254781126

254781126

hypothetical protein CLIBASIA_05140

GeneID in NCBI database:8210151Locus tag:CLIBASIA_05140
Protein GI in NCBI database:254781126Protein Accession:YP_003065539.1
Gene range:+(1129330, 1129587)Protein Length:85aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:not defined as a protein in SEED
Pathway involved in KEGG:not defined
Subsystem involved in KEGG:not defined
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80-----
MNIFVRDISCLRALVFVITRGVARLPKDQKKAFFRHEKKVADHLNYNAGDRKSNIDKLYKARCKYRKESKLQKLSKSKIFSIKHT
cccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcEEEccc
ccEEEEcHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHccccEEEEEcc
MNIFVRDISCLRALVFVITRgvarlpkdqkKAFFRHEKKVADhlnynagdrksNIDKLYKARCKYRkesklqklskskifsikht
mnifvrdisclrALVFVITrgvarlpkdqkkaFFRHEkkvadhlnynagdrksniDKLYKARCKyrkesklqklskskifsikht
MNIFVRDISCLRALVFVITRGVARLPKDQKKAFFRHEKKVADHLNYNAGDRKSNIDKLYKARCKYRkesklqklskskifsikHT
*NIFVRDISCLRALVFVITRGVAR**KD*****FRHEKKVADHLNYNAGDRKSNIDKLYKAR****************IFSIK**
MNIFVRDISCLRALVFVITRGVARLPKDQKKAFFRHEKKVADHLNYNAGDRKSNIDKLYKARCKYRKESKLQKLSKSKIFSIKHT
MNIFVRDISCLRALVFVITRGVARLPKDQKKAFFRHEKKVADHLNYNAGDRKSNIDKLYKARCKYRKESKLQKLSKSKIFSI***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNIFVRDISCLRALVFVITRGVARLPKDQKKAFFRHEKKVADHLNYNAGDRKSNIDKLYKARCKYRKESKLQKLSKSKIFSIKHT
MNIFVRDISCLRALVFVITRGVARLPKDQKKAFFRHEKKVADHLNYNAGDRKSNIDKLYKARCKYRKESKLQKLSKSKIFSIKHT
MNIFVRDISCLRALVFVITRGVARLPKDQKKAFFRHEKKVADHLNYNAGDRKSNIDKLYKARCKYRKESKLQKLSKSKIFSIKHT

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target85 hypothetical protein CLIBASIA_05140 [Candidatus Liberib
254780984125 hypothetical protein CLIBASIA_04425 [Candidatus Li 7e-13
>gi|254780984|ref|YP_003065397.1| hypothetical protein CLIBASIA_04425 [Candidatus Liberibacter asiaticus str. psy62] Length = 125 Back     alignment
 Score = 63.5 bits (153), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 38/49 (77%)

Query: 18  ITRGVARLPKDQKKAFFRHEKKVADHLNYNAGDRKSNIDKLYKARCKYR 66
           ITR +  L +++KKAFF HEKKV  +LNYNA DRK NI++ Y+AR KYR
Sbjct: 65  ITRELNTLSENEKKAFFEHEKKVTSNLNYNARDRKHNINQFYEARGKYR 113

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target85 hypothetical protein CLIBASIA_05140 [Candidatus Liberib
254780984125 hypothetical protein CLIBASIA_04425 [Candidatus Liberib 1 1e-08
>gi|254780984|ref|YP_003065397.1| hypothetical protein CLIBASIA_04425 [Candidatus Liberibacter asiaticus str. psy62] Length = 125 Back     alignment and organism information
 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 38/49 (77%)

Query: 18  ITRGVARLPKDQKKAFFRHEKKVADHLNYNAGDRKSNIDKLYKARCKYR 66
           ITR +  L +++KKAFF HEKKV  +LNYNA DRK NI++ Y+AR KYR
Sbjct: 65  ITRELNTLSENEKKAFFEHEKKVTSNLNYNARDRKHNINQFYEARGKYR 113


Species: Candidatus Liberibacter asiaticus
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00