254781158

254781158

peptidyl prolyl cis-trans isomerase D signal peptide protein

GeneID in NCBI database:8210183Locus tag:CLIBASIA_05325
Protein GI in NCBI database:254781158Protein Accession:YP_003065571.1
Gene range:-(1152757, 1154652)Protein Length:631aa
Gene description:peptidyl prolyl cis-trans isomerase D signal peptide protein
COG prediction:[O] Parvulin-like peptidyl-prolyl isomerase
KEGG prediction:peptidyl prolyl cis-trans isomerase D signal peptide protein; K03770 peptidyl-prolyl cis-trans isomerase D [EC:5.2.1.8]
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED2 TM-Helix
HMMTOP1 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-
MLEIIRKASRTWVAKIFLVVLFVPFLIWGLSDALFSVSGSSTVVSVGRQKVPFSSFINSWKQELGMISQKIGFVVNSERARSVGLDKKILDNLVSGATLDQFIEDIGLEADHGRVWGEIARSPLFHGKDNKFSHDVFVSRLAREGINEKEYIDHYTKMLSRTDVVGMFVGGMRPSNLLLDQAKRFYFENRSVDYIVLNNRHVPAIADPSNAVLTQWFEKYKDNYRAPEYKRISYILFDVHEKEKKIEISNDELQAEYEKNKEKYFSPEIRTVEQLVFPNQKEADEAFQSLKKGKKFIQLAEEQGKSLSDISLGSFSKEYIPDVSLADSIFSLAKKGDFTPVIHGSFGYVIAHVSNIKPSFTVSFQEVKKDIANQMRITKASEKVKEDYKRLEEFLALGTSMDEISRREKIVSIDLPLVDFAGKDVKGKEVAAIPYKEQLLFRVFGKDDPLSKDHTVALPDGSYMWVQIKESIPARDRKLEEVLTDVKKDWKTVKTAEEVSSKANQLVLEYSKEGKNFRDIGKNLGASLLTTNQINRMDNENKFFGYDGISQVFSGPVEMVKCFPIENGLSYVVFKVTNSKVGPVQEKDKFISYLTQMMNKDLLDSVIAYLKSQYSVTVHDNLIQRYLDGEK
cHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEccEEccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHEEEEccHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHcccHHHHHHHHccccHHHHHHHHHHHHccccHHHHHHHHcccccccccccccccccccHHHHHHHHHccccccEEccEEcccEEEEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHccccccccccEEEccccEEEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHccccEEEcccccccccccccccHHHHHHHHcccccccEEEEcccccEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHcccc
cHHHHHHHccHHHHHHHHHHHHHHHHHHcccHHcccccccccEEEEccccccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHcccccccccccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccccEEEEcHHHHHccccccHHHHHHHHHHcHHHcccccEEEEEEEEEcHHHHHccccccHHHHHHHHHHHHHHcccHHHHHHHHHEcccHHHHHHHHHHHHccccHHHHHHHccccccccccccccccccccHHHHHHHHHHHHcccccccEEccccEEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHcccEEEEEccccccccccccccHcccHHHHHHHccHHHHccccccccEEEEccccEEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHcccEEEcccccccccccccccHHHHHHHcccccccccccccccccccEEEEEEEccccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHccccHHHHHHHHHccccc
MLEIIRKASRTWVAKIFLVVLFVPFLIWGLSDALfsvsgsstvvsvgrqkvpfsSFINSWKQELGMISQKIGFVVNSerarsvgldKKILDnlvsgatlDQFIEDIgleadhgrvwgeiarsplfhgkdnkfshdVFVSRLareginekEYIDHYTKMLSRTDVVGMfvggmrpsnlllDQAKRFYFENRSVDYivlnnrhvpaiadpsnaVLTQWFEKYkdnyrapeykrISYILFDVHEKEKKIEISNDELQAEYEKnkekyfspeirtveqlvfpnqkEADEAFQSLKKGKKFIQLAEEQgkslsdislgsfskeyipdvslADSIFSlakkgdftpvihGSFGYVIAHvsnikpsftVSFQEVKKDIANQMRITKASEKVKEDYKRLEEFLALGTSMDEISRREKivsidlplvdfagkdvkgkevaaipykeqllfrvfgkddplskdhtvalpdgsyMWVQIKESIPARDRKLEEVLTDVKKDWKTVKTAEEVSSKANQLVLEYSKEGKNFRDIGKNLGasllttnqinrmdnenkffgydgisqvfsgpvemvkcfpienglSYVVFKVtnskvgpvqekDKFISYLTQMMNKDLLDSVIAYLKSQYSVTVHDNLIQRYLDGEK
MLEIIRKASRTWVAKIFLVVLFVPFLIWGLSDALFSVSGSSTVVSVGRQKVPFSSFINSWKQELGMISQKIGFVVNSERARSVGLDKKILDNLVSGATLDQFIEDIGLEADHGRVWGEIARsplfhgkdnkfSHDVFVSRLAREGINEKEYIDHYTKMLSRTDVVGMFVGGMRPSNLLLDQAKRFYFENRSVDYIVLNNRHVPAIADPSNAVLTQWFEKYkdnyrapeYKRISYILFDVHEKEKKIEISNDELQAEYEknkekyfspeiRTVEQLVFPNQKEADEAFQSLKKGKKFIQLAEEQGKSLSDISLGSFSKEYIPDVSLADSIFSLAKKGDFTPVIHGSFGYVIAHVSNIKPSFTVSFQEVKKDIANQMritkasekvkedYKRLEEFLalgtsmdeisrrekivsidlplvdfagkdvkgkevaaipykeqllfrvfgkddpLSKDHtvalpdgsymWVQIKEsipardrkLEEVLTDVkkdwktvktaeevsskanqLVLEYSKEGKNFRDIGKNLGASLLTTNQINRMDNENKFFGYDGISQVFSGPVEMVKCFPIENGLSYVVFKvtnskvgpvqeKDKFISYLTQMMNKDLLDSVIAYLKSqysvtvhdNLIQRYLDGEK
MLEIIRKASRTWVAKIFLVVLFVPFLIWGLSDALFsvsgsstvvsvgRQKVPFSSFINSWKQELGMISQKIGFVVNSERARSVGLDKKILDNLVSGATLDQFIEDIGLEADHGRVWGEIARSPLFHGKDNKFSHDVFVSRLAREGINEKEYIDHYTKMLSRTDVVGMFVGGMRPSNLLLDQAKRFYFENRSVDYIVLNNRHVPAIADPSNAVLTQWFEKYKDNYRAPEYKRISYILFDVHEKEKKIEISNDELQAEYEKNKEKYFSPEIRTVEQLVFPNQKEADEAFQSLKKGKKFIQLAEEQGKSLSDISLGSFSKEYIPDVSLADSIFSLAKKGDFTPVIHGSFGYVIAHVSNIKPSFTVSFQEVKKDIANQMRITKASEKVKEDYKRLEEFLALGTSMDEISRREKIVSIDLPLVDFAGKDVKGKEVAAIPYKEQLLFRVFGKDDPLSKDHTVALPDGSYMWVQIKESIPARDRKLEEVLtdvkkdwktvktAEEVSSKANQLVLEYSKEGKNFRDIGKNLGASLLTTNQINRMDNENKFFGYDGISQVFSGPVEMVKCFPIENGLSYVVFKVTNSKVGPVQEKDKFISYLTQMMNKDLLDSVIAYLKSQYSVTVHDNLIQRYLDGEK
MLEIIR*ASRTWVAKIFLVVLFVPFLIWGLSDALFSVSGSSTVVSVGRQKVPFSSFINSWK**********************GLDKKILDNLVSGATLDQFIEDIGLEADHGRVWGEIARSPLFHGKDNKFSHDVFVSRLAREGINEKEYIDHYTKMLSRTDVVGMFVGGMRPSNLLLDQAKRFYFENRSVDYIVLNNRHVPAIADPSNAVLTQWFEKYKDNYRAPEYKRISYILFDVHEKEKKIEISNDELQAEYEKNKEKYFSPEIRTVEQLVFPNQKEADEAFQSLKKGKKFIQ*************LGSFSKEYIPDVSLADSIFSLAKKGDFTPVIHGSFGYVIAHVSNIKPSFTVSFQEVKKDIANQMRITKASEKVKEDYKRLEEFLALGTSMDEISRREKIVSIDLPLVDF**********AAIPYKEQLLFRVFG*********TVALPDGSYMWVQIKESIPARDRKLEEVLTDVKKDWKTVKTA*E**SKAN*LVLE************K**GASLLT***************YDGISQVFSGPVEMVKCFPIENGLSYVVFKVTN**********************DLLDSVIAYLKSQYSVTVHDNLIQRYLD***
