254781009

254781009

hypothetical protein CLIBASIA_04555

GeneID in NCBI database:8210032Locus tag:CLIBASIA_04555
Protein GI in NCBI database:254781009Protein Accession:YP_003065422.1
Gene range:-(1007221, 1009473)Protein Length:750aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:Flagellar basal-body rod protein FlgF
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750
MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDPIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSPNQNKDPWNNSFDDPQNNVSLQLSPQKKSNGRFSILNLF
cccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccHHHHHHHHcHHHHHHHHHHccccccHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccccHHHHHHHHccHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHccHHHHHHHHcccccHHHHHHHHHHHHHHccccHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccccHHHHHHHHcccccccccccccccEEEEEEEEEcccccHHHHHHHHHHHHHHcccccHHHHHHHHccHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHccccccEEEEEEEEccccHHHHHHHHHccHHHHHHHHHHccccHHHHHccHHHHHHHHHHHccHHHcccHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccEEEEEcccccccccEEEEccc
ccccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccccHHHHHHHcccHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHccccccHHHHHcccccHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccccHHHHHccHHHHHHHHHHcccccccccHHHHHHHHccccHHHHHHHHHHcccccccccccccHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccccHHHHHcccccccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccHHHHHHHcccHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccccHHHHHccHHHHHHHHHHccccHHHHHHHHHHHHHHcccccHHHHHHHcccHHHHHHHHHHcccccccccccccccHccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHccccHHHHHHHHccHHHHHHHHHHccccHHHHHccHHHHHHHHHHHccHHHcccHHHHHHHHHHHHHHcccccccHHcccccccccccccccccccccccEEEEEcccccccccEEEEEcc
mipshvapfpskdiqSKLFstvskdpivscEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILEsdlsdpkslVNQLNSLKYQYfarsydfspppkviqsdiQHKTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSfsitpkyislpflKDVLtlglanpkkyfIESRDNRFRAMAenfrfqpdgslskRDKILTDMQIEKIVSNYFnntidcvpivsdqnyYKLAINSVssfsdflkdpklfkmlqlslfplnpeitADKFLTLMqendpivsQVKYFFQInfhrdnssstkiqQDSQIQKMLDLYKKNCQILHDDKMQSLIKdyqlplgkiksidnllsgkcqlegpnsaeepIITLQFALDAYNLNMQDLDRDQLrnvltsnpsdpdsyankskddRLIKLNHafnfnadgsigpipmmqsrlTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRinleinsevdyytLNINTIHSFEELLANKRILNFLLeskgidsqkVREDFLCEIFksdlkdpksfantykdnrykeIISSFnfdihgelshkkigkvqdnfhiddtcdLYKHQMIEkkeeekdpNIALALYFKRTIPNIRNHyeilgdskLFKVVSKKlklspyfavlpERKKIRILKKHikindfkdskKVEDFLYAAKAMDHQSIDYKKalfsspnqnkdpwnnsfddpqnnvslqlspqkksngrfsilnlf
mipshvapfpskdiqsklfstvskdpivsceeryyrerikhistidefikdkRLFSYALKAFGLSDMSHAEKFIKKILesdlsdpkSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQSHQHKEEVALEESKYFRKNIHKinsvdqlfkdrRLLDYVLQSFsitpkyislPFLKDVLTLGLANPKKYFIESRDNRFRAMAEnfrfqpdgslskrDKILTDMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDPIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLtsnpsdpdsyankSKDDRLIKLNHAFnfnadgsigpiPMMQSRLTIRDNVKHYANRKrsihdaenksfnsmeqistqkrinleINSEVDYYTLNINTIHSFEELLANKRILNFLLEskgidsqkVREDFLCEifksdlkdpksfantykdnryKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIekkeeekdpnIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKlspyfavlperkkirilkkhikindfkdskKVEDFLYAAKAMDHQSIDYKKALFSSPNQNKDPWNNSFDDPQNNVslqlspqkksngrfsilnlf
MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDPIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDsklfkvvskklklsPYFAVLPErkkirilkkhikiNDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSPNQNKDPWNNSFDDPQNNVSLQLSPQKKSNGRFSILNLF
*IPSHVAPFPSKDIQS************SCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQD*************EESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKR**ILTDMQIEKIVSNYFN*******IVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDPIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDL********************QLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQIS**K****EINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKK*GKVQDNFHIDDTCDLYKHQMIEK*****DPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKA**************SFDDPQN************NGRFSILNLF
MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQD************LEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDPIVSQVKYFFQINFHRDN***********IQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSPNQNKDPWNNSFDDPQNNVSLQLSPQKKSNGRFSILNLF
*IPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDPIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSPNQNKDPWNNSFDDPQNNVSLQLSPQKKSNGRFSIL*LF
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDPIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSPNQNKDPWNNSFDDPQNNVSLQLSPQKKSNGRFSILNLF
MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDPIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSPNQNKDPWNNSFDDPQNNVSLQLSPQKKSNGRFSILNLF
MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDPIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSPNQNKDPWNNSFDDPQNNVSLQLSPQKKSNGRFSILNLF

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target750 hypothetical protein CLIBASIA_04555 [Candidatus Liberib
315122487757 hypothetical protein CKC_03695 [Candidatus Liberibacter 1 0.0
222147731727 hypothetical protein Avi_0969 [Agrobacterium vitis S4] 1 2e-87
15889789774 hypothetical protein Atu2524 [Agrobacterium tumefaciens 1 1e-86
15889789774 hypothetical protein Atu2524 [Agrobacterium tumefaciens 1 9e-17
327192290773 hypothetical protein RHECNPAF_2330071 [Rhizobium etli C 1 1e-85
209547533738 hypothetical protein Rleg2_5534 [Rhizobium leguminosaru 1 2e-84
86360899727 hypothetical protein RHE_PF00168 [Rhizobium etli CFN 42 1 1e-83
325293876775 hypothetical protein AGROH133_08567 [Agrobacterium sp. 1 2e-83
241113587727 protein of unknown function DUF1217 [Rhizobium legumino 1 1e-80
116248743727 putative flagella associated protein [Rhizobium legumin 1 1e-79
>gi|315122487|ref|YP_004062976.1| hypothetical protein CKC_03695 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 757 Back     alignment and organism information
 Score =  771 bits (1991), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 421/746 (56%), Positives = 545/746 (73%), Gaps = 18/746 (2%)

Query: 11  SKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHA 70
           S  +  K  +T+SKDPIVS EE+YYRE+IK IST++EFI DKRL +Y LKAF LSDMSHA
Sbjct: 23  SDKVYKKSIATISKDPIVSREEKYYREKIKKISTVEEFINDKRLLNYVLKAFDLSDMSHA 82

Query: 71  EKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQSH 130
           + F++KIL SDLS P+SLVN++NS KYQ FA  +DFSP PK IQ+ IQ K +I+DY  S+
Sbjct: 83  KTFLQKILTSDLSVPESLVNKMNSKKYQTFASQFDFSPAPKSIQTTIQQKKVIEDYITSY 142

Query: 131 QHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLG 190
           + KE+ ALEESKYFR+NI+ I SVDQL K+RRL++Y LQSF I P+YISL FLK+ LT  
Sbjct: 143 KRKEKDALEESKYFRQNINNITSVDQLIKNRRLVNYALQSFGINPQYISLSFLKESLTSE 202

Query: 191 LANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVP- 249
           L + K+     ++N   A+A+NFRFQ +GS   +DKILT+MQIE +V NYF++TI  VP 
Sbjct: 203 LDHTKQK--TPKENLLHALADNFRFQSNGSPIHKDKILTNMQIENMVHNYFSHTIMSVPE 260

Query: 250 --IVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDPIV 307
             I SDQ YY+ +INS+ SF   LKDPKL+K+LQ+SL  L+P++T + FL L++ NDP +
Sbjct: 261 EVIFSDQKYYRSSINSIPSFEQLLKDPKLYKILQISL-SLDPKVTENNFLKLIKNNDPSI 319

Query: 308 SQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQLPL-GK 366
            QVK FFQI++  D +S   IQ   QI K+L LY+ NC+ L   K++SLI++Y+  + G 
Sbjct: 320 VQVKKFFQIDYAGDINSRPAIQTKKQIDKLLFLYQTNCKKLRSQKIESLIENYKKDISGD 379

Query: 367 IKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSY 426
           IKS+D  L+ K +    ++  +PI  L+FAL AY +   DL++ +LR++L S+ SD  SY
Sbjct: 380 IKSVDQFLNMKPKSYISSNKSQPITPLEFALQAYGIKKNDLNKYRLRDILISDSSDSKSY 439

Query: 427 ANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNS 486
            N+ KD+R I L+HAFNFN  G IG   + QS+LT+RDNV +Y   K+S+++ ENK F+S
Sbjct: 440 VNQLKDNRFINLHHAFNFNKKGEIGFNRLTQSKLTLRDNVMNYIGYKKSLYN-ENKIFSS 498

Query: 487 MEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFL 546
            + I    RI  + + EV+YYT NI TIHSF +LLANKRILNFLLESK ID +KV+  FL
Sbjct: 499 AQNI----RIKKDTDKEVEYYTSNIQTIHSFNDLLANKRILNFLLESKEIDPKKVKNSFL 554

Query: 547 CEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYK 606
            +IFKSDL + KS ANTYKD+RYKEI+ SFNFDIHG  S++  GKVQDNFHID   DLYK
Sbjct: 555 EKIFKSDLNNTKSLANTYKDSRYKEIMLSFNFDIHGTKSNENTGKVQDNFHIDHVVDLYK 614

Query: 607 HQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPER 666
           +Q+++KKEEEKDP++AL LYFKRTIP I+N Y+ILGD  LF+V+SKKL+LSP+F  LPE 
Sbjct: 615 NQILQKKEEEKDPDVALLLYFKRTIPTIKNIYDILGDKNLFQVISKKLRLSPHFPSLPES 674

Query: 667 KKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSS--PNQNKDPWNNSFD 724
            KI ILKK I I DFKD KK+E+FLYA     +QS  +K AL  +  P   KD    S D
Sbjct: 675 TKIHILKKLINIKDFKDPKKLENFLYAVNVNHYQSTTHKIALTLAFFPPLEKD----SMD 730

Query: 725 DPQNNVSLQLSPQKKSNGRFSILNLF 750
           D + N+SLQLSP KK NG+FSILNLF
Sbjct: 731 DHEKNISLQLSPNKKENGKFSILNLF 756


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222147731|ref|YP_002548688.1| hypothetical protein Avi_0969 [Agrobacterium vitis S4] Length = 727 Back     alignment and organism information
>gi|15889789|ref|NP_355470.1| hypothetical protein Atu2524 [Agrobacterium tumefaciens str. C58] Length = 774 Back     alignment and organism information
>gi|15889789|ref|NP_355470.1| hypothetical protein Atu2524 [Agrobacterium tumefaciens str. C58] Length = 774 Back     alignment and organism information
>gi|327192290|gb|EGE59255.1| hypothetical protein RHECNPAF_2330071 [Rhizobium etli CNPAF512] Length = 773 Back     alignment and organism information
>gi|209547533|ref|YP_002279451.1| hypothetical protein Rleg2_5534 [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 738 Back     alignment and organism information
>gi|86360899|ref|YP_472786.1| hypothetical protein RHE_PF00168 [Rhizobium etli CFN 42] Length = 727 Back     alignment and organism information
>gi|325293876|ref|YP_004279740.1| hypothetical protein AGROH133_08567 [Agrobacterium sp. H13-3] Length = 775 Back     alignment and organism information
>gi|241113587|ref|YP_002973422.1| protein of unknown function DUF1217 [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 727 Back     alignment and organism information
>gi|116248743|ref|YP_764584.1| putative flagella associated protein [Rhizobium leguminosarum bv. viciae 3841] Length = 727 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target750 hypothetical protein CLIBASIA_04555 [Candidatus Liberib
pfam06748150 pfam06748, DUF1217, Protein of unknown function (DUF121 2e-20
pfam06748150 pfam06748, DUF1217, Protein of unknown function (DUF121 4e-14
pfam06748150 pfam06748, DUF1217, Protein of unknown function (DUF121 4e-09
pfam06748150 pfam06748, DUF1217, Protein of unknown function (DUF121 6e-07
pfam06748150 pfam06748, DUF1217, Protein of unknown function (DUF121 5e-25
>gnl|CDD|148384 pfam06748, DUF1217, Protein of unknown function (DUF1217) Back     alignment and domain information
>gnl|CDD|148384 pfam06748, DUF1217, Protein of unknown function (DUF1217) Back     alignment and domain information
>gnl|CDD|148384 pfam06748, DUF1217, Protein of unknown function (DUF1217) Back     alignment and domain information
>gnl|CDD|148384 pfam06748, DUF1217, Protein of unknown function (DUF1217) Back     alignment and domain information
>gnl|CDD|148384 pfam06748, DUF1217, Protein of unknown function (DUF1217) Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 750 hypothetical protein CLIBASIA_04555 [Candidatus Liberib
pfam06748150 DUF1217 Protein of unknown function (DUF1217). This fam 100.0
pfam06748150 DUF1217 Protein of unknown function (DUF1217). This fam 100.0
>pfam06748 DUF1217 Protein of unknown function (DUF1217) Back     alignment and domain information
>pfam06748 DUF1217 Protein of unknown function (DUF1217) Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target750 hypothetical protein CLIBASIA_04555 [Candidatus Liberib
2o8s_A323 X-Ray Crystal Structure Of Protein Agr_c_984 From A 1e-57
2o8s_A323 X-Ray Crystal Structure Of Protein Agr_c_984 From A 5e-45
2o8s_A323 X-Ray Crystal Structure Of Protein Agr_c_984 From A 2e-19
2o8s_A323 X-Ray Crystal Structure Of Protein Agr_c_984 From A 1e-15
>gi|126031430|pdb|2O8S|A Chain A, X-Ray Crystal Structure Of Protein Agr_c_984 From Agrobacterium Tumefaciens. Northeast Structural Genomics Consortium Target Atr120. Length = 323 Back     alignment and structure
 Score =  229 bits (584), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 55/274 (20%), Positives = 105/274 (38%), Gaps = 15/274 (5%)

Query: 461 TIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEEL 520
            ++           S + +       + +   +     ++  E +YY   I ++ S ++ 
Sbjct: 42  ALKSGSNESGGSVTSTYTSYRLISQDIGKSLERVSKQPDVARETEYYREKIGSVKSIDDF 101

Query: 521 LANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDI 580
            A+ R+ N+ L++ G++     + F+ ++      D  +FAN   DNRY E+  S +F  
Sbjct: 102 XADTRLYNYALKAHGLEDXAYAKAFIRKVLTEGASDKNAFANKLSDNRYAELAKSLDF-- 159

Query: 581 HGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEI 640
               +                   Y  Q +E++  + +  + LALYF+R  P I++  + 
Sbjct: 160 ----AGLGAAATATEAAKSGVIGNYARQTLEQEAGDDNNGVRLALYFERKAPTIKSGLDF 215

Query: 641 LGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQ 700
           L D  L +V      L   FA     K+  +++K I I D +D +KV   L         
Sbjct: 216 LADDALAQVFRTTFNLPDAFAAADVDKQAALIEKSINIKDLQDPEKVGKLLERFTI---- 271

Query: 701 SIDYKKALFSSPNQNKDPWNNSFDDPQNNVSLQL 734
             + +      P+   DP           +S  L
Sbjct: 272 XWEXQN-----PSTTYDPLAVFGSSSGYGISPDL 300


>gi|126031430|pdb|2O8S|A Chain A, X-Ray Crystal Structure Of Protein Agr_c_984 From Agrobacterium Tumefaciens. Northeast Structural Genomics Consortium Target Atr120. Length = 323 Back     alignment and structure
>gi|126031430|pdb|2O8S|A Chain A, X-Ray Crystal Structure Of Protein Agr_c_984 From Agrobacterium Tumefaciens. Northeast Structural Genomics Consortium Target Atr120. Length = 323 Back     alignment and structure
>gi|126031430|pdb|2O8S|A Chain A, X-Ray Crystal Structure Of Protein Agr_c_984 From Agrobacterium Tumefaciens. Northeast Structural Genomics Consortium Target Atr120. Length = 323 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target750 hypothetical protein CLIBASIA_04555 [Candidatus Liberib
2o8s_A323 AGR_C_984P; all alpha-helical protein, structural genom 1e-47
2o8s_A323 AGR_C_984P; all alpha-helical protein, structural genom 3e-40
2o8s_A323 AGR_C_984P; all alpha-helical protein, structural genom 8e-23
2o8s_A323 AGR_C_984P; all alpha-helical protein, structural genom 2e-18
2o8s_A323 AGR_C_984P; all alpha-helical protein, structural genom 4e-06
>2o8s_A AGR_C_984P; all alpha-helical protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Agrobacterium tumefaciens str} SCOP: a.295.1.1 Length = 323 Back     alignment and structure
 Score =  187 bits (475), Expect = 1e-47
 Identities = 63/276 (22%), Positives = 110/276 (39%), Gaps = 22/276 (7%)

Query: 416 LTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRS 475
           L++ P  P S    S      K                   +S          Y + +  
Sbjct: 13  LSAMPPAPPSPQPVSH-----KQAATLCRQGRTCALKSGSNESG---GSVTSTYTSYRLI 64

Query: 476 IHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKG 535
             D       S+E++S Q     ++  E +YY   I ++ S ++ +A+ R+ N+ L++ G
Sbjct: 65  SQDIGK----SLERVSKQP----DVARETEYYREKIGSVKSIDDFMADTRLYNYALKAHG 116

Query: 536 IDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDN 595
           ++     + F+ ++      D  +FAN   DNRY E+  S +F   G             
Sbjct: 117 LEDMAYAKAFIRKVLTEGASDKNAFANKLSDNRYAELAKSLDFAGLGA------AATATE 170

Query: 596 FHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLK 655
                    Y  Q +E++  + +  + LALYF+R  P I++  + L D  L +V      
Sbjct: 171 AAKSGVIGNYARQTLEQEAGDDNNGVRLALYFERKAPTIKSGLDFLADDALAQVFRTTFN 230

Query: 656 LSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFL 691
           L   FA     K+  +++K I I D +D +KV   L
Sbjct: 231 LPDAFAAADVDKQAALIEKSINIKDLQDPEKVGKLL 266


>2o8s_A AGR_C_984P; all alpha-helical protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Agrobacterium tumefaciens str} SCOP: a.295.1.1 Length = 323 Back     alignment and structure
>2o8s_A AGR_C_984P; all alpha-helical protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Agrobacterium tumefaciens str} SCOP: a.295.1.1 Length = 323 Back     alignment and structure
>2o8s_A AGR_C_984P; all alpha-helical protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Agrobacterium tumefaciens str} SCOP: a.295.1.1 Length = 323 Back     alignment and structure
>2o8s_A AGR_C_984P; all alpha-helical protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Agrobacterium tumefaciens str} SCOP: a.295.1.1 Length = 323 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target750 hypothetical protein CLIBASIA_04555 [Candidatus Liberib
2o8s_A323 AGR_C_984P; all alpha-helical protein, structural genom 100.0
2o8s_A323 AGR_C_984P; all alpha-helical protein, structural genom 100.0
>2o8s_A AGR_C_984P; all alpha-helical protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Agrobacterium tumefaciens str} SCOP: a.295.1.1 Back     alignment and structure
Probab=100.00  E-value=0  Score=529.70  Aligned_cols=283  Identities=22%  Similarity=0.355  Sum_probs=253.7

Q ss_pred             CCCCHHHHHHCCCHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHH
Q ss_conf             88701354201431578888744877678566510111133445568899987776411222235642111024566788
Q gi|254781009|r  420 PSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLE  499 (750)
Q Consensus       420 ~~Dp~S~aN~L~D~Ry~~lA~AFnF~~dG~~~~~~~~q~~~~~~~~~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  499 (750)
                      |.-|.||+|-..     ++|++|||+++|.....-..|.++.+..+...|+.-.+           ++..+....+.++.
T Consensus        17 ~~~~~~~~~~~~-----~~~~~~~~~~~~~~~~~~~~~~~~~~~sty~~y~~l~r-----------~~~~~l~~~a~~p~   80 (323)
T 2o8s_A           17 PPAPPSPQPVSH-----KQAATLCRQGRTCALKSGSNESGGSVTSTYTSYRLISQ-----------DIGKSLERVSKQPD   80 (323)
T ss_dssp             ---CCCCCCCCC-----C------------------------CCHHHHHHHHHHH-----------THHHHHHHHTTSHH
T ss_pred             CCCCCCCCCCCH-----HHHHHHHHCCCCCHHHCCCCCCCCCCCHHHHHHHHHHH-----------HHHHHHHHHHCCHH
T ss_conf             999899665208-----99998811554201003432147841103688999985-----------18999999863737


Q ss_pred             HHHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCCHHHHHHHCCCHHHHHHHHHCCCC
Q ss_conf             89899999974156678999941489999998754888544128999999622788855777521647899999761877
Q gi|254781009|r  500 INSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFD  579 (750)
Q Consensus       500 ~~~e~~yf~~~i~~i~s~~dll~D~rl~~~aL~AfGL~~~~~~~~~i~kvL~sd~~d~~slaN~l~D~ry~~la~aF~F~  579 (750)
                      +++|++||+++|++|+|+||||+|+||++|+|+||||++++++++||||||+||++||+||+|+|+|+||++|+.+|||+
T Consensus        81 v~Re~~Yf~e~Ig~VtSvddLl~D~RL~~~aL~AfGLed~~~~kafikKVLesd~~D~~S~ANrL~D~Ry~~~A~AFnF~  160 (323)
T 2o8s_A           81 VARETEYYREKIGSVKSIDDFMADTRLYNYALKAHGLEDMAYAKAFIRKVLTEGASDKNAFANKLSDNRYAELAKSLDFA  160 (323)
T ss_dssp             HHHHHHHHHHHGGGCCSHHHHHTCHHHHHHHHHHTTGGGSTTCHHHHHHHHHHCSSSTTCGGGGSSSTHHHHHHHHTCHH
T ss_pred             HHHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHHHCCCCCCCCHHHHHHHHHHCCCCCCHHHHHHCCCHHHHHHHHHHCCC
T ss_conf             77899999987378788999834689999999976998442519999999706998705688862668899999970999


Q ss_pred             CCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHCCCCHHHHHHHCCHHHHHHHHHHHCCCHH
Q ss_conf             65765567743224566799999999987788873003854699999986325500299872778999999997048676
Q gi|254781009|r  580 IHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPY  659 (750)
Q Consensus       580 ~~G~~~~~~~~~~q~~~~~~~i~d~Y~~qs~E~~~Ge~n~gvRLALyF~R~a~~Its~y~ILgD~aL~~V~~TAlgLP~~  659 (750)
                      +.|...      .|..++..+|+++|++|+||.++|++|+||||||||+|++|+|++||+||||++|++||+||||||++
T Consensus       161 ~~G~~~------tq~~~~~~~ivd~Y~~q~fE~~~Ge~n~~vRlALyF~R~~~~Its~ydIL~D~~L~~vv~TAlGLP~~  234 (323)
T 2o8s_A          161 GLGAAA------TATEAAKSGVIGNYARQTLEQEAGDDNNGVRLALYFERKAPTIKSGLDFLADDALAQVFRTTFNLPDA  234 (323)
T ss_dssp             HHGGGT------TSSTTTTHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHSTTCCSHHHHHTSHHHHHHHHTTTTC---
T ss_pred             CCCCCC------CCCHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHCHHHCCHHHHHCCHHHHHHHHHHCCCCHH
T ss_conf             888754------46568999999999999999985467888999999997440023499996788999999998199866


Q ss_pred             HHCCCHHHHHHHHHHHCCHHHCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHCCCCCCCCEEC
Q ss_conf             63199999999999621978649989999999998753110111112456786666415888416764420000
Q gi|254781009|r  660 FAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSPNQNKDPWNNSFDDPQNNVSLQ  733 (750)
Q Consensus       660 ~a~~DiDkQa~li~~k~Di~dl~DP~kv~kli~RF~Am~~~~yD~~n~~~~s~~~~~sp~~~lf~~~~~~~~~~  733 (750)
                      |+++|||||+++|++|+||+||+||++|+|||+||++|    ||++|++.+     ++|+..+...++.+|+..
T Consensus       235 ~a~lDiDkQa~~i~~k~disdf~DP~~v~kli~RFla~----~d~~n~~~~-----ss~~~ll~~~~~~~is~~  299 (323)
T 2o8s_A          235 FAAADVDKQAALIEKSINIKDLQDPEKVGKLLERFTIM----WEMQNPSTT-----YDPLAVFGSSSGYGISPD  299 (323)
T ss_dssp             --CCCCTTHHHHHHHSSCTTTTTCTTHHHHHHHHHHHH----HHHHCC--------------------------
T ss_pred             HCCCCHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHH----HHHHCCCCC-----CCHHHHHHCCCCCCCCHH
T ss_conf             51288899999999751498548979999999999999----998666778-----878999706874455889



>2o8s_A AGR_C_984P; all alpha-helical protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Agrobacterium tumefaciens str} SCOP: a.295.1.1 Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 750 hypothetical protein CLIBASIA_04555 [Candidatus Liberib
d2o8sa1225 a.295.1.1 (A:54-278) Uncharacterized protein AGR_C_984p 7e-46
d2o8sa1225 a.295.1.1 (A:54-278) Uncharacterized protein AGR_C_984p 3e-37
d2o8sa1225 a.295.1.1 (A:54-278) Uncharacterized protein AGR_C_984p 1e-22
d2o8sa1225 a.295.1.1 (A:54-278) Uncharacterized protein AGR_C_984p 5e-18
>d2o8sa1 a.295.1.1 (A:54-278) Uncharacterized protein AGR_C_984p {Agrobacterium tumefaciens [TaxId: 358]} Length = 225 Back     information, alignment and structure

class: All alpha proteins
fold: AGR C 984p-like
superfamily: AGR C 984p-like
family: AGR C 984p-like
domain: Uncharacterized protein AGR C 984p
species: Agrobacterium tumefaciens [TaxId: 358]
 Score =  179 bits (456), Expect = 7e-46
 Identities = 54/206 (26%), Positives = 96/206 (46%), Gaps = 10/206 (4%)

Query: 486 SMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDF 545
           S+E++S Q     ++  E +YY   I ++ S ++ +A+ R+ N+ L++ G++     + F
Sbjct: 18  SLERVSKQP----DVARETEYYREKIGSVKSIDDFMADTRLYNYALKAHGLEDMAYAKAF 73

Query: 546 LCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLY 605
           + ++      D  +FAN   DNRY E+  S +F   G                      Y
Sbjct: 74  IRKVLTEGASDKNAFANKLSDNRYAELAKSLDFAGLGAA------ATATEAAKSGVIGNY 127

Query: 606 KHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPE 665
             Q +E++  + +  + LALYF+R  P I++  + L D  L +V      L   FA    
Sbjct: 128 ARQTLEQEAGDDNNGVRLALYFERKAPTIKSGLDFLADDALAQVFRTTFNLPDAFAAADV 187

Query: 666 RKKIRILKKHIKINDFKDSKKVEDFL 691
            K+  +++K I I D +D +KV   L
Sbjct: 188 DKQAALIEKSINIKDLQDPEKVGKLL 213


>d2o8sa1 a.295.1.1 (A:54-278) Uncharacterized protein AGR_C_984p {Agrobacterium tumefaciens [TaxId: 358]} Length = 225 Back     information, alignment and structure
>d2o8sa1 a.295.1.1 (A:54-278) Uncharacterized protein AGR_C_984p {Agrobacterium tumefaciens [TaxId: 358]} Length = 225 Back     information, alignment and structure
>d2o8sa1 a.295.1.1 (A:54-278) Uncharacterized protein AGR_C_984p {Agrobacterium tumefaciens [TaxId: 358]} Length = 225 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target750 hypothetical protein CLIBASIA_04555 [Candidatus Liberib
d2o8sa1225 Uncharacterized protein AGR_C_984p {Agrobacterium tumef 100.0
d2o8sa1225 Uncharacterized protein AGR_C_984p {Agrobacterium tumef 100.0
>d2o8sa1 a.295.1.1 (A:54-278) Uncharacterized protein AGR_C_984p {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
class: All alpha proteins
fold: AGR C 984p-like
superfamily: AGR C 984p-like
family: AGR C 984p-like
domain: Uncharacterized protein AGR C 984p
species: Agrobacterium tumefaciens [TaxId: 358]
Probab=100.00  E-value=0  Score=473.06  Aligned_cols=208  Identities=25%  Similarity=0.468  Sum_probs=198.3

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCCHHHHHHHCCCHHH
Q ss_conf             10245667888989999997415667899994148999999875488854412899999962278885577752164789
Q gi|254781009|r  490 ISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRY  569 (750)
Q Consensus       490 ~~~~~~~~~~~~~e~~yf~~~i~~i~s~~dll~D~rl~~~aL~AfGL~~~~~~~~~i~kvL~sd~~d~~slaN~l~D~ry  569 (750)
                      .....+.++.+++|++||+++|++|+|++|||+|+||++|+|+||||+++++++++|||||+||++||+||||+|+|+||
T Consensus        18 ~~~~~a~~~~v~re~~Yf~e~I~~v~svddll~D~rL~~~al~AfGL~~~~~~~~~lkkvL~sd~~d~~S~aN~l~D~Ry   97 (225)
T d2o8sa1          18 SLERVSKQPDVARETEYYREKIGSVKSIDDFMADTRLYNYALKAHGLEDMAYAKAFIRKVLTEGASDKNAFANKLSDNRY   97 (225)
T ss_dssp             HHHHHTTSHHHHHHHHHHHHHGGGCCSHHHHHTCHHHHHHHHHHTTGGGSTTCHHHHHHHHHHCSSSTTCGGGGSSSTHH
T ss_pred             HHHHHHCCHHHHHHHHHHHHHHCCCCCHHHHHCCHHHHHHHHHHCCCCCCCCCHHHHHHHHCCCCCCHHHHHHHCCCHHH
T ss_conf             99998627788889999999836788899995488999999997699965363999999982699875889887378889


Q ss_pred             HHHHHHCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHCCCCHHHHHHHCCHHHHHH
Q ss_conf             99997618776576556774322456679999999998778887300385469999998632550029987277899999
Q gi|254781009|r  570 KEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKV  649 (750)
Q Consensus       570 ~~la~aF~F~~~G~~~~~~~~~~q~~~~~~~i~d~Y~~qs~E~~~Ge~n~gvRLALyF~R~a~~Its~y~ILgD~aL~~V  649 (750)
                      ++|++||||+++|+..+      |..++..+|+++|++|+||.++|++|+||||||||+|++|+|+|||+||||++|++|
T Consensus        98 ~~~a~AFnF~~~g~~~~------~~~~~~~~i~~~Y~~~~~E~~~g~~d~~~rlALyf~r~~~~its~~~iL~d~~L~~v  171 (225)
T d2o8sa1          98 AELAKSLDFAGLGAAAT------ATEAAKSGVIGNYARQTLEQEAGDDNNGVRLALYFERKAPTIKSGLDFLADDALAQV  171 (225)
T ss_dssp             HHHHHHTCHHHHGGGTT------SSTTTTHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHSTTCCSHHHHHTSHHHHHH
T ss_pred             HHHHHHHCCCCCCCCCC------CCHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHCCHHCCHHHHHCCHHHHHH
T ss_conf             99999829999987554------546889999999999998998457788899999999846012469999788899999


Q ss_pred             HHHHHCCCHHHHCCCHHHHHHHHHHHCCHHHCCCHHHHHHHHHHHHHHHHCCCCCCCC
Q ss_conf             9997048676631999999999996219786499899999999987531101111124
Q gi|254781009|r  650 VSKKLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKA  707 (750)
Q Consensus       650 ~~TAlgLP~~~a~~DiDkQa~li~~k~Di~dl~DP~kv~kli~RF~Am~~~~yD~~n~  707 (750)
                      |+||||||++|+++|||+|+++|++|+|+++|+||++|++||+||++|    ||++|.
T Consensus       172 ~~talgLp~~~a~~did~Q~~~i~~k~d~sd~~DP~~v~~~i~rf~~~----~d~~Np  225 (225)
T d2o8sa1         172 FRTTFNLPDAFAAADVDKQAALIEKSINIKDLQDPEKVGKLLERFTIM----WEMQNP  225 (225)
T ss_dssp             HHTTTTC-----CCCCTTHHHHHHHSSCTTTTTCTTHHHHHHHHHHHH----HHHHCC
T ss_pred             HHHHCCCCHHHCCCCHHHHHHHHHHHCCHHHCCCHHHHHHHHHHHHHH----HHCCCC
T ss_conf             999909985543389899999999652297559989999999999999----870196



>d2o8sa1 a.295.1.1 (A:54-278) Uncharacterized protein AGR_C_984p {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 750 hypothetical protein CLIBASIA_04555 [Candidatus Li
2o8s_A_69-192124 (A:69-192) AGR_C_984P; all alpha-helical protein, 1e-26
2o8s_A_69-192124 (A:69-192) AGR_C_984P; all alpha-helical protein, 1e-23
2o8s_A_69-192124 (A:69-192) AGR_C_984P; all alpha-helical protein, 4e-22
2o8s_A_69-192124 (A:69-192) AGR_C_984P; all alpha-helical protein, 8e-15
2o8s_A_69-192124 (A:69-192) AGR_C_984P; all alpha-helical protein, 0.003
2o8s_A_1-68_193-323199 (A:1-68,A:193-323) AGR_C_984P; all alpha-helical p 7e-20
>2o8s_A (A:69-192) AGR_C_984P; all alpha-helical protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Agrobacterium tumefaciens str}Length = 124 Back     alignment and structure
 Score =  116 bits (291), Expect = 1e-26
 Identities = 45/126 (35%), Positives = 70/126 (55%), Gaps = 3/126 (2%)

Query: 16  SKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIK 75
            K    VSK P V+ E  YYRE+I  + +ID+F  D RL++YALKA GL D ++A+ FI+
Sbjct: 1   GKSLERVSKQPDVARETEYYREKIGSVKSIDDFXADTRLYNYALKAHGLEDXAYAKAFIR 60

Query: 76  KILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKV-IQSDIQHKTIIQDYKQSHQHKE 134
           K+L    SD  +  N+L+  +Y   A+S DF+        ++     +I +Y    Q  E
Sbjct: 61  KVLTEGASDKNAFANKLSDNRYAELAKSLDFAGLGAAATATEAAKSGVIGNYA--RQTLE 118

Query: 135 EVALEE 140
           + A ++
Sbjct: 119 QEAGDD 124


>2o8s_A (A:69-192) AGR_C_984P; all alpha-helical protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Agrobacterium tumefaciens str}Length = 124 Back     alignment and structure
>2o8s_A (A:69-192) AGR_C_984P; all alpha-helical protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Agrobacterium tumefaciens str}Length = 124 Back     alignment and structure
>2o8s_A (A:69-192) AGR_C_984P; all alpha-helical protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Agrobacterium tumefaciens str}Length = 124 Back     alignment and structure
>2o8s_A (A:69-192) AGR_C_984P; all alpha-helical protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Agrobacterium tumefaciens str}Length = 124 Back     alignment and structure
>2o8s_A (A:1-68,A:193-323) AGR_C_984P; all alpha-helical protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Agrobacterium tumefaciens str}Length = 199 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target750 hypothetical protein CLIBASIA_04555 [Candidatus Liberib
2o8s_A_1-68_193-323199 AGR_C_984P; all alpha-helical protein, structural 100.0
2o8s_A_69-192124 AGR_C_984P; all alpha-helical protein, structural 100.0
2o8s_A_69-192124 AGR_C_984P; all alpha-helical protein, structural 100.0
2o8s_A_1-68_193-323199 AGR_C_984P; all alpha-helical protein, structural 98.67
>2o8s_A (A:1-68,A:193-323) AGR_C_984P; all alpha-helical protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Agrobacterium tumefaciens str} Back     alignment and structure
Probab=100.00  E-value=1.5e-42  Score=272.53  Aligned_cols=111  Identities=25%  Similarity=0.406  Sum_probs=102.9

Q ss_pred             HCCCHHHHHHHHHHHHCCCCHHHHHHHCCHHHHHHHHHHHCCCHHHHCCCHHHHHHHHHHHCCHHHCCCHHHHHHHHHHH
Q ss_conf             00385469999998632550029987277899999999704867663199999999999621978649989999999998
Q gi|254781009|r  615 EEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAA  694 (750)
Q Consensus       615 Ge~n~gvRLALyF~R~a~~Its~y~ILgD~aL~~V~~TAlgLP~~~a~~DiDkQa~li~~k~Di~dl~DP~kv~kli~RF  694 (750)
                      .+-|+||||||||+|++|+|++||+||||++|++||+||||||++|+++|||||+++|++|+||+||+||+||+|||+||
T Consensus        66 ~~~NegvRLALYFqR~ap~I~swY~ILgD~aL~~VfeTALGLPssfa~lDIDkQa~li~~k~DlsdlsDP~kveklI~RF  145 (199)
T 2o8s_A           66 QDINNGVRLALYFERKAPTIKSGLDFLADDALAQVFRTTFNLPDAFAAADVDKQAALIEKSINIKDLQDPEKVGKLLERF  145 (199)
T ss_dssp             HTHCHHHHHHHHHHHHSTTCCSHHHHHTSHHHHHHHHTTTTC-----CCCCTTHHHHHHHSSCTTTTTCTTHHHHHHHHH
T ss_pred             HHHCHHHHHHHHHHHHCHHHCCHHHHHCCHHHHHHHHHHCCCCHHHCCCCHHHHHHHHHHHCCHHHCCCHHHHHHHHHHH
T ss_conf             01788899999999743323229999677899999999819986661388899999999633798648979999999999


Q ss_pred             HHHHHCCCCCCCCCCCCCCCCCCHHHHHCCCCCCCCEECC
Q ss_conf             7531101111124567866664158884167644200000
Q gi|254781009|r  695 KAMDHQSIDYKKALFSSPNQNKDPWNNSFDDPQNNVSLQL  734 (750)
Q Consensus       695 ~Am~~~~yD~~n~~~~s~~~~~sp~~~lf~~~~~~~~~~~  734 (750)
                      +||    ||++|+     +++++|+..++..++.+|+..|
T Consensus       146 lA~----~di~N~-----sasssalalL~~sSs~sIS~dL  176 (199)
T 2o8s_A          146 TIX----WEXQNP-----STTYDPLAVFGSSSGYGISPDL  176 (199)
T ss_dssp             HHH----HHHHCC---------------------------
T ss_pred             HHH----HHHHCC-----CCCCCHHHHHCCCCCCCCCHHH
T ss_conf             999----998665-----6788688887068754448899



>2o8s_A (A:69-192) AGR_C_984P; all alpha-helical protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Agrobacterium tumefaciens str} Back     alignment and structure
>2o8s_A (A:69-192) AGR_C_984P; all alpha-helical protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Agrobacterium tumefaciens str} Back     alignment and structure
>2o8s_A (A:1-68,A:193-323) AGR_C_984P; all alpha-helical protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Agrobacterium tumefaciens str} Back     alignment and structure