GidB Predicted S-adenosylmethionine-dependent methyltra 96.04
TIGR00446284 nop2p NOL1/NOP2/sun family putative RNA methylase; Inte 95.75
TIGR00675 425 dcm DNA-cytosine methyltransferase; InterPro: IPR001525 95.4
pfam04816204 DUF633 Family of unknown function (DUF633). This family 94.91
COG2384226 Predicted SAM-dependent methyltransferase [General func 93.56
TIGR00138197 gidB methyltransferase GidB; InterPro: IPR003682 GidB ( 91.53
KOG2360413 consensus 90.35
PRK11783716 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional 99.37
pfam01170171 UPF0020 Putative RNA methylase family UPF0020. This dom 99.18
TIGR02021224 BchM-ChlM magnesium protoporphyrin O-methyltransferase; 99.12
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provi 98.97
TIGR00095210 TIGR00095 putative methyltransferase; InterPro: IPR0043 98.95
COG2521287 Predicted archaeal methyltransferase [General function 98.04
PRK00121229 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed 97.95
PRK11088272 rrmA 23S rRNA methyltransferase A; Provisional 97.7
COG0220227 Predicted S-adenosylmethionine-dependent methyltransfer 97.57
pfam0824195 Methyltransf_11 Methyltransferase domain. Members of th 97.52
TIGR00308 462 TRM1 N2,N2-dimethylguanosine tRNA methyltransferase; In 97.26
COG0270 328 Dcm Site-specific DNA methylase [DNA replication, recom 97.04
TIGR02987 603 met_A_Alw26 type II restriction m6 adenine DNA methyltr 96.69
TIGR00091216 TIGR00091 tRNA (guanine-N(7)-)-methyltransferase; Inter 96.44
PRK04457262 spermidine synthase; Provisional 96.21
pfam01564240 Spermine_synth Spermine/spermidine synthase. Spermine a 95.79
COG2961279 ComJ Protein involved in catabolism of external DNA [Ge 94.73
PRK07580230 Mg-protoporphyrin IX methyl transferase; Validated 99.17
PRK05134233 3-demethylubiquinone-9 3-methyltransferase; Provisional 98.9
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzo 98.83
PRK11036256 putative metallothionein SmtA; Provisional 98.75
TIGR00406330 prmA ribosomal protein L11 methyltransferase; InterPro: 98.73
pfam01209233 Ubie_methyltran ubiE/COQ5 methyltransferase family. 98.65
PRK00216239 ubiE ubiquinone/menaquinone biosynthesis methyltransfer 98.61
PRK08317241 hypothetical protein; Provisional 98.51
PRK01683252 trans-aconitate 2-methyltransferase; Provisional 98.42
PTZ00098263 phosphoethanolamine N-methyltransferase; Provisional 98.19
PRK10258251 biotin biosynthesis protein BioC; Provisional 98.09
pfam02353273 CMAS Cyclopropane-fatty-acyl-phospholipid synthase. Thi 97.94
PRK11524284 putative methyltransferase; Provisional 97.7
PRK05785225 hypothetical protein; Provisional 97.59
pfam01555221 N6_N4_Mtase DNA methylase. Members of this family are D 97.59
COG2230283 Cfa Cyclopropane fatty acid synthase and related methyl 97.58
PRK12335289 tellurite resistance protein TehB; Provisional 97.4
PRK13699227 putative methylase; Provisional 97.35
TIGR02072272 BioC biotin biosynthesis protein BioC; InterPro: IPR011 97.08
KOG1540296 consensus 97.07
PRK00050 309 mraW S-adenosyl-methyltransferase MraW; Provisional 96.99
pfam01795 310 Methyltransf_5 MraW methylase family. Members of this f 96.78
COG0275 314 Predicted S-adenosylmethionine-dependent methyltransfer 96.44
TIGR02752231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methylt 96.26
PRK11705383 cyclopropane fatty acyl phospholipid synthase; Provisio 96.24
TIGR00477239 tehB tellurite resistance protein TehB; InterPro: IPR00 96.19
KOG4300252 consensus 95.59
KOG1541270 consensus 95.19
pfam11599249 AviRa RRNA methyltransferase AviRa. This family of prot 95.06
pfam03291327 Pox_MCEL mRNA capping enzyme. This family of enzymes ar 94.73
KOG3010261 consensus 94.06
COG0863302 DNA modification methylase [DNA replication, recombinat 93.89
TIGR00677 312 fadh2_euk methylenetetrahydrofolate reductase; InterPro 92.15
COG0677436 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenase [Ce 90.47
PRK11873258 arsM arsenite S-adenosylmethyltransferase; Reviewed 98.9
COG2226238 UbiE Methylase involved in ubiquinone/menaquinone biosy 98.55
smart00828224 PKS_MT Methyltransferase in polyketide synthase (PKS) e 98.29
KOG1270282 consensus 98.29
TIGR01934242 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis meth 98.21
pfam0824298 Methyltransf_12 Methyltransferase domain. Members of th 97.88
COG4076252 Predicted RNA methylase [General function prediction on 97.86
pfam03848192 TehB Tellurite resistance protein TehB. 97.66
KOG1499 346 consensus 97.65
COG4106257 Tam Trans-aconitate methyltransferase [General function 96.86
COG3897218 Predicted methyltransferase [General function predictio 96.76
COG4976287 Predicted methyltransferase (contains TPR repeat) [Gene 96.52
TIGR01444142 fkbM_fam methyltransferase, FkbM family; InterPro: IPR0 95.81
KOG2899288 consensus 95.79
TIGR00740247 TIGR00740 methyltransferase, putative; InterPro: IPR005 95.25