MLEIIRKASRTWVAKIFLVVLFVPFLIWGLSDALFSVSGSSTVVSVGRQKVPFSSFINSWKQELGMISQKIGFVVNSERARSVGLDKKILDNLVSGATLDQFIEDIGLEADHGRVWGEIARSPLFHGKDNKFSHDVFVSRLAREGINEKEYIDHYTKMLSRTDVVGMFVGGMRPSNLLLDQAKRFYFENRSVDYIVLNNRHVPAIADPSNAVLTQWFEKYKDNYRAPEYKRISYILFDVHEKEKKIEISNDELQAEYEKNKEKYFSPEIRTVEQLVFPNQKEADEAFQSLKKGKKFIQLAEEQGKSLSDISLGSFSKEYIPDVSLADSIFSLAKKGDFTPVIHGSFGYVIAHVSNIKPSFTVSFQEVKKDIANQMRITKASEKVKEDYKRLEEFLALGTSMDEISRREKIVSIDLPLVDFAGKDVKGKEVAAIPYKEQLLFRVFGKDDPLSKDHTVALPDGSYMWVQIKESIPARDRKLEEVLTDVKKDWKTVKTAEEVSSKANQLVLEYSKEGKNFRDIGKNLGASLLTTNQINRMDNENKFFGYDGISQVFSGPVEMVKCFPIENGLSYVVFKVTNSKVGPVQEKDKFISYLTQMMNKDLLDSVIAYLKSQYSVTVHDNLIQRYLDGEK
MLEIIRKASRTWVAKIFLVVLFVPFLIWGLSDALFSVSGSSTVVSVGRQKVPFSSFINSWKQELGMISQKIGFVVNSERARSVGLDKKILDNLVSGATLDQFIEDIGLEADHGRVWGEIARSPLFHGKDNKFSHDVFVSRLAREGINEKEYIDHYTKMLSRTDVVGMFVGGMRPSNLLLDQAKRFYFENRSVDYIVLNNRHVPAIADPSNAVLTQWFEKYKDNYRAPEYKRISYILFDVHEKEKKIEISNDELQAEYEKNKEKYFSPEIRTVEQLVFPNQKEADEAFQSLKKGKKFIQLAEEQGKSLSDISLGSFSKEYIPDVSLADSIFSLAKKGDFTPVIHGSFGYVIAHVSNIKPSFTVSFQEVKKDIANQMRITKASEKVKEDYKRLEEFLALGTSMDEISRREKIVSIDLPLVDFAGKDVKGKEVAAIPYKEQLLFRVFGKDDPLSKDHTVALPDGSYMWVQIKESIPARDRKLEEVLTDVKKDWKTVKTAEEVSSKANQLVLEYSKEGKNFRDIGKNLGASLLTTNQINRMDNENKFFGYDGISQVFSGPVEMVKCFPIENGLSYVVFKVTNSKVGPVQEKDKFISYLTQMMNKDLLDSVIAYLKSQYSVTVHDNLIQRYL****
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLEIIRKASRTWVAKIFLVVLFVPFLIWGLSDALFSVSGSSTVVSVGRQKVPFSSFINSWKQELGMISQKIGFVVNSERARSVGLDKKILDNLVSGATLDQFIEDIGLEADHGRVWGEIARSPLFHGKDNKFSHDVFVSRLAREGINEKEYIDHYTKMLSRTDVVGMFVGGMRPSNLLLDQAKRFYFENRSVDYIVLNNRHVPAIADPSNAVLTQWFEKYKDNYRAPEYKRISYILFDVHEKxxxxxxxxxxxxxxxxxxxxxYFSPEIRTVEQLVFPNQKEADEAFQSLKKGKKFIQLAEEQGKSLSDISLGSFSKEYIPDVSLADSIFSLAKKGDFTPVIHGSFGYVIAHVSNIKPSFTVSFQEVKKDIANQMRITKASEKVKEDYKRLEEFLALGTSMDEISRREKIVSIDLPLVDFAGKDVKGKEVAAIPYKEQLLFRVFGKDDPLSKDHTVALPDGSYMWVQIKESIPARDRKLEEVLTDVKKDWKTVKTAEEVSSKANQLVLEYSKEGKNFRDIGKNLGASLLTTNQINRMDNENKFFGYDGISQVFSGPVEMVKCFPIENGLSYVVFKVTNSKVGPVQEKDKFISYLTQMMNKDLLDSVIAYLKSQYSVTVHDNLIQRYLDGEK
MLEIIRKASRTWVAKIFLVVLFVPFLIWGLSDALFSVSGSSTVVSVGRQKVPFSSFINSWKQELGMISQKIGFVVNSERARSVGLDKKILDNLVSGATLDQFIEDIGLEADHGRVWGEIARSPLFHGKDNKFSHDVFVSRLAREGINEKEYIDHYTKMLSRTDVVGMFVGGMRPSNLLLDQAKRFYFENRSVDYIVLNNRHVPAIADPSNAVLTQWFEKYKDNYRAPEYKRISYILFDVHEKEKKIEISNDELQAEYEKNKEKYFSPEIRTVEQLVFPNQKEADEAFQSLKKGKKFIQLAEEQGKSLSDISLGSFSKEYIPDVSLADSIFSLAKKGDFTPVIHGSFGYVIAHVSNIKPSFTVSFQEVKKDIANQMRITKASEKVKEDYKRLEEFLALGTSMDEISRREKIVSIDLPLVDFAGKDVKGKEVAAIPYKEQLLFRVFGKDDPLSKDHTVALPDGSYMWVQIKESIPARDRKLEEVLTDVKKDWKTVKTAEEVSSKANQLVLEYSKEGKNFRDIGKNLGASLLTTNQINRMDNENKFFGYDGISQVFSGPVEMVKCFPIENGLSYVVFKVTNSKVGPVQEKDKFISYLTQMMNKDLLDSVIAYLKSQYSVTVHDNLIQRYLDGEK
MLEIIRKASRTWVAKIFLVVLFVPFLIWGLSDALFSVSGSSTVVSVGRQKVPFSSFINSWKQELGMISQKIGFVVNSERARSVGLDKKILDNLVSGATLDQFIEDIGLEADHGRVWGEIARSPLFHGKDNKFSHDVFVSRLAREGINEKEYIDHYTKMLSRTDVVGMFVGGMRPSNLLLDQAKRFYFENRSVDYIVLNNRHVPAIADPSNAVLTQWFEKYKDNYRAPEYKRISYILFDVHEKEKKIEISNDELQAEYEKNKEKYFSPEIRTVEQLVFPNQKEADEAFQSLKKGKKFIQLAEEQGKSLSDISLGSFSKEYIPDVSLADSIFSLAKKGDFTPVIHGSFGYVIAHVSNIKPSFTVSFQEVKKDIANQMRITKASEKVKEDYKRLEEFLALGTSMDEISRREKIVSIDLPLVDFAGKDVKGKEVAAIPYKEQLLFRVFGKDDPLSKDHTVALPDGSYMWVQIKESIPARDRKLEEVLTDVKKDWKTVKTAEEVSSKANQLVLEYSKEGKNFRDIGKNLGASLLTTNQINRMDNENKFFGYDGISQVFSGPVEMVKCFPIENGLSYVVFKVTNSKVGPVQEKDKFISYLTQMMNKDLLDSVIAYLKSQYSVTVHDNLIQRYLDGEK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target631 peptidyl prolyl cis-trans isomerase D signal peptide pr
315122544632 peptidyl prolyl cis-trans isomerase D signal peptide pr 1 0.0
241204737630 peptidyl-prolyl cis-trans isomerase D signal peptide pr 1 1e-107
86357790646 peptidyl prolyl cis-trans isomerase D signal peptide pr 1 1e-106
116252238630 peptidyl-prolyl cis-trans isomerase D [Rhizobium legumi 1 1e-106
209549414630 peptidyl-prolyl cis-trans isomerase D signal peptide pr 1 1e-106
190891851630 peptidyl-prolyl cis-trans isomerase D signal peptide pr 1 1e-106
327192898630 peptidyl-prolyl cis-trans isomerase D signal peptide pr 1 1e-105
222086022630 peptidyl prolyl cis-trans isomerase D signal peptide pr 1 1e-103
222148891629 peptidyl-prolyl cis-trans isomerase [Agrobacterium viti 1 2e-98
218675330579 peptidyl prolyl cis-trans isomerase D signal peptide pr 1 8e-98
>gi|315122544|ref|YP_004063033.1| peptidyl prolyl cis-trans isomerase D signal peptide protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 632 Back     alignment and organism information
 Score =  770 bits (1989), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/633 (59%), Positives = 486/633 (76%), Gaps = 3/633 (0%)

Query: 1   MLEIIRKASRTWVAKIFLVVLFVPFLIWGLSDALFSVSGSSTVVSVGRQKVPFSSFINSW 60
           MLEIIRKASRTWVAKIFLVVLFVPF++WG+SDA FS SG STVVSVG QK+P S+FI  W
Sbjct: 1   MLEIIRKASRTWVAKIFLVVLFVPFIVWGVSDAFFSFSGKSTVVSVGNQKIPLSAFIQIW 60

Query: 61  KQELGMISQKIGFVVNSERARSVGLDKKILDNLVSGATLDQFIEDIGLEADHGRVWGEIA 120
            QEL  +S++IGF V  ERARS  LDKKI ++LV+GA +DQFIED GLEA   RV+  I 
Sbjct: 61  TQELDALSRQIGFAVPPERARSAELDKKITEHLVAGAAIDQFIEDTGLEAPDSRVFEFIG 120

Query: 121 RSPLFHGKDNKFSHDVFVSRLAREGINEKEYIDHYTKMLSRTDVVGMFVGGMRPSNLLLD 180
             P+F+GKD KFSH+VF+S+LA+EG++EKEY++ Y KM+SR+D+  MF+GG + S  L +
Sbjct: 121 SQPIFYGKDGKFSHEVFLSKLAQEGVSEKEYVETYKKMISRSDIAEMFIGGDKSSRFLAE 180

Query: 181 QAKRFYFENRSVDYIVLNNRHVPAIADPSNAVLTQWFEKYKDNYRAPEYKRISYILFDVH 240
           Q  R Y ENR+++Y+VLN   VPA+ DP+  VL +WF K+K NYRAPEYK  SYI  DV+
Sbjct: 181 QMMRHYSENRTIEYVVLNAHDVPAVVDPAPVVLAEWFAKFKGNYRAPEYKSFSYIALDVN 240

Query: 241 EKEKKIEISNDELQAEYEKNKEKYFSPEIRTVEQLVFPNQKEADEAFQSLKKGKKFIQLA 300
           EKEK + ++  EL++EYEKNK +YFSPEIRTVEQLVFPNQKEA+EA +SLKKGKKFIQLA
Sbjct: 241 EKEKNVVVTESELRSEYEKNKNQYFSPEIRTVEQLVFPNQKEAEEALKSLKKGKKFIQLA 300

Query: 301 EEQGKSLSDISLGSFSKEYIPDVSLADSIFSLAKKGDFTPVIHGSFGYVIAHVSNIKPSF 360
           +E+GKSLSDISLGSFSKEYIPD SLAD IF+LAK+GD+T +IHGSFGYVIAHVS IKPSF
Sbjct: 301 KEKGKSLSDISLGSFSKEYIPDPSLADPIFALAKEGDYTSLIHGSFGYVIAHVSRIKPSF 360

Query: 361 TVSFQEVKKDIANQMRITKASEKVKEDYKRLEEFLALGTSMDEISRREKIVSIDLPLVDF 420
           T  F+++KK I +++R+ KAS+ V E+YK+ ++ L+ G +M +I+ +EK    DLP +++
Sbjct: 361 TTPFEQIKKSIEHKVRLAKASQVVLEEYKKAQDLLSSGKTMKDIATKEKFSFGDLPPLNