254781080

254781080

hypothetical protein CLIBASIA_04910

GeneID in NCBI database:8210104Locus tag:CLIBASIA_04910
Protein GI in NCBI database:254781080Protein Accession:YP_003065493.1
Gene range:+(1081359, 1081616)Protein Length:85aa
Gene description:hypothetical protein
COG prediction:[S] Uncharacterized protein conserved in bacteria
KEGG prediction:hypothetical protein
SEED prediction:Uncharacterized protein conserved in bacteria
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80-----
MIDNIQNVTQDQLRTFIERLERLEEEKKLLTENIKDIYGEAKATGFDVKAIKKILSLRKKDEKQWMEEEQILDVYLRALGMLKDE
cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHcc
ccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHccHcHHHHHHHHHHHHHHHHcccccc
MIDNIQNVTQDQLRTFIERLERLEEEKKLLTENIKDIYGeakatgfdVKAIKKILSLRKKDEKQWMEEEQILDVYLRALGMLKDE
midniqnvtqdqlRTFIERLERLEEEKKLLTENIKDIygeakatgfdvkAIKKILSlrkkdekqwmeeeqiLDVYLRALGMLKDE
MIDNIQNVTQDQLRTFIerlerleeekkllTENIKDIYGEAKATGFDVKAIKKILSLRKKDEKQWMEEEQILDVYLRALGMLKDE
*********QDQLRTFIERLERLEEEKKL*TENIKDIYGEAKATGFDVKAIKKILS*********MEEEQILDVYLRALGML***
MIDNIQNVTQDQLRTFIERLERLEEEKKLLTENIKDIYGEAKATGFDVKAIKKILSLRKKDEKQWMEEEQILDVYLRALGMLKDE
*****QNVTQDQLRTFIERLERLEEEKKLLTENIKDIYGEAKATGFDVKAIKKILSLRKKDEKQWMEEEQILDVYLRALGMLK**
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIDNIxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxAKATGFDVKAIKKILSLRKKDEKQWMEEEQILDVYLRALGMLKDE
MIDNIQNVTQDQLRTFIERLERLEEEKKLLTENIKDIYGEAKATGFDVKAIKKILSLRKKDEKQWMEEEQILDVYLRALGMLKDE
MIDNIQNVTQDQLRTFIERLERLEEEKKLLTENIKDIYGEAKATGFDVKAIKKILSLRKKDEKQWMEEEQILDVYLRALGMLKDE

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target85 hypothetical protein CLIBASIA_04910 [Candidatus Liberib
31512246186 hypothetical protein CKC_03565 [Candidatus Liberibacter 1 3e-25
22214971287 hypothetical protein Avi_3695 [Agrobacterium vitis S4] 1 2e-21
18071259133 hypothetical protein PBC5p55 [Sinorhizobium phage PBC5] 1 4e-21
16375885688 hypothetical protein HPDFL43_15572 [Hoeflea phototrophi 1 2e-20
33218883487 hypothetical protein SUS17_3941 [Sphingomonas sp. S17] 1 2e-19
32854248886 hypothetical protein SL003B_0868 [polymorphum gilvum SL 1 2e-19
33218599184 hypothetical protein SUS17_1210 [Sphingomonas sp. S17] 1 3e-19
11470435387 hypothetical protein FP2506_05451 [Fulvimarina pelagi H 1 3e-19
31211440098 hypothetical protein Rvan_1647 [Rhodomicrobium vannieli 1 1e-18
11858895685 hypothetical protein SIAM614_12928 [Stappia aggregata I 1 2e-18
>gi|315122461|ref|YP_004062950.1| hypothetical protein CKC_03565 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 86 Back     alignment and organism information
 Score =  118 bits (296), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 71/83 (85%), Positives = 80/83 (96%)

Query: 3  DNIQNVTQDQLRTFIERLERLEEEKKLLTENIKDIYGEAKATGFDVKAIKKILSLRKKDE 62
          DNIQNVTQDQLR+F+ERLERLEEEKKLL+ENIKD+YGEAKATGFDV A++KILSLRKKDE
Sbjct: 4  DNIQNVTQDQLRSFVERLERLEEEKKLLSENIKDVYGEAKATGFDVGALRKILSLRKKDE 63

Query: 63 KQWMEEEQILDVYLRALGMLKDE 85
          ++ MEEE IL+VYLRALGMLKDE
Sbjct: 64 QKRMEEEHILEVYLRALGMLKDE 86


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222149712|ref|YP_002550669.1| hypothetical protein Avi_3695 [Agrobacterium vitis S4] Length = 87 Back     alignment and organism information
>gi|18071259|ref|NP_542315.1| hypothetical protein PBC5p55 [Sinorhizobium phage PBC5] Length = 133 Back     alignment and organism information
>gi|163758856|ref|ZP_02165943.1| hypothetical protein HPDFL43_15572 [Hoeflea phototrophica DFL-43] Length = 88 Back     alignment and organism information
>gi|332188834|ref|ZP_08390543.1| hypothetical protein SUS17_3941 [Sphingomonas sp. S17] Length = 87 Back     alignment and organism information
>gi|328542488|ref|YP_004302597.1| hypothetical protein SL003B_0868 [polymorphum gilvum SL003B-26A1] Length = 86 Back     alignment and organism information
>gi|332185991|ref|ZP_08387737.1| hypothetical protein SUS17_1210 [Sphingomonas sp. S17] Length = 84 Back     alignment and organism information
>gi|114704353|ref|ZP_01437261.1| hypothetical protein FP2506_05451 [Fulvimarina pelagi HTCC2506] Length = 87 Back     alignment and organism information
>gi|312114400|ref|YP_004011996.1| hypothetical protein Rvan_1647 [Rhodomicrobium vannielii ATCC 17100] Length = 98 Back     alignment and organism information
>gi|118588956|ref|ZP_01546363.1| hypothetical protein SIAM614_12928 [Stappia aggregata IAM 12614] Length = 85 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target85 hypothetical protein CLIBASIA_04910 [Candidatus Liberib
pfam1007374 pfam10073, DUF2312, Uncharacterized protein conserved i 4e-20
PRK1369483 PRK13694, PRK13694, hypothetical protein; Provisional 7e-20
COG375085 COG3750, COG3750, Uncharacterized protein conserved in 6e-16
>gnl|CDD|150715 pfam10073, DUF2312, Uncharacterized protein conserved in bacteria (DUF2312) Back     alignment and domain information
>gnl|CDD|184250 PRK13694, PRK13694, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|33545 COG3750, COG3750, Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 85 hypothetical protein CLIBASIA_04910 [Candidatus Liberib
PRK1369484 hypothetical protein; Provisional 100.0
pfam1007374 DUF2312 Uncharacterized protein conserved in bacteria ( 99.97
COG375085 Uncharacterized protein conserved in bacteria [Function 99.97
>PRK13694 hypothetical protein; Provisional Back     alignment and domain information
>pfam10073 DUF2312 Uncharacterized protein conserved in bacteria (DUF2312) Back     alignment and domain information
>COG3750 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00