PRK09432296 metF 5,10-methylenetetrahydrofolate reductase; Provisio 94.78
PRK10458 470 DNA cytosine methylase; Provisional 94.64
pfam06564244 YhjQ YhjQ protein. This family consists of several bact 92.62
KOG1227351 consensus 98.83
KOG2078495 consensus 98.33
PHA02056279 putative methyltransferase 98.02
COG0286 489 HsdM Type I restriction-modification system methyltrans 96.41
TIGR01177358 TIGR01177 conserved hypothetical protein TIGR01177; Int 96.06
pfam01861243 DUF43 Protein of unknown function DUF43. This family in 95.75
TIGR00676302 fadh2 5,10-methylenetetrahydrofolate reductase; InterPr 91.92
cd02038139 FleN-like FleN is a member of the Fer4_NifH superfamily 90.09
cd00550254 ArsA_ATPase Oxyanion-translocating ATPase (ArsA). This 92.32
pfam02086254 MethyltransfD12 D12 class N6 adenine-specific DNA methy 91.42
KOG1501636 consensus 90.24
>PRK05031 tRNA (uracil-5-)-methyltransferase; Validated Back     alignment and domain information
>pfam05958 tRNA_U5-meth_tr tRNA (Uracil-5-)-methyltransferase Back     alignment and domain information
>TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA; InterPro: IPR001566 This protein family was first proposed to be RNA methyltransferases by homology to the TrmA family Back     alignment and domain information
>PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed Back     alignment and domain information
>TIGR02143 trmA_only tRNA (uracil-5-)-methyltransferase; InterPro: IPR011869 This family consists exclusively of proteins believed to act as tRNA (uracil-5-)-methyltransferase Back     alignment and domain information
>PRK13168 rumA 23S rRNA 5-methyluridine methyltransferase; Reviewed Back     alignment and domain information
>COG2265 TrmA SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR02085 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase RumB; InterPro: IPR011825 This family consists of RNA methyltransferases designated RumB, formerly YbjF Back     alignment and domain information
>KOG2187 consensus Back     alignment and domain information
>pfam02475 Met_10 Met-10+ like-protein Back     alignment and domain information
>pfam10672 Methyltrans_SAM S-adenosylmethionine-dependent methyltransferase Back     alignment and domain information
>TIGR03534 RF_mod_HemK protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>pfam05175 MTS Methyltransferase small domain Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional Back     alignment and domain information
>KOG2730 consensus Back     alignment and domain information
>KOG2904 consensus Back     alignment and domain information
>KOG3191 consensus Back     alignment and domain information
>COG1092 Predicted SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>pfam09445 Methyltransf_15 RNA cap guanine-N2 methyltransferase Back     alignment and domain information
>pfam03602 Cons_hypoth95 Conserved hypothetical protein 95 Back     alignment and domain information
>COG0742 N6-adenine-specific methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>TIGR00537 hemK_rel_arch methylase, putative; InterPro: IPR004557 These proteins exhibit homology to the Saccharomyces cerevisiae (yeast) ORF YDR140w (FYV9) Back     alignment and domain information
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>COG0116 Predicted N6-adenine-specific DNA methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase; InterPro: IPR010233 This entry represents an O-methyltransferase, which is believed to act at two points in the ubiquinone biosynthetic pathway in bacteria (UbiG) and mitochondria (COQ3) , Back     alignment and domain information
>pfam01135 PCMT Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT) Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>pfam02005 TRM N2,N2-dimethylguanosine tRNA methyltransferase Back     alignment and domain information
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>pfam07021 MetW Methionine biosynthesis protein MetW Back     alignment and domain information
>pfam01596 Methyltransf_3 O-methyltransferase Back     alignment and domain information
>COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1867 TRM1 N2,N2-dimethylguanosine tRNA methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit; InterPro: IPR014008 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt Back     alignment and domain information
>pfam05401 NodS Nodulation protein S (NodS) Back     alignment and domain information
>TIGR00080 pimt protein-L-isoaspartate O-methyltransferase; InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (Back     alignment and domain information
>TIGR02081 metW methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins Back     alignment and domain information
>PRK10742 putative methyltransferase; Provisional Back     alignment and domain information
