254781078

254781078

hypothetical protein CLIBASIA_04900

GeneID in NCBI database:8210102Locus tag:CLIBASIA_04900
Protein GI in NCBI database:254781078Protein Accession:YP_003065491.1
Gene range:-(1079073, 1079801)Protein Length:242aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED2 TM-Helix
HMMTOP3 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMyes
SignalP_NNyes
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240--
MNFNGYGALFFVVFLSIVVPNHSLAVDLYLPRKIDLFNEADNNVEYQDDEYGIWSGNYVGLHISRLYETHPLADTINRKTYNSLLPNGLGIELGHNIQLEDFVFGINCHTTAAKDDSTFYRLKEKYFIYGDVVLKAGYSVDSLLIYGMGGFGGAYVIDSSLEKVESDNSKNAKGRFDGHGSSVVLGIGLDYMVNYDISLSASYRYIPHHIHSVNNSNAKSDVERVDRKGNAHIASLGINMHF
ccccccHHHHHHHHHHHHcccccEEEEEEEccEEEcccccccccEEccccccccEEEEEEEEEEccccccccccccccccccccccccEEEEEEEEEccccEEEEEEEEEEEccccccccEEEEccEEEEEEEEEEEEEEccccEEEEEEEEEEEEEEccccccccccccccccccccccccEEEEEcEEEcccccEEEEEEEEEEEEcccccccccccccccEEEEcccEEEEEEEEEEEc
ccccccHHEEEEEEEEEEccccccEEEEcccccEEcccccccccEEccccccccccccccccEcccccccccHccccccccccccccccEEEEEEEEEEccEEEEEcccEEEEcccccEEEEEccEEEEEEEEEEEEEEEcEEEEEEccccccEEEEcccccEEEcccccccccccccccccEEEEEEEEEEEcccEEEEEEEEEccccEEEEccccccccEEEEcccccEEEEEEEEEccc
MNFNGYGALFFVVFLSIVvpnhslavdlylprkidlfneadnnveyqddeygiwsgnYVGLHISRlyethpladtinrktynsllpnglgielghniqledfvfginchttaakddstfyRLKEKYFIYGDVVLKAGYSVDSLLIYGMGGFGGAYVIDSslekvesdnsknakgrfdghgssVVLGIGLDYMVNYDISLSasyryiphhihsvnnsnaksdvervdrkGNAHIASLGINMHF
MNFNGYGALFFVVFLSIVVPNHSLAVDLYLPRKIDLFNEADNNVEYQDDEYGIWSGNYVGLHISRLYETHPLADTINRKTYNSLLPNGLGIELGHNIQLEDFVFGINCHTtaakddstfyRLKEKYFIYGDVVLKAGYSVDSLLIYGMGGFGGAYVIDSSLEKVESDNSknakgrfdghgsSVVLGIGLDYMVNYDISLSASYRYIPHHihsvnnsnaksdVERVDRKGNAHiaslginmhf
MNFNGYGALFFVVFLSIVVPNHSLAVDLYLPRKIDLFNEADNNVEYQDDEYGIWSGNYVGLHISRLYETHPLADTINRKTYNSLLPNGLGIELGHNIQLEDFVFGINCHTTAAKDDSTFYRLKEKYFIYGDVVLKAGYSVDSLLIYGMGGFGGAYVIDSSLEKVESDNSKNAKGRFDGHGSSVVLGIGLDYMVNYDISLSASYRYIPHHIHSVNNSNAKSDVERVDRKGNAHIASLGINMHF
****GYGALFFVVFLSIVVPNHSLAVDLYLPRKIDLFNEADNNVEYQDDEYGIWSGNYVGLHISRLYETHPLADTINRKTYNSLLPNGLGIELGHNIQLEDFVFGINCHTTAAKDDSTFYRLKEKYFIYGDVVLKAGYSVDSLLIYGMGGFGGAYVIDSSLEKVESDNSKNAKGRFDGHGSSVVLGIGLDYMVNYDISLSASYRYIPHHIHSVNNSNAKSDVERVDRKGNAHIASLGINMHF
MNFNGYGALFFVVFLSIVVPNHSLAVDLYLPRKIDLFNEADNNVEYQDDEYGIWSGNYVGLHISRLYETHPLADTINRKTYNSLLPNGLGIELGHNIQLEDFVFGINCHTTAAKDDSTFYRLKEKYFIYGDVVLKAGYSVDSLLIYGMGGFGGAYVIDSSLEKVESDNSKNAKGRFDGHGSSVVLGIGLDYMVNYDISLSASYRYIPHHIHSVNNSNAKSDVERVDRKGNAHIASLGINMHF
*NFNGYGALFFVVFLSIVVPNHSLAVDLYLPRKIDLFNEADNNVEYQDDEYGIWSGNYVGLHISRLYETHPLADTINRKTYNSLLPNGLGIELGHNIQLEDFVFGINCHTTAAKDDSTFYRLKEKYFIYGDVVLKAGYSVDSLLIYGMGGFGGAYVIDSSLEKVESDN***AKGRFDGHGSSVVLGIGLDYMVNYDISLSASYRYIPHHIHSVNNSNAKSDVERVDRKGNAHIASLGINMHF
iiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
MNFNGYGALFFVVFLSIVVPNHSLAVDLYLPRKIDLFNEADNNVEYQDDEYGIWSGNYVGLHISRLYETHPLADTINRKTYNSLLPNGLGIELGHNIQLEDFVFGINCHTTAAKDDSTFYRLKEKYFIYGDVVLKAGYSVDSLLIYGMGGFGGAYVIDSSLEKVESDNSKNAKGRFDGHGSSVVLGIGLDYMVNYDISLSASYRYIPHHIHSVNNSNAKSDVERVDRKGNAHIASLGINMHF
MNFNGYGALFFVVFLSIVVPNHSLAVDLYLPRKIDLFNEADNNVEYQDDEYGIWSGNYVGLHISRLYETHPLADTINRKTYNSLLPNGLGIELGHNIQLEDFVFGINCHTTAAKDDSTFYRLKEKYFIYGDVVLKAGYSVDSLLIYGMGGFGGAYVIDSSLEKVESDNSKNAKGRFDGHGSSVVLGIGLDYMVNYDISLSASYRYIPHHIHSVNNSNAKSDVERVDRKGNAHIASLGINMHF
MNFNGYGALFFVVFLSIVVPNHSLAVDLYLPRKIDLFNEADNNVEYQDDEYGIWSGNYVGLHISRLYETHPLADTINRKTYNSLLPNGLGIELGHNIQLEDFVFGINCHTTAAKDDSTFYRLKEKYFIYGDVVLKAGYSVDSLLIYGMGGFGGAYVIDSSLEKVESDNSKNAKGRFDGHGSSVVLGIGLDYMVNYDISLSASYRYIPHHIHSVNNSNAKSDVERVDRKGNAHIASLGINMHF

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target242 hypothetical protein CLIBASIA_04900 [Candidatus Liberib
315122463294 hypothetical protein CKC_03575 [Candidatus Liberibacter 1 1e-28
170750202 708 carbohydrate-selective porin OprB [Methylobacterium rad 1 8e-05
90422419207 putative outer-membrane immunogenic protein precursor [ 1 9e-05
312113967294 porin [Rhodomicrobium vannielii ATCC 17100] Length = 29 1 3e-04
312114546250 outer membrane protein [Rhodomicrobium vannielii ATCC 1 1 4e-04
13474724205 outer membrane protein [Mesorhizobium loti MAFF303099] 1 6e-04
83308662238 outer membrane protein [uncultured bacterium] Length = 1 0.001
312113068260 hypothetical protein Rvan_0276 [Rhodomicrobium vannieli 1 0.001
110632458237 outer membrane protein, 31 kDa [Mesorhizobium sp. BNC1] 1 0.002
27382580208 outer-membrane immunogenic protein [Bradyrhizobium japo 1 0.003
>gi|315122463|ref|YP_004062952.1| hypothetical protein CKC_03575 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 294 Back     alignment and organism information
 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 86/217 (39%), Positives = 134/217 (61%), Gaps = 11/217 (5%)

Query: 37  FNEADNNVEYQDDEYGIWSGNYVGLHISRLYETHPLADTINRKTYNSLLPNGLGIELGHN 96
           F+   NN+EY DDEYGIW G +VG++ S  +           K  +S     +GI+ G++
Sbjct: 77  FDNRCNNIEYLDDEYGIWEGIHVGINFSSQHYNQAFYYEPYNKAKSSFNKYKVGIDTGYD 136

Query: 97  IQLEDFVFGINCHTTAAK----------DDSTFYRLKEKYFIYGDVVLKAGYSVDSLLIY 146
           +  EDFV+G+   +  +K          D + F+R+K  Y IYGD + +AGYSVDS+L+Y
Sbjct: 137 LHTEDFVYGLRFSSNFSKGLEANAKLSSDQALFHRMKAGYSIYGDALFRAGYSVDSVLVY 196

Query: 147 GMGGFGGAYVIDSSLEKVESDNSKNAKGRFDGHGSSVVLGIGLDYMVNYDISLSASYRYI 206
           G+GG GG Y+ +S+L+K++ + S N   +F G+G  +VLG+G+DYM+  +IS++ SYRY 
Sbjct: 197 GLGGLGGTYIGNSTLQKIDKEGSGNHATKFSGYGVGIVLGVGVDYMIWDNISVTTSYRYA 256

Query: 207 PHHIHSVN-NSNAKSDVERVDRKGNAHIASLGINMHF 242
           PH I   N + +A   ++ ++   NAHI SLG++MH 
Sbjct: 257 PHSIRFNNISKDASETIKEINGTSNAHIISLGLSMHL 293


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|170750202|ref|YP_001756462.1| carbohydrate-selective porin OprB [Methylobacterium radiotolerans JCM 2831] Length = 708 Back     alignment and organism information
>gi|90422419|ref|YP_530789.1| putative outer-membrane immunogenic protein precursor [Rhodopseudomonas palustris BisB18] Length = 207 Back     alignment and organism information
>gi|312113967|ref|YP_004011563.1| porin [Rhodomicrobium vannielii ATCC 17100] Length = 294 Back     alignment and organism information
>gi|312114546|ref|YP_004012142.1| outer membrane protein [Rhodomicrobium vannielii ATCC 17100] Length = 250 Back     alignment and organism information
>gi|13474724|ref|NP_106293.1| outer membrane protein [Mesorhizobium loti MAFF303099] Length = 205 Back     alignment and organism information
>gi|83308662|emb|CAJ01570.1| outer membrane protein [uncultured bacterium] Length = 238 Back     alignment and organism information
>gi|312113068|ref|YP_004010664.1| hypothetical protein Rvan_0276 [Rhodomicrobium vannielii ATCC 17100] Length = 260 Back     alignment and organism information
>gi|110632458|ref|YP_672666.1| outer membrane protein, 31 kDa [Mesorhizobium sp. BNC1] Length = 237 Back     alignment and organism information
>gi|27382580|ref|NP_774109.1| outer-membrane immunogenic protein [Bradyrhizobium japonicum USDA 110] Length = 208 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target242 hypothetical protein CLIBASIA_04900 [Candidatus Liberib
pfam01389175 pfam01389, OmpA_membrane, OmpA-like transmembrane domai 0.001
>gnl|CDD|110393 pfam01389, OmpA_membrane, OmpA-like transmembrane domain Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 242 hypothetical protein CLIBASIA_04900 [Candidatus Liberib
COG3637199 Opacity protein and related surface antigens [Cell enve 100.0
PRK10808 347 outer membrane protein A; Reviewed 99.9
pfam01389175 OmpA_membrane OmpA-like transmembrane domain. The struc 99.92
pfam03797265 Autotransporter Autotransporter beta-domain. Secretion 95.78
TIGR01414454 autotrans_barl outer membrane autotransporter barrel do 95.11
pfam02462126 Opacity Opacity family porin protein. Pathogenic Neisse 99.37
PRK09408171 ompX outer membrane protein X; Provisional 99.23
pfam06316199 Ail_Lom Enterobacterial Ail/Lom protein. This family co 99.01
COG2067440 FadL Long-chain fatty acid transport protein [Lipid met 98.52
pfam05736184 OprF OprF membrane domain. This domain represents the p 98.1
pfam03349415 Toluene_X Outer membrane protein transport protein (OMP 97.84
pfam06629226 MipA MltA-interacting protein MipA. This family consist 97.49
smart00869261 Autotransporter Autotransporter beta-domain. Secretion 96.51
pfam02530378 Porin_2 Porin subfamily. This family consists of porins 99.33
COG5338 468 Uncharacterized protein conserved in bacteria [Function 95.32
PRK10959212 outer membrane protein W; Provisional 99.07
pfam03922189 OmpW OmpW family. This family includes outer membrane p 98.91
COG3047213 OmpW Outer membrane protein W [Cell envelope biogenesis 98.43
COG2067440 FadL Long-chain fatty acid transport protein [Lipid met 97.94
pfam11383273 DUF3187 Protein of unknown function (DUF3187). This fam 94.44
pfam07585338 DUF1551 Protein of unknown function (DUF1551). A family 92.17
pfam03349415 Toluene_X Outer membrane protein transport protein (OMP 98.85
PRK10716437 long-chain fatty acid outer membrane transporter; Provi 98.48
PRK10716437 long-chain fatty acid outer membrane transporter; Provi 98.47
cd00342329 gram_neg_porins Porins form aqueous channels for the di 97.18
COG3203354 OmpC Outer membrane protein (porin) [Cell envelope biog 96.73
pfam10082380 DUF2320 Uncharacterized protein conserved in bacteria ( 96.08
pfam00267334 Porin_1 Gram-negative porin. 95.66
pfam05420339 BCSC_C Cellulose synthase operon protein C C-terminus ( 94.85
pfam11854675 DUF3374 Protein of unknown function (DUF3374). This fam 94.75
PRK12580312 outer membrane protease; Reviewed 94.04
pfam01278295 Omptin Omptin family. The omptin family is a family of 93.34
COG4625577 Uncharacterized protein with a C-terminal OMP (outer me 91.81
PRK09980230 ompL outer membrane porin L; Provisional 91.16
PRK10993311 outer membrane protease; Reviewed 91.14
PRK10159351 outer membrane phosphoporin protein E; Provisional 90.71
pfam07437180 YfaZ YfaZ precursor. This family contains the precursor 98.34
pfam01617279 Surface_Ag_2 Surface antigen. This family includes a nu 92.75
pfam03797265 Autotransporter Autotransporter beta-domain. Secretion 98.26
smart00869261 Autotransporter Autotransporter beta-domain. Secretion 97.79
PRK097521250 adhesin; Provisional 95.75
COG3468592 AidA Type V secretory pathway, adhesin AidA [Cell envel 93.7
pfam12099186 DUF3575 Protein of unknown function (DUF3575). This fam 96.91
pfam11854 675 DUF3374 Protein of unknown function (DUF3374). This fam 95.6
pfam05736184 OprF OprF membrane domain. This domain represents the p 95.53
PRK114471158 cellulose synthase subunit BcsC; Provisional 94.75
pfam06082 661 DUF940 Bacterial putative lipoprotein (DUF940). This fa 93.43
>COG3637 Opacity protein and related surface antigens [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK10808 outer membrane protein A; Reviewed Back     alignment and domain information
>pfam01389 OmpA_membrane OmpA-like transmembrane domain Back     alignment and domain information
>pfam03797 Autotransporter Autotransporter beta-domain Back     alignment and domain information
>TIGR01414 autotrans_barl outer membrane autotransporter barrel domain; InterPro: IPR006315 The secretion of protein products occurs by a number of different pathways in bacteria and several secretion mechanisms have been described for Gram-negative bacteria , an increasing number employ a highly efficient but simple mechanism first described for the immunoglobulin A1 (IgA1) proteases , Back     alignment and domain information
>pfam02462 Opacity Opacity family porin protein Back     alignment and domain information
>PRK09408 ompX outer membrane protein X; Provisional Back     alignment and domain information
>pfam06316 Ail_Lom Enterobacterial Ail/Lom protein Back     alignment and domain information
>COG2067 FadL Long-chain fatty acid transport protein [Lipid metabolism] Back     alignment and domain information
>pfam05736 OprF OprF membrane domain Back     alignment and domain information
>pfam03349 Toluene_X Outer membrane protein transport protein (OMPP1/FadL/TodX) Back     alignment and domain information
>pfam06629 MipA MltA-interacting protein MipA Back     alignment and domain information
>smart00869 Autotransporter Autotransporter beta-domain Back     alignment and domain information
>pfam02530 Porin_2 Porin subfamily Back     alignment and domain information
>COG5338 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK10959 outer membrane protein W; Provisional Back     alignment and domain information
>pfam03922 OmpW OmpW family Back     alignment and domain information
>COG3047 OmpW Outer membrane protein W [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG2067 FadL Long-chain fatty acid transport protein [Lipid metabolism] Back     alignment and domain information
>pfam11383 DUF3187 Protein of unknown function (DUF3187) Back     alignment and domain information
>pfam07585 DUF1551 Protein of unknown function (DUF1551) Back     alignment and domain information
>pfam03349 Toluene_X Outer membrane protein transport protein (OMPP1/FadL/TodX) Back     alignment and domain information
>PRK10716 long-chain fatty acid outer membrane transporter; Provisional Back     alignment and domain information
>PRK10716 long-chain fatty acid outer membrane transporter; Provisional Back     alignment and domain information
>cd00342 gram_neg_porins Porins form aqueous channels for the diffusion of small hydrophillic molecules across the outer membrane Back     alignment and domain information
>COG3203 OmpC Outer membrane protein (porin) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>pfam10082 DUF2320 Uncharacterized protein conserved in bacteria (DUF2320) Back     alignment and domain information
>pfam00267 Porin_1 Gram-negative porin Back     alignment and domain information
>pfam05420 BCSC_C Cellulose synthase operon protein C C-terminus (BCSC_C) Back     alignment and domain information
>pfam11854 DUF3374 Protein of unknown function (DUF3374) Back     alignment and domain information
>PRK12580 outer membrane protease; Reviewed Back     alignment and domain information
>pfam01278 Omptin Omptin family Back     alignment and domain information
>COG4625 Uncharacterized protein with a C-terminal OMP (outer membrane protein) domain [Function unknown] Back     alignment and domain information
>PRK09980 ompL outer membrane porin L; Provisional Back     alignment and domain information
>PRK10993 outer membrane protease; Reviewed Back     alignment and domain information
>PRK10159 outer membrane phosphoporin protein E; Provisional Back     alignment and domain information
>pfam07437 YfaZ YfaZ precursor Back     alignment and domain information
>pfam01617 Surface_Ag_2 Surface antigen Back     alignment and domain information
>pfam03797 Autotransporter Autotransporter beta-domain Back     alignment and domain information
>smart00869 Autotransporter Autotransporter beta-domain Back     alignment and domain information
>PRK09752 adhesin; Provisional Back     alignment and domain information
>COG3468 AidA Type V secretory pathway, adhesin AidA [Cell envelope biogenesis, outer membrane / Intracellular trafficking and secretion] Back     alignment and domain information
>pfam12099 DUF3575 Protein of unknown function (DUF3575) Back     alignment and domain information
>pfam11854 DUF3374 Protein of unknown function (DUF3374) Back     alignment and domain information
>pfam05736 OprF OprF membrane domain Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>pfam06082 DUF940 Bacterial putative lipoprotein (DUF940) Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target242 hypothetical protein CLIBASIA_04900 [Candidatus Liberib
3nb3_A 346 The Host Outer Membrane Proteins Ompa And Ompc Are 4e-09
1bxw_A172 Outer Membrane Protein A (Ompa) Transmembrane Domai 1e-05
2ge4_A177 High-Resolution Solution Structure Of Outer Membran 2e-05
1qjp_A171 High Resolution Structure Of The Outer Membrane Pro 2e-05
1g90_A176 Nmr Solution Structure Of Outer Membrane Protein A 3e-05
2k0l_A216 Nmr Structure Of The Transmembrane Domain Of The Ou 5e-05
>gi|323462898|pdb|3NB3|A Chain A, The Host Outer Membrane Proteins Ompa And Ompc Are Packed At Specific Sites In The Shigella Phage Sf6 Virion As Structural Components Length = 346 Back     alignment and structure
 Score = 66.0 bits (159), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 36/191 (18%), Positives = 61/191 (31%), Gaps = 32/191 (16%)

Query: 57  NYVGLHISRLYETHPLADTINRKTYNSLLPNGLGIELGHNIQLEDFVFGINCHTTAAK-- 114
            Y G  +   +  +     IN          G G   G+  Q+  +V G           
Sbjct: 28  WYTGAKLG--WSQYHDTGFINNNGPTHENKLGAGAFGGY--QVNPYV-GFEMGYDWLGRM 82

Query: 115 -DDSTFYRLKEKYFIYGDVVLKAGYSV-DSLLIYGM-GGFGGAYVIDSSLEKVESDNSKN 171
               +      K      +  K GY + D L IY   GG               +D   N
Sbjct: 83  PYKGSVENGAYKAQGV-QLTAKLGYPITDDLDIYTRLGGMVWR-----------ADTYSN 130

Query: 172 AKGRFDGHGSSVVLGIGLDYMVNYDISLSASYRYIPHHIHSVNNSNAKSDVERVDRKGNA 231
             G+    G S V   G++Y +  +I+    Y++          +N   D   +  + + 
Sbjct: 131 VYGKNHDTGVSPVFAGGVEYAITPEIATRLEYQW----------TNNIGDAHTIGTRPDN 180

Query: 232 HIASLGINMHF 242
            + SLG++  F
Sbjct: 181 GMLSLGVSYRF 191


>gi|4140005|pdb|1BXW|A Chain A, Outer Membrane Protein A (Ompa) Transmembrane Domain Length = 172 Back     alignment and structure
>gi|99032472|pdb|2GE4|A Chain A, High-Resolution Solution Structure Of Outer Membrane Protein A Transmembrane Domain Length = 177 Back     alignment and structure
>gi|14278420|pdb|1G90|A Chain A, Nmr Solution Structure Of Outer Membrane Protein A Transmembrane Domain: 10 Conformers Length = 176 Back     alignment and structure
>gi|218766516|pdb|2K0L|A Chain A, Nmr Structure Of The Transmembrane Domain Of The Outer Membrane Protein A From Klebsiella Pneumoniae In Dhpc Micelles Length = 216 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target242 hypothetical protein CLIBASIA_04900 [Candidatus Liberib
2f1v_A197 Outer membrane protein W; outer membrane protein beta b 9e-05
2k0l_A216 Outer membrane protein A; OMPA, trosy, sidechain, DHPC 0.001
1orm_A148 Outer membrane protein X; OMPX, trosy, DHPC, detergents 1e-04
>2f1v_A Outer membrane protein W; outer membrane protein beta barrel; 2.70A {Escherichia coli K12} PDB: 2f1t_A Length = 197 Back     alignment and structure
 Score = 42.6 bits (99), Expect = 9e-05
 Identities = 20/157 (12%), Positives = 42/157 (26%), Gaps = 7/157 (4%)

Query: 89  LGIELGHNIQLEDFVFGINCHTTAAKDDSTFYRLKEKYFIYGDVVLKAGY---SVDSLLI 145
           LG+   +       V  +       K  +               ++   Y   +      
Sbjct: 39  LGLTFTYMATDNIGVELLAATPFRHKIGTRATGDIATVHHLPPTLMAQWYFGDASSKFRP 98

Query: 146 YGMGGFGGAYVIDSSLEKVESDNSKNAKGRFDGHGSSVVLGIGLDYMVNYDISLSASYRY 205
           Y   G       D+       +   +     D  G      +G+DY++N D  ++ S  Y
Sbjct: 99  YVGAGINYTTFFDNGFNDHGKEAGLSDLSLKDSWG--AAGQVGVDYLINRDWLVNMSVWY 156

Query: 206 IPHHIHSVNNSNAKSDVERVDRKGNAHIASLGINMHF 242
           +   I +  N       +    + +  +        F
Sbjct: 157 MD--IDTTANYKLGGAQQHDSVRLDPWVFMFSAGYRF 191


>2k0l_A Outer membrane protein A; OMPA, trosy, sidechain, DHPC micelles; NMR {Klebsiella pneumoniae} Length = 216 Back     alignment and structure
>1orm_A Outer membrane protein X; OMPX, trosy, DHPC, detergents, lipids, micelles; NMR {Escherichia coli} SCOP: f.4.1.1 PDB: 1q9f_A 1q9g_A 1qj8_A* 1qj9_A Length = 148 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target242 hypothetical protein CLIBASIA_04900 [Candidatus Liberib
1p4t_A155 Outer membrane protein NSPA; beta barrel; HET: CXE; 2.5 99.9
2k0l_A216 Outer membrane protein A; OMPA, trosy, sidechain, DHPC 99.87
1qjp_A171 Outer membrane protein A; HET: C8E; 1.65A {Escherichia 99.82
2jmm_A156 Outer membrane protein A; NMR {Escherichia coli} 99.68
1uyn_X308 NALP; autotransporter, translocator domain, membrane pr 98.99
3aeh_A308 Hemoglobin-binding protease HBP autotransporter; beta-b 98.95
2qom_A285 Serine protease ESPP; outer membrane protein, beta-barr 98.95
3kvn_X632 Esterase ESTA; beta barrel, alpha-beta-alpha motif, cel 98.86
1orm_A148 Outer membrane protein X; OMPX, trosy, DHPC, detergents 99.87
2f1v_A197 Outer membrane protein W; outer membrane protein beta b 99.82
3dwo_X451 Probable outer membrane protein; beta barrel; HET: C8E; 98.2
2qom_A285 Serine protease ESPP; outer membrane protein, beta-barr 95.72
2x55_A293 Coagulase/fibrinolysin; plasminogen activator, transmem 98.95
3dwo_X451 Probable outer membrane protein; beta barrel; HET: C8E; 98.43
3bs0_A439 TODX; beta barrel, outer membrane protein, transport pr 98.26
3dwn_A427 Long-chain fatty acid transport protein; beta barrel, o 98.2
3dwn_A427 Long-chain fatty acid transport protein; beta barrel, o 98.08
2fgq_X332 OMP32, outer membrane porin protein 32; malate, outer m 97.49
1i78_A297 Protease VII; integral outer membrane protein, beta bar 97.4
3bry_A441 TBUX; beta barrel, outer membrane protein, transport pr 97.29
1pho_A330 Phosphoporin; outer membrane protein; 3.00A {Escherichi 97.28
3bs0_A439 TODX; beta barrel, outer membrane protein, transport pr 97.26
2j1n_A346 Outer membrane protein C; beta-barrel, ION transport, n 97.24
2zfg_A340 Outer membrane protein F; OMPF porin, ordered waters, I 96.59
3bry_A441 TBUX; beta barrel, outer membrane protein, transport pr 96.42
2f1c_X286 OMPG, outer membrane protein G; beta barrel; HET: C8E; 95.12
3prn_A289 Porin; integral membrane protein, pore eyelet mutant; H 93.75
3a2s_X355 Outer membrane protein II; beta barrel, porin, neisseri 90.52
3kvn_X632 Esterase ESTA; beta barrel, alpha-beta-alpha motif, cel 97.58
3aeh_A308 Hemoglobin-binding protease HBP autotransporter; beta-b 96.78
1uyn_X308 NALP; autotransporter, translocator domain, membrane pr 96.52
1qjp_A171 Outer membrane protein A; HET: C8E; 1.65A {Escherichia 96.25
2k0l_A216 Outer membrane protein A; OMPA, trosy, sidechain, DHPC 96.1
>1p4t_A Outer membrane protein NSPA; beta barrel; HET: CXE; 2.55A {Neisseria meningitidis} SCOP: f.4.1.1 Back     alignment and structure
Probab=99.90  E-value=3.5e-22  Score=138.79  Aligned_cols=151  Identities=16%  Similarity=0.102  Sum_probs=100.1

Q ss_pred             EEEEEEEEEEEEEEEEECCCCCCCCCCCCCCCCEEEEEEEEEEEECCEEEEEEEEEEEECCCCCCCCCCCCCEEEEEEEE
Q ss_conf             00574446441033222145556666676675504799886554457799999886740477764323101003679899
Q gi|254781078|r   55 SGNYVGLHISRLYETHPLADTINRKTYNSLLPNGLGIELGHNIQLEDFVFGINCHTTAAKDDSTFYRLKEKYFIYGDVVL  134 (242)
Q Consensus        55 tG~YiG~~~G~~~~~~~~~d~~~~~~~n~~~~~g~G~~~GYN~Q~~~~V~GvE~d~~~~~~~~~~~~~~~k~~~~Gsvr~  134 (242)
                      +|||||+++|++....+..+         ..+...++.+||  ||++|.  +|+++.+........ ...+. ..-.+.+
T Consensus         4 ~Gfyv~~~~g~~~~~~~~~~---------~~g~~~~~~~GY--~f~~~~--~e~~y~~~~~~~~~~-~~~~~-~~~~l~~   68 (155)
T 1p4t_A            4 SGFYVQADAAHAKASSSLGS---------AKGFSPRISAGY--RINDLR--FAVDYTRYKNYKAPS-TDFKL-YSIGASA   68 (155)
T ss_dssp             EEEEEEEEEEEEEEECSSCE---------EEEECCEEEEEE--EETTEE--EEEEEEEEEESSCCS-SCCEE-EEEEEEE
T ss_pred             CCEEEEEEEEEECCCCCCCC---------CCCEEEEEEEEE--ECCCEE--EEEEEEEECCCCCCC-CCEEE-EEEEEEE
T ss_conf             43389687547024467787---------885768999999--827999--999999824556788-63578-9999999


Q ss_pred             EEEEE-ECCEEEEEEEEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCEEEEEEEEEEEECCCCEEEEEEEEEEECCCCEE
Q ss_conf             98633-14403444401145753011000236666555543455653037987316673278768888988874487300
Q gi|254781078|r  135 KAGYS-VDSLLIYGMGGFGGAYVIDSSLEKVESDNSKNAKGRFDGHGSSVVLGIGLDYMVNYDISLSASYRYIPHHIHSV  213 (242)
Q Consensus       135 r~Gya-~~~~l~Y~~gG~A~~~~~~~~~~~~~~~~~~~~~~~~d~t~~G~tvGaGVEYait~nwslraEY~Y~d~g~~~~  213 (242)
                      +.-+. .+++.||+++|+++.+++.....          ....+.+..+|.+|+|+||++++||++++||||++.++.. 
T Consensus        69 ~y~~~~~~~~~py~~~G~g~~~~~~~~~~----------~~~~~~~~~~~~~g~G~~y~~~~~~~~~~ey~y~~~~~~~-  137 (155)
T 1p4t_A           69 IYDFDTQSPVKPYLGARLSLNRASVDLGG----------SDSFSQTSIGLGVLTGVSYAVTPNVDLDAGYRYNYIGKVN-  137 (155)
T ss_dssp             EEECCCSSSEEEEEEEEEEEEEEEEEETT----------EEEECCCEEEEEEEEEEEEEEETTEEEEEEEEEEEEEEET-
T ss_pred             EEEECCCCCEEEEEEEEEEEEEEECCCCC----------CCCCCCCEEEEEEEEEEEEEECCCEEEEEEEEEEECCCCC-
T ss_conf             99843677577999965789998714333----------0014785060475114999717899999999998767876-


Q ss_pred             ECCCCCCCCCCCCCCCCEEEEEEEEEEEC
Q ss_conf             03666666442201234138999886209
Q gi|254781078|r  214 NNSNAKSDVERVDRKGNAHIASLGINMHF  242 (242)
Q Consensus       214 ~~~~~~~~~~~~~~~~~~h~v~~GinY~F  242 (242)
                                 .+.+.+.|.+++||+|||
T Consensus       138 -----------~~~~~~~~~~~~Gl~Y~F  155 (155)
T 1p4t_A          138 -----------TVKNVRSGELSAGVRVKF  155 (155)
T ss_dssp             -----------TEEEEEEEEEEEEEEEEC
T ss_pred             -----------CCCCEEEEEEEEEEEEEC
T ss_conf             -----------674300369999999999



>2k0l_A Outer membrane protein A; OMPA, trosy, sidechain, DHPC micelles; NMR {Klebsiella pneumoniae} Back     alignment and structure
>1qjp_A Outer membrane protein A; HET: C8E; 1.65A {Escherichia coli} SCOP: f.4.1.1 PDB: 1bxw_A* 1g90_A 2ge4_A Back     alignment and structure
>2jmm_A Outer membrane protein A; NMR {Escherichia coli} Back     alignment and structure
>1uyn_X NALP; autotransporter, translocator domain, membrane protein, outer membrane, beta-domain, beta-barrel; HET: CXE; 2.6A {Neisseria meningitidis} SCOP: f.4.5.1 PDB: 1uyo_X* Back     alignment and structure
>3aeh_A Hemoglobin-binding protease HBP autotransporter; beta-barrel, auto-proteolytic, reaction intermediate, mutant membrane, cell outer membrane; 2.00A {Escherichia coli} Back     alignment and structure
>2qom_A Serine protease ESPP; outer membrane protein, beta-barrel, beta-domain, autotransporter, hydrolase, plasmid, secreted, transmembrane; 2.66A {Escherichia coli O157} Back     alignment and structure
>3kvn_X Esterase ESTA; beta barrel, alpha-beta-alpha motif, cell membrane, cell outer membrane, hydrolase, membrane, transmembrane; HET: C8E; 2.50A {Pseudomonas aeruginosa} Back     alignment and structure
>1orm_A Outer membrane protein X; OMPX, trosy, DHPC, detergents, lipids, micelles; NMR {Escherichia coli} SCOP: f.4.1.1 PDB: 1q9f_A 1q9g_A 1qj8_A* 1qj9_A Back     alignment and structure
>2f1v_A Outer membrane protein W; outer membrane protein beta barrel; 2.70A {Escherichia coli K12} PDB: 2f1t_A Back     alignment and structure
>3dwo_X Probable outer membrane protein; beta barrel; HET: C8E; 2.20A {Pseudomonas aeruginosa} Back     alignment and structure
>2qom_A Serine protease ESPP; outer membrane protein, beta-barrel, beta-domain, autotransporter, hydrolase, plasmid, secreted, transmembrane; 2.66A {Escherichia coli O157} Back     alignment and structure
>2x55_A Coagulase/fibrinolysin; plasminogen activator, transmembrane, aspartyl protease, CEL membrane, omptin, protease, hydrolase,; HET: C8E; 1.85A {Yersinia pestis} PDB: 2x56_A* 2x4m_A* Back     alignment and structure
>3dwo_X Probable outer membrane protein; beta barrel; HET: C8E; 2.20A {Pseudomonas aeruginosa} Back     alignment and structure
>3bs0_A TODX; beta barrel, outer membrane protein, transport protein; HET: C8E; 2.60A {Pseudomonas putida} PDB: 3brz_A* Back     alignment and structure
>3dwn_A Long-chain fatty acid transport protein; beta barrel, outer membrane protein, lipid transport, membrane, outer membrane, phage recognition; HET: LDA; 2.50A {Escherichia coli} PDB: 1t16_A* 1t1l_A* 2r4p_A* 2r4n_A* 2r4l_A* 2r4o_A* 2r89_A 2r8a_A* 2r88_A Back     alignment and structure
>3dwn_A Long-chain fatty acid transport protein; beta barrel, outer membrane protein, lipid transport, membrane, outer membrane, phage recognition; HET: LDA; 2.50A {Escherichia coli} PDB: 1t16_A* 1t1l_A* 2r4p_A* 2r4n_A* 2r4l_A* 2r4o_A* 2r89_A 2r8a_A* 2r88_A Back     alignment and structure
>2fgq_X OMP32, outer membrane porin protein 32; malate, outer membrane protein; HET: BOG; 1.45A {Delftia acidovorans} SCOP: f.4.3.1 PDB: 2fgr_A 1e54_A Back     alignment and structure
>1i78_A Protease VII; integral outer membrane protein, beta barrel, hydrolase; HET: BOG; 2.60A {Escherichia coli K12} SCOP: f.4.4.1 Back     alignment and structure
>3bry_A TBUX; beta barrel, outer membrane protein, transport protein; HET: C8E; 3.20A {Ralstonia pickettii} Back     alignment and structure
>1pho_A Phosphoporin; outer membrane protein; 3.00A {Escherichia coli} SCOP: f.4.3.1 Back     alignment and structure
>3bs0_A TODX; beta barrel, outer membrane protein, transport protein; HET: C8E; 2.60A {Pseudomonas putida} PDB: 3brz_A* Back     alignment and structure
>2j1n_A Outer membrane protein C; beta-barrel, ION transport, non-specific porin, general porin, osmoporin, transmembrane transport; HET: D12; 2.0A {Escherichia coli} PDB: 2j4u_P 2zle_D 2ixx_A* 2xe1_A* 2xe2_A* 2ixw_A* 2xe5_A* 2xe3_A* 2xg6_A 1osm_A* Back     alignment and structure
>2zfg_A Outer membrane protein F; OMPF porin, ordered waters, ION transport, phage recognition, transmembrane, transport; HET: C8E; 1.59A {Escherichia coli} SCOP: f.4.3.1 PDB: 1opf_A* 2omf_A* 2zld_A 3k19_A 3k1b_A 3hw9_A* 3hwb_A* 1hxx_A 3fyx_A* 1bt9_A 1mpf_A* 1gfq_A* 1gfp_A* 1gfm_A* 1gfo_A* 1hxu_A 1hxt_A* 1gfn_A* Back     alignment and structure
>3bry_A TBUX; beta barrel, outer membrane protein, transport protein; HET: C8E; 3.20A {Ralstonia pickettii} Back     alignment and structure
>2f1c_X OMPG, outer membrane protein G; beta barrel; HET: C8E; 2.30A {Escherichia coli K12} PDB: 2wvp_A* 2jqy_A 2iwv_A* 2iww_A* Back     alignment and structure
>3prn_A Porin; integral membrane protein, pore eyelet mutant; HET: C8E; 1.90A {Rhodobacter blasticus} SCOP: f.4.3.1 PDB: 1bh3_A* 1prn_A* 7prn_A* 6prn_A* 5prn_A* 2prn_A* 8prn_A* 1h6s_1 Back     alignment and structure
>3a2s_X Outer membrane protein II; beta barrel, porin, neisseria mening cell membrane, cell outer membrane, ION transport, membrane transmembrane; HET: SUC LDA; 2.20A {Neisseria meningitidis} PDB: 3a2r_X* 3a2t_X* 3a2u_X* Back     alignment and structure
>3kvn_X Esterase ESTA; beta barrel, alpha-beta-alpha motif, cell membrane, cell outer membrane, hydrolase, membrane, transmembrane; HET: C8E; 2.50A {Pseudomonas aeruginosa} Back     alignment and structure
>3aeh_A Hemoglobin-binding protease HBP autotransporter; beta-barrel, auto-proteolytic, reaction intermediate, mutant membrane, cell outer membrane; 2.00A {Escherichia coli} Back     alignment and structure
>1uyn_X NALP; autotransporter, translocator domain, membrane protein, outer membrane, beta-domain, beta-barrel; HET: CXE; 2.6A {Neisseria meningitidis} SCOP: f.4.5.1 PDB: 1uyo_X* Back     alignment and structure
>1qjp_A Outer membrane protein A; HET: C8E; 1.65A {Escherichia coli} SCOP: f.4.1.1 PDB: 1bxw_A* 1g90_A 2ge4_A Back     alignment and structure
>2k0l_A Outer membrane protein A; OMPA, trosy, sidechain, DHPC micelles; NMR {Klebsiella pneumoniae} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 242 hypothetical protein CLIBASIA_04900 [Candidatus Liberib
d1qj8a_148 f.4.1.1 (A:) Outer membrane protein X (OMPX) {Escherich 1e-05
>d1qj8a_ f.4.1.1 (A:) Outer membrane protein X (OMPX) {Escherichia coli [TaxId: 562]} Length = 148 Back     information, alignment and structure

class: Membrane and cell surface proteins and peptides
fold: Transmembrane beta-barrels
superfamily: OMPA-like
family: Outer membrane protein
domain: Outer membrane protein X (OMPX)
species: Escherichia coli [TaxId: 562]
 Score = 44.2 bits (104), Expect = 1e-05
 Identities = 22/121 (18%), Positives = 37/121 (30%), Gaps = 11/121 (9%)

Query: 87  NGLGIELGHNIQLEDFVFGINC-HTTAAKDDSTFYRLKEKYFIYGDVVLKAGYSVDSLLI 145
              G  L +  + ++   G+    T   K  +       K   YG     A    D   I
Sbjct: 20  KMGGFNLKYRYEEDNSPLGVIGSFTYTEKSRTASSGDYNKNQYYGITAGPAYRINDWASI 79

Query: 146 YGMGGFGGAYVIDSSLEKVESDNSKNAKGRFDGHGSSVVLGIGLDYMVNYDISLSASYRY 205
           YG+ G G            +   ++    + D        G GL +    +++L  SY  
Sbjct: 80  YGVVGVGYG----------KFQTTEYPTYKNDTSDYGFSYGAGLQFNPMENVALDFSYEQ 129

Query: 206 I 206
            
Sbjct: 130 S 130


Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target242 hypothetical protein CLIBASIA_04900 [Candidatus Liberib
d1qj8a_148 Outer membrane protein X (OMPX) {Escherichia coli [TaxI 99.94
d1t16a_427 Long-chain fatty acid transport protein FadL {Escherich 97.9
d1uynx_299 Translocator domain of NalP {Neisseria meningitidis [Ta 97.35
d1p4ta_155 Outer membrane protein NspA {Neisseria meningitidis [Ta 99.91
d1qjpa_171 Outer membrane protein A (OMPA) transmembrane domain {E 99.87
d1uynx_299 Translocator domain of NalP {Neisseria meningitidis [Ta 99.17
d1t16a_427 Long-chain fatty acid transport protein FadL {Escherich 98.35
d1i78a_297 Outer membrane protease OMPT {Escherichia coli [TaxId: 98.0
d2fgqx1330 Porin {Comamonas acidovorans [TaxId: 80866]} 97.54
d1osma_342 Porin {Klebsiella pneumoniae [TaxId: 573]} 97.16
d1phoa_330 Porin {Escherichia coli, different sequences [TaxId: 56 96.99
d3prna_289 Porin {Rhodopseudomonas blastica, strain DSM2131 [TaxId 96.78
d2pora_301 Porin {Rhodobacter capsulatus [TaxId: 1061]} 95.74
d2zfga1340 Porin {Escherichia coli, different sequences [TaxId: 56 95.07
d1qjpa_171 Outer membrane protein A (OMPA) transmembrane domain {E 95.86
>d1qj8a_ f.4.1.1 (A:) Outer membrane protein X (OMPX) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: Transmembrane beta-barrels
superfamily: OMPA-like
family: Outer membrane protein
domain: Outer membrane protein X (OMPX)
species: Escherichia coli [TaxId: 562]
Probab=99.94  E-value=9.2e-26  Score=157.10  Aligned_cols=127  Identities=17%  Similarity=0.167  Sum_probs=102.1

Q ss_pred             EEEEEEEEEEEECCEEEEEEEEEEEECCCCCCCCCCCCCEEEEEEEEEEEEEE-CCEEEEEEEEEEEEEEECCCCCCCCC
Q ss_conf             04799886554457799999886740477764323101003679899986331-44034444011457530110002366
Q gi|254781078|r   88 GLGIELGHNIQLEDFVFGINCHTTAAKDDSTFYRLKEKYFIYGDVVLKAGYSV-DSLLIYGMGGFGGAYVIDSSLEKVES  166 (242)
Q Consensus        88 g~G~~~GYN~Q~~~~V~GvE~d~~~~~~~~~~~~~~~k~~~~Gsvr~r~Gya~-~~~l~Y~~gG~A~~~~~~~~~~~~~~  166 (242)
                      ..|+.+|||||++++++|+|+++.+...+..............++.++..|.+ ++++||+++|+++.+.+.+..     
T Consensus        21 ~~G~~lgy~y~~~n~~~gvE~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Y~~~G~a~~~~~~~~~-----   95 (148)
T d1qj8a_          21 MGGFNLKYRYEEDNSPLGVIGSFTYTEKSRTASSGDYNKNQYYGITAGPAYRINDWASIYGVVGVGYGKFQTTEY-----   95 (148)
T ss_dssp             EEEEEEEEEEECTTCSEEEEEEEEEEEEEEECTTSCEEEEEEEEEEEEEEEEEETTEEEEEEEEEEEEEEEEEET-----
T ss_pred             CCEEEEEEEEEECCCEEEEEEEEEEECCCCCCCCCCCCEEEEEEEEEEEEEECCCCEEEEEEEEEEEEEEEECCC-----
T ss_conf             114999982891791799999999885678304663110158899988889747745498986778999984137-----


Q ss_pred             CCCCCCCCCCCCCCEEEEEEEEEEEECCCCEEEEEEEEEEECCCCEEECCCCCCCCCCCCCCCCEEEEEEEEEEEC
Q ss_conf             6655554345565303798731667327876888898887448730003666666442201234138999886209
Q gi|254781078|r  167 DNSKNAKGRFDGHGSSVVLGIGLDYMVNYDISLSASYRYIPHHIHSVNNSNAKSDVERVDRKGNAHIASLGINMHF  242 (242)
Q Consensus       167 ~~~~~~~~~~d~t~~G~tvGaGVEYait~nwslraEY~Y~d~g~~~~~~~~~~~~~~~~~~~~~~h~v~~GinY~F  242 (242)
                           ...+.+.+.+||++|+|+||++++||++|+||||.+++                  +.+.+.+++||+|||
T Consensus        96 -----~~~~~~~~~~g~~~G~Gvey~l~~n~~~~~eY~~~~~~------------------~~d~~~~~~Gv~YrF  148 (148)
T d1qj8a_          96 -----PTYKNDTSDYGFSYGAGLQFNPMENVALDFSYEQSRIR------------------SVDVGTWIAGVGYRF  148 (148)
T ss_dssp             -----TTEEEEEEEEEEEEEEEEEECSSTTEEEEEEEEEEEET------------------TEEEEEEEEEEEEEC
T ss_pred             -----CCCCCCCCCCCEEEEEEEEEEECCCEEEEEEEEEEECC------------------CCEEEEEEEEEEEEC
T ss_conf             -----87655645444469621799806887999999997479------------------943306999989889



>d1t16a_ f.4.3.4 (A:) Long-chain fatty acid transport protein FadL {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uynx_ f.4.5.1 (X:) Translocator domain of NalP {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1p4ta_ f.4.1.1 (A:) Outer membrane protein NspA {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1uynx_ f.4.5.1 (X:) Translocator domain of NalP {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1t16a_ f.4.3.4 (A:) Long-chain fatty acid transport protein FadL {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i78a_ f.4.4.1 (A:) Outer membrane protease OMPT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fgqx1 f.4.3.1 (X:3-332) Porin {Comamonas acidovorans [TaxId: 80866]} Back     information, alignment and structure
>d1osma_ f.4.3.1 (A:) Porin {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1phoa_ f.4.3.1 (A:) Porin {Escherichia coli, different sequences [TaxId: 562]} Back     information, alignment and structure
>d3prna_ f.4.3.1 (A:) Porin {Rhodopseudomonas blastica, strain DSM2131 [TaxId: 1075]} Back     information, alignment and structure
>d2pora_ f.4.3.1 (A:) Porin {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d2zfga1 f.4.3.1 (A:1-340) Porin {Escherichia coli, different sequences [TaxId: 562]} Back     information, alignment and structure
>d1qjpa_ f.4.1.1 (A:) Outer membrane protein A (OMPA) transmembrane domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 242 hypothetical protein CLIBASIA_04900 [Candidatus Li
2k0l_A_216 (A:) Outer membrane protein A; OMPA, trosy, sidech 9e-07
2f1v_A_197 (A:) Outer membrane protein W; outer membrane prot 8e-06
1qjp_A_171 (A:) Outer membrane protein A; HET: C8E; 1.65A {Es 1e-05
1orm_A_148 (A:) Outer membrane protein X; OMPX, trosy, DHPC, 0.001
>2k0l_A (A:) Outer membrane protein A; OMPA, trosy, sidechain, DHPC micelles; NMR {Klebsiella pneumoniae}Length = 216 Back     alignment and structure
 Score = 48.3 bits (114), Expect = 9e-07
 Identities = 26/192 (13%), Positives = 45/192 (23%), Gaps = 18/192 (9%)

Query: 54  WSGNYVGLHISRLYETHPLADTINRKTYNSLL---PNGLGIELGHNIQLEDFVFGINCHT 110
            +  Y G  +               +  N        G G   G+ +             
Sbjct: 16  DNTWYAGGKLGWSQYHDTGFYGNGFQNNNGPTRNDQLGAGAFGGYQVNPYLGFEMGYDWL 75

Query: 111 TAAKDDSTFYRLKEKYFIYGDVVLKAGYSVDSLLIYGMGGFGGAYVIDSSLEKVESDNSK 170
                  +      K               D L IY   G                 +  
Sbjct: 76  GRMAYKGSVDNGAFKAQGVQLTAKLGYPITDDLDIYTRLGGMVWRADSKGNYASTGVSRS 135

Query: 171 NAKGRFDGHGSSVVLGIGLDYMVNYDISLSASYRYIPHHIHSVNNSNAKSDVERVDRKGN 230
                      S V   G+++ V  DI+    Y+++          N   D   V  + +
Sbjct: 136 EHDTGV-----SPVFAGGVEWAVTRDIATRLEYQWV----------NNIGDAGTVGTRPD 180

Query: 231 AHIASLGINMHF 242
             + SLG++  F
Sbjct: 181 NGMLSLGVSYRF 192


>2f1v_A (A:) Outer membrane protein W; outer membrane protein beta barrel; 2.70A {Escherichia coli K12} PDB: 2f1t_ALength = 197 Back     alignment and structure
>1orm_A (A:) Outer membrane protein X; OMPX, trosy, DHPC, detergents, lipids, micelles; NMR {Escherichia coli}Length = 148 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target242 hypothetical protein CLIBASIA_04900 [Candidatus Liberib
1p4t_A_155 Outer membrane protein NSPA; beta barrel; HET: CXE 99.91
2f1v_A_197 Outer membrane protein W; outer membrane protein b 99.91
1qjp_A_171 Outer membrane protein A; HET: C8E; 1.65A {Escheri 99.88
2k0l_A_216 Outer membrane protein A; OMPA, trosy, sidechain, 99.84
2jmm_A_156 Outer membrane protein A; NMR {Escherichia coli} ( 99.76
1uyn_X_308 NALP; autotransporter, translocator domain, membra 99.12
2qom_A_285 Serine protease ESPP; outer membrane protein, beta 99.12
1orm_A_148 Outer membrane protein X; OMPX, trosy, DHPC, deter 99.78
3kvn_X_322-632311 Esterase ESTA; beta barrel, alpha-beta-alpha motif 98.75
1i78_A_297 Protease VII; integral outer membrane protein, bet 98.36
2erv_A_150 Hypothetical protein PAER03002360; beta barrel, ou 93.88
2f1c_X_286 OMPG, outer membrane protein G; beta barrel; HET: 99.12
2j1n_A_346 Outer membrane protein C; beta-barrel, ION transpo 97.52
2por_A_301 Porin; HET: C8E; 1.80A {Rhodobacter capsulatus} (A 97.44
3prn_A_289 Porin; integral membrane protein, pore eyelet muta 97.1
1pho_A_330 Phosphoporin; outer membrane protein; 3.00A {Esche 96.96
2zfg_A_340 Outer membrane protein F; OMPF porin, ordered wate 95.75
2fgq_X_332 OMP32, outer membrane porin protein 32; malate, ou 94.83
3bry_A_441 TBUX; beta barrel, outer membrane protein, transpo 94.5
2o4v_A_411 Porin P; outer membrane, phosphate, transport, cha 94.44
3dwo_X_451 Probable outer membrane protein; beta barrel; HET: 93.73
2vdf_A_253 OPCA, outer membrane protein; invasin, adhesin, be 97.69
1uyn_X_308 NALP; autotransporter, translocator domain, membra 97.39
3kvn_X_322-632311 Esterase ESTA; beta barrel, alpha-beta-alpha motif 97.21
2qom_A_285 Serine protease ESPP; outer membrane protein, beta 96.76
2k0l_A_216 Outer membrane protein A; OMPA, trosy, sidechain, 96.87
1qjp_A_171 Outer membrane protein A; HET: C8E; 1.65A {Escheri 96.63
2jmm_A_156 Outer membrane protein A; NMR {Escherichia coli} ( 95.98
2f1v_A_197 Outer membrane protein W; outer membrane protein b 95.5
3dwn_A_427 Long-chain fatty acid transport protein; beta barr 93.38
>1p4t_A (A:) Outer membrane protein NSPA; beta barrel; HET: CXE; 2.55A {Neisseria meningitidis} Back     alignment and structure
Probab=99.91  E-value=3.2e-22  Score=139.85  Aligned_cols=151  Identities=15%  Similarity=0.146  Sum_probs=113.3

Q ss_pred             EEEEEEEEEEEEEEEEECCCCCCCCCCCCCCCCEEEEEEEEEEEECCEEEEEEEEEEEECCCCCCCCCCCCCEEEEEEEE
Q ss_conf             00574446441033222145556666676675504799886554457799999886740477764323101003679899
Q gi|254781078|r   55 SGNYVGLHISRLYETHPLADTINRKTYNSLLPNGLGIELGHNIQLEDFVFGINCHTTAAKDDSTFYRLKEKYFIYGDVVL  134 (242)
Q Consensus        55 tG~YiG~~~G~~~~~~~~~d~~~~~~~n~~~~~g~G~~~GYN~Q~~~~V~GvE~d~~~~~~~~~~~~~~~k~~~~Gsvr~  134 (242)
                      +|+|||+.+|+.+...+..+.         ....+|+++||  |+++|.+.+|.+........... .   ......+-+
T Consensus         4 ~~~yvg~~~G~~~~~~~~~~~---------~~~~~g~~~GY--~fn~~~~e~~~~~~~~~~~~~~~-~---~~~~~~l~~   68 (155)
T 1p4t_A            4 SGFYVQADAAHAKASSSLGSA---------KGFSPRISAGY--RINDLRFAVDYTRYKNYKAPSTD-F---KLYSIGASA   68 (155)
T ss_dssp             EEEEEEEEEEEEEEECSSCEE---------EEECCEEEEEE--EETTEEEEEEEEEEEESSCCSSC-C---EEEEEEEEE
T ss_pred             CCEEEEEECEEEECCCCCCCC---------CCEEEEEEEEE--ECCCEEEEEEEEEECCCCCCCCE-E---EEEEEEEEE
T ss_conf             642897864176134766778---------85748999999--80799999999995354678702-5---788999999


Q ss_pred             EEEEEE-CCEEEEEEEEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCEEEEEEEEEEEECCCCEEEEEEEEEEECCCCEE
Q ss_conf             986331-4403444401145753011000236666555543455653037987316673278768888988874487300
Q gi|254781078|r  135 KAGYSV-DSLLIYGMGGFGGAYVIDSSLEKVESDNSKNAKGRFDGHGSSVVLGIGLDYMVNYDISLSASYRYIPHHIHSV  213 (242)
Q Consensus       135 r~Gya~-~~~l~Y~~gG~A~~~~~~~~~~~~~~~~~~~~~~~~d~t~~G~tvGaGVEYait~nwslraEY~Y~d~g~~~~  213 (242)
                      +..+.+ +++.||+++|+++.+++.+.          ......+++..+|.+|+|+||+++|||++++||||+++++.  
T Consensus        69 ~~~~~~~~~~~~Y~~~G~~~~~~~~~~----------~~~~~~~~~~~~~~~g~G~~y~i~~~~~~~~~y~y~~~~~~--  136 (155)
T 1p4t_A           69 IYDFDTQSPVKPYLGARLSLNRASVDL----------GGSDSFSQTSIGLGVLTGVSYAVTPNVDLDAGYRYNYIGKV--  136 (155)
T ss_dssp             EEECCCSSSEEEEEEEEEEEEEEEEEE----------TTEEEECCCEEEEEEEEEEEEEEETTEEEEEEEEEEEEEEE--
T ss_pred             EEEECCCCCEEEEEEEEEEEEEEEEEC----------CCCCCCCCCEEEEEEEEEEEEEECCCEEEEEEEEEEECCCC--
T ss_conf             998436785669999889999998201----------55565566327314731799994589999999999976676--


Q ss_pred             ECCCCCCCCCCCCCCCCEEEEEEEEEEEC
Q ss_conf             03666666442201234138999886209
Q gi|254781078|r  214 NNSNAKSDVERVDRKGNAHIASLGINMHF  242 (242)
Q Consensus       214 ~~~~~~~~~~~~~~~~~~h~v~~GinY~F  242 (242)
                                ..+.+.+.|.+++||+|||
T Consensus       137 ----------~~~~~~~~~~~~lGv~Y~F  155 (155)
T 1p4t_A          137 ----------NTVKNVRSGELSAGVRVKF  155 (155)
T ss_dssp             ----------TTEEEEEEEEEEEEEEEEC
T ss_pred             ----------CCCCCEEEEEEEEEEEEEC
T ss_conf             ----------6575200228999999999



>2f1v_A (A:) Outer membrane protein W; outer membrane protein beta barrel; 2.70A {Escherichia coli K12} PDB: 2f1t_A Back     alignment and structure
>2k0l_A (A:) Outer membrane protein A; OMPA, trosy, sidechain, DHPC micelles; NMR {Klebsiella pneumoniae} Back     alignment and structure
>2jmm_A (A:) Outer membrane protein A; NMR {Escherichia coli} Back     alignment and structure
>1uyn_X (X:) NALP; autotransporter, translocator domain, membrane protein, outer membrane, beta-domain, beta-barrel; HET: CXE; 2.6A {Neisseria meningitidis} Back     alignment and structure
>2qom_A (A:) Serine protease ESPP; outer membrane protein, beta-barrel, beta-domain, autotransporter, hydrolase, plasmid, secreted, transmembrane; 2.66A {Escherichia coli O157} Back     alignment and structure
>1orm_A (A:) Outer membrane protein X; OMPX, trosy, DHPC, detergents, lipids, micelles; NMR {Escherichia coli} Back     alignment and structure
>3kvn_X (X:322-632) Esterase ESTA; beta barrel, alpha-beta-alpha motif, cell membrane, cell outer membrane, hydrolase, membrane, transmembrane; HET: C8E; 2.50A {Pseudomonas aeruginosa} Back     alignment and structure
>1i78_A (A:) Protease VII; integral outer membrane protein, beta barrel, hydrolase; HET: BOG; 2.60A {Escherichia coli K12} Back     alignment and structure
>2erv_A (A:) Hypothetical protein PAER03002360; beta barrel, outer membrane, enzyme, hydrolase, lipopolysaccharide, membrane protein; HET: CXE; 2.00A {Pseudomonas aeruginosa} Back     alignment and structure
>2f1c_X (X:) OMPG, outer membrane protein G; beta barrel; HET: C8E; 2.30A {Escherichia coli K12} PDB: 2jqy_A 2iwv_A* 2iww_A* Back     alignment and structure
>2j1n_A (A:) Outer membrane protein C; beta-barrel, ION transport, non-specific porin, general porin, osmoporin, transmembrane transport; HET: D12; 2.0A {Escherichia coli} PDB: 2j4u_P 2zle_D 2ixx_A* 2ixw_A* 1osm_A* Back     alignment and structure
>2por_A (A:) Porin; HET: C8E; 1.80A {Rhodobacter capsulatus} Back     alignment and structure
>3prn_A (A:) Porin; integral membrane protein, pore eyelet mutant; HET: C8E; 1.90A {Rhodopseudomonas blastica} Back     alignment and structure
>1pho_A (A:) Phosphoporin; outer membrane protein; 3.00A {Escherichia coli} Back     alignment and structure
>2zfg_A (A:) Outer membrane protein F; OMPF porin, ordered waters, ION transport, phage recognition, transmembrane, transport; HET: C8E; 1.59A {Escherichia coli} Back     alignment and structure
>2fgq_X (X:) OMP32, outer membrane porin protein 32; malate, outer membrane protein; HET: BOG; 1.45A {Delftia acidovorans} Back     alignment and structure
>3bry_A (A:) TBUX; beta barrel, outer membrane protein, transport protein; HET: C8E; 3.20A {Ralstonia pickettii} Back     alignment and structure
>2o4v_A (A:) Porin P; outer membrane, phosphate, transport, channel, membrane protein; HET: C8E; 1.94A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>3dwo_X (X:) Probable outer membrane protein; beta barrel; HET: C8E; 2.20A {Pseudomonas aeruginosa} Back     alignment and structure
>2vdf_A (A:) OPCA, outer membrane protein; invasin, adhesin, beta barrel; 1.95A {Neisseria meningitidis} Back     alignment and structure
>1uyn_X (X:) NALP; autotransporter, translocator domain, membrane protein, outer membrane, beta-domain, beta-barrel; HET: CXE; 2.6A {Neisseria meningitidis} Back     alignment and structure
>3kvn_X (X:322-632) Esterase ESTA; beta barrel, alpha-beta-alpha motif, cell membrane, cell outer membrane, hydrolase, membrane, transmembrane; HET: C8E; 2.50A {Pseudomonas aeruginosa} Back     alignment and structure
>2qom_A (A:) Serine protease ESPP; outer membrane protein, beta-barrel, beta-domain, autotransporter, hydrolase, plasmid, secreted, transmembrane; 2.66A {Escherichia coli O157} Back     alignment and structure
>2k0l_A (A:) Outer membrane protein A; OMPA, trosy, sidechain, DHPC micelles; NMR {Klebsiella pneumoniae} Back     alignment and structure
>1qjp_A (A:) Outer membrane protein A; HET: C8E; 1.65A {Escherichia coli} Back     alignment and structure
>2jmm_A (A:) Outer membrane protein A; NMR {Escherichia coli} Back     alignment and structure
>2f1v_A (A:) Outer membrane protein W; outer membrane protein beta barrel; 2.70A {Escherichia coli K12} PDB: 2f1t_A Back     alignment and structure
>3dwn_A (A:) Long-chain fatty acid transport protein; beta barrel, outer membrane protein, lipid transport, membrane, outer membrane, phage recognition; HET: LDA; 2.50A {Escherichia coli} PDB: 1t16_A* 1t1l_A* 2r4p_A* 2r4n_A* 2r4l_A* 2r4o_A* 2r89_A 2r8a_A* 2r88_A Back     alignment and structure