>pfam04445 DUF548 Protein of unknown function (DUF548) Back     alignment and domain information
>pfam10294 Methyltransf_16 Putative methyltransferase Back     alignment and domain information
>KOG1122 consensus Back     alignment and domain information
>pfam08123 DOT1 Histone methylation protein DOT1 Back     alignment and domain information
>COG4122 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>KOG1663 consensus Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>KOG1253 consensus Back     alignment and domain information
>TIGR00536 hemK_fam methyltransferase, HemK family; InterPro: IPR004556 The gene hemK from Escherichia coli was found to contribute to heme biosynthesis and originally suggested to be protoporphyrinogen oxidase Back     alignment and domain information
>KOG1500 consensus Back     alignment and domain information
>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase B; InterPro: IPR004573 This family consists of bacterial sequences related to Escherichia coli rsmB, an rRNA SAM-dependent methyltransferase Back     alignment and domain information
>KOG0820 consensus Back     alignment and domain information
>KOG1661 consensus Back     alignment and domain information
>COG1568 Predicted methyltransferases [General function prediction only] Back     alignment and domain information
>pfam05971 Methyltransf_10 Protein of unknown function (DUF890) Back     alignment and domain information
>pfam04378 DUF519 Protein of unknown function (DUF519) Back     alignment and domain information
>pfam12147 Hydrolase_5 Putative lysophospholipase Back     alignment and domain information
>PRK11727 putative SAM-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>pfam01728 FtsJ FtsJ-like methyltransferase Back     alignment and domain information
>PRK01581 speE spermidine synthase; Validated Back     alignment and domain information
>COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>pfam07091 FmrO Ribosomal RNA methyltransferase (FmrO) Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>COG2520 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional Back     alignment and domain information
>COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK09329 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>COG4123 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>PRK10901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>pfam06325 PrmA Ribosomal protein L11 methyltransferase (PrmA) Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>pfam01189 Nol1_Nop2_Fmu NOL1/NOP2/sun family Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>COG1041 Predicted DNA modification methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG0144 Sun tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed Back     alignment and domain information
>PRK04338 N(2),N(2)-dimethylguanosine tRNA methyltransferase; Provisional Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>pfam08704 GCD14 tRNA methyltransferase complex GCD14 subunit Back     alignment and domain information
>KOG3420 consensus Back     alignment and domain information
>cd00315 Cyt_C5_DNA_methylase Cytosine-C5 specific DNA methylases; Methyl transfer reactions play an important role in many aspects of biology Back     alignment and domain information
>pfam02384 N6_Mtase N-6 DNA Methylase Back     alignment and domain information
>KOG2671 consensus Back     alignment and domain information
>pfam05724 TPMT Thiopurine S-methyltransferase (TPMT) Back     alignment and domain information
>PRK06202 hypothetical protein; Provisional Back     alignment and domain information
>COG0030 KsgA Dimethyladenosine transferase (rRNA methylation) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>smart00650 rADc Ribosomal RNA adenine dimethylases Back     alignment and domain information
>KOG1271 consensus Back     alignment and domain information
>pfam00398 RrnaAD Ribosomal RNA adenine dimethylase Back     alignment and domain information
>pfam00145 DNA_methylase C-5 cytosine-specific DNA methylase Back     alignment and domain information
>PTZ00338 dimethyladenosine transferase; Provisional Back     alignment and domain information
>pfam02390 Methyltransf_4 Putative methyltransferase Back     alignment and domain information
>TIGR00755 ksgA dimethyladenosine transferase; InterPro: IPR011530 This family of proteins represent the rRNA adenine dimethylases (e Back     alignment and domain information
>PRK00274 ksgA dimethyladenosine transferase; Reviewed Back     alignment and domain information
>PRK13255 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>pfam02527 GidB rRNA small subunit methyltransferase G Back     alignment and domain information
>KOG2915 consensus Back     alignment and domain information
>pfam05219 DREV DREV methyltransferase Back     alignment and domain information
>PRK00107 gidB glucose-inhibited division protein B; Reviewed Back     alignment and domain information
>COG0357 GidB Predicted S-adenosylmethionine-dependent methyltransferase involved in bacterial cell division [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase; InterPro: IPR011023 This domain is found in archaeal, bacterial and eukaryotic proteins Back     alignment and domain information
>TIGR00675 dcm DNA-cytosine methyltransferase; InterPro: IPR001525 C-5 cytosine-specific DNA methylases (2 Back     alignment and domain information
>pfam04816 DUF633 Family of unknown function (DUF633) Back     alignment and domain information
>COG2384 Predicted SAM-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR00138 gidB methyltransferase GidB; InterPro: IPR003682 GidB (glucose-inhibited division protein B) appears to be present and in a single copy in all complete eubacterial genomes so far Back     alignment and domain information
>KOG2360 consensus Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>pfam01170 UPF0020 Putative RNA methylase family UPF0020 Back     alignment and domain information
>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase; InterPro: IPR010251 Chlorophyll and bacteriochlorophyll are essential photosynthetic pigments involved in oxygenic and non-oxygenic photosythesis respectively Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>TIGR00095 TIGR00095 putative methyltransferase; InterPro: IPR004398 This is a family of conserved hypothetical proteins, which includes a putative methylase Back     alignment and domain information
>COG2521 Predicted archaeal methyltransferase [General function prediction only] Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional Back     alignment and domain information
>COG0220 Predicted S-adenosylmethionine-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>pfam08241 Methyltransf_11 Methyltransferase domain Back     alignment and domain information
>TIGR00308 TRM1 N2,N2-dimethylguanosine tRNA methyltransferase; InterPro: IPR002905 This enzyme 2 Back     alignment and domain information
>COG0270 Dcm Site-specific DNA methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02987 met_A_Alw26 type II restriction m6 adenine DNA methyltransferase, Alw26I/Eco31I/Esp3I family; InterPro: IPR014329 Members of this entry are the m6-adenine DNA methyltransferase protein, or a fusion protein that also carries m5 cytosine methyltransferase activity of type II restriction systems of the Alw26I/Eco31I/Esp3I family Back     alignment and domain information
>TIGR00091 TIGR00091 tRNA (guanine-N(7)-)-methyltransferase; InterPro: IPR004395 This predicted S-adenosylmethionine-dependent methyltransferase is found in a single copy in most Bacteria Back     alignment and domain information
>PRK04457 spermidine synthase; Provisional Back     alignment and domain information
>pfam01564 Spermine_synth Spermine/spermidine synthase Back     alignment and domain information
>COG2961 ComJ Protein involved in catabolism of external DNA [General function prediction only] Back     alignment and domain information
>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated Back     alignment and domain information
>PRK05134 3-demethylubiquinone-9 3-methyltransferase; Provisional Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>PRK11036 putative metallothionein SmtA; Provisional Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase; InterPro: IPR004498 Ribosomal protein L11 methyltransferase (2 Back     alignment and domain information
>pfam01209 Ubie_methyltran ubiE/COQ5 methyltransferase family Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>pfam02353 CMAS Cyclopropane-fatty-acyl-phospholipid synthase Back     alignment and domain information
>PRK11524 putative methyltransferase; Provisional Back     alignment and domain information
>PRK05785 hypothetical protein; Provisional Back     alignment and domain information
>pfam01555 N6_N4_Mtase DNA methylase Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PRK13699 putative methylase; Provisional Back     alignment and domain information
>TIGR02072 BioC biotin biosynthesis protein BioC; InterPro: IPR011814 This enzyme, which is found in biotin biosynthetic gene clusters in proteobacteria, firmicutes, green-sulphur bacteria, fusobacterium and bacteroides, is believed to carry out an enzymatic step prior to the formation of pimeloyl-CoA (although attribution of this annotation is not traceable) Back     alignment and domain information
>KOG1540 consensus Back     alignment and domain information
>PRK00050 mraW S-adenosyl-methyltransferase MraW; Provisional Back     alignment and domain information
>pfam01795 Methyltransf_5 MraW methylase family Back     alignment and domain information
>COG0275 Predicted S-adenosylmethionine-dependent methyltransferase involved in cell envelope biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase; InterPro: IPR014122 MenG is a generic term for a methyltransferase that catalyses the last step in menaquinone biosynthesis; the exact enzymatic activity differs for different MenG because the menaquinone differ in their prenoid side chains in different species Back     alignment and domain information
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB; InterPro: IPR004537 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB Back     alignment and domain information
>KOG4300 consensus Back     alignment and domain information
>KOG1541 consensus Back     alignment and domain information
>pfam11599 AviRa RRNA methyltransferase AviRa Back     alignment and domain information
>pfam03291 Pox_MCEL mRNA capping enzyme Back     alignment and domain information
>KOG3010 consensus Back     alignment and domain information
>COG0863 DNA modification methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00677 fadh2_euk methylenetetrahydrofolate reductase; InterPro: IPR004621 The enzyme activities methylenetetrahydrofolate reductase (1 Back     alignment and domain information
>COG0677 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes Back     alignment and domain information
>KOG1270 consensus Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities Back     alignment and domain information
>pfam08242 Methyltransf_12 Methyltransferase domain Back     alignment and domain information
>COG4076 Predicted RNA methylase [General function prediction only] Back     alignment and domain information
>pfam03848 TehB Tellurite resistance protein TehB Back     alignment and domain information
>KOG1499 consensus Back     alignment and domain information
>COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] Back     alignment and domain information
>COG3897 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>TIGR01444 fkbM_fam methyltransferase, FkbM family; InterPro: IPR006342 Members of this group are characterised by two well-conserved short regions separated by a variable region in both sequence and length Back     alignment and domain information
>KOG2899 consensus Back     alignment and domain information
>TIGR00740 TIGR00740 methyltransferase, putative; InterPro: IPR005271 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK09432 metF 5,10-methylenetetrahydrofolate reductase; Provisional Back     alignment and domain information
>PRK10458 DNA cytosine methylase; Provisional Back     alignment and domain information
>pfam06564 YhjQ YhjQ protein Back     alignment and domain information
>KOG1227 consensus Back     alignment and domain information
>KOG2078 consensus Back     alignment and domain information
>PHA02056 putative methyltransferase Back     alignment and domain information
>COG0286 HsdM Type I restriction-modification system methyltransferase subunit [Defense mechanisms] Back     alignment and domain information
>TIGR01177 TIGR01177 conserved hypothetical protein TIGR01177; InterPro: IPR005885 This family of largely hypothetical proteins is found exclusively in the Archaea and contain a putative RNA methylase domain Back     alignment and domain information
>pfam01861 DUF43 Protein of unknown function DUF43 Back     alignment and domain information
>TIGR00676 fadh2 5,10-methylenetetrahydrofolate reductase; InterPro: IPR004620 The enzyme activities methylenetetrahydrofolate reductase (1 Back     alignment and domain information
>cd02038 FleN-like FleN is a member of the Fer4_NifH superfamily Back     alignment and domain information
>cd00550 ArsA_ATPase Oxyanion-translocating ATPase (ArsA) Back     alignment and domain information
>pfam02086 MethyltransfD12 D12 class N6 adenine-specific DNA methyltransferase Back     alignment and domain information
>KOG1501 consensus Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target371 tRNA (uracil-5-)-methyltransferase [Candidatus Liberiba
3bt7_A369 Structure Of E. Coli 5-Methyluridine Methyltransfer 1e-95
2bh2_A433 Crystal Structure Of E. Coli 5-Methyluridine Methyl 4e-65
1uwv_A433 Crystal Structure Of Ruma, The Iron-Sulfur Cluster 1e-61
2jjq_A425 The Crystal Structure Of Pyrococcus Abyssi Trna (Ur 2e-53
2vs1_A425 The Crystal Structure Of Pyrococcus Abyssi Trna (Ur 5e-52
2cww_A382 Crystal Structure Of Thermus Thermophilus Ttha1280, 4e-07
1wxw_A382 Crystal Structure Of Tt1595, A Putative Sam-Depende 6e-07
2as0_A396 Crystal Structure Of Ph1915 (Apc 5817): A Hypotheti 3e-04
2yxd_A183 Crystal Structure Of Cobalamin Biosynthesis Precorr 0.004
>gi|186972974|pdb|3BT7|A Chain A, Structure Of E. Coli 5-Methyluridine Methyltransferase Trma In Complex With 19 Nucleotide T-Arm Analogue Length = 369 Back     alignment and structure
 Score =  354 bits (909), Expect = 1e-95,   Method: Composition-based stats.
 Identities = 244/361 (67%), Positives = 290/361 (80%)

Query: 5   LLIDQYEQQLAEKVDRLRQMMLAFQVPNLQIFRSEPIHYRMRAEFHIWHDGDDLYHIMFD 64
           L  +QYE QLAEKV RL+ MM  F     ++FRS   HYRMRAEF IWHDGDDLYHI+FD
Sbjct: 9   LPTEQYEAQLAEKVVRLQSMMAPFSDLVPEVFRSPVSHYRMRAEFRIWHDGDDLYHIIFD 68

Query: 65  QQTKERMRIDYFMPGSLLINALMIEMMATIRLEPLLRAKLFQIDYLTSQSDQAIVTLIYH 124
           QQTK R+R+D F   S LIN LM  M+A +R  P+LR KLFQIDYLT+ S+QA+V+L+YH
Sbjct: 69  QQTKSRIRVDSFPAASELINQLMTAMIAGVRNNPVLRHKLFQIDYLTTLSNQAVVSLLYH 128

Query: 125 RLLDDAWRECAIRLRDALHARKYQIQLIGRANKTKICLDRDYVDERLTVAGRTLIYRQIE 184
           + LDD WR+ A  LRDAL A+   + LIGRA KTKI LD+DY+DERL VAG+ +IYRQ+E
Sbjct: 129 KKLDDEWRQEAEALRDALRAQNLNVHLIGRATKTKIELDQDYIDERLPVAGKEMIYRQVE 188

Query: 185 NSFTQPNAGINVHMLEWVLAATKGIQGDLLELYCGNGNFSLVLARHFDRVLAVEIAKPSV 244
           NSFTQPNA +N+ MLEW L  TKG +GDLLELYCGNGNFSL LAR+FDRVLA EIAKPSV
Sbjct: 189 NSFTQPNAAMNIQMLEWALDVTKGSKGDLLELYCGNGNFSLALARNFDRVLATEIAKPSV 248

Query: 245 EAARYNIAANHVNNVKIVRMSSKEFTQAMRREREFNRLKDIDIHSYRFKTIFVDPPRSGL 304
            AA+YNIAANH++NV+I+RM+++EFTQAM   REFNRL+ ID+ SY+ +TIFVDPPRSGL
Sbjct: 249 AAAQYNIAANHIDNVQIIRMAAEEFTQAMNGVREFNRLQGIDLKSYQCETIFVDPPRSGL 308

Query: 305 DDATVGMVQAYPHILYISCNPDSLCRDLSILSTTHTIERLALFDQFPYTRHMECGVLLVR 364
           D  T  MVQAYP ILYISCNP++LC++L  LS TH +ERLALFDQFPYT HM+CGVLL  
Sbjct: 309 DSETEKMVQAYPRILYISCNPETLCKNLETLSQTHKVERLALFDQFPYTHHMQCGVLLTA 368

Query: 365 K 365
           K
Sbjct: 369 K 369


gi|62738954|pdb|2BH2|A Chain A, Crystal Structure Of E. Coli 5-Methyluridine Methyltransferase Ruma In Complex With Ribosomal Rna Substrate And S-Adenosylhomocysteine. Length = 433 Back     alignment and structure
>gi|47169345|pdb|1UWV|A Chain A, Crystal Structure Of Ruma, The Iron-Sulfur Cluster Containing E. Coli 23s Ribosomal Rna 5-Methyluridine Methyltransferase Length = 433 Back     alignment and structure
>gi|195927220|pdb|2JJQ|A Chain A, The Crystal Structure Of Pyrococcus Abyssi Trna (Uracil-54, C5)-Methyltransferase In Complex With S-Adenosyl-L- Homocysteine Length = 425 Back     alignment and structure
>gi|195927327|pdb|2VS1|A Chain A, The Crystal Structure Of Pyrococcus Abyssi Trna (Uracil-54, C5)-Methyltransferase In Complex With S-Adenosyl-L- Homocysteine Length = 425 Back     alignment and structure
gi|82408293|pdb|2CWW|A Chain A, Crystal Structure Of Thermus Thermophilus Ttha1280, A Putative Sam-Dependent Rna Methyltransferase, In Complex With S-Adenosyl-L-Homocysteine Length = 382 Back     alignment and structure
>gi|73535497|pdb|1WXW|A Chain A, Crystal Structure Of Tt1595, A Putative Sam-Dependent Methyltransferase From Thermus Thermophillus Hb8 Length = 382 Back     alignment and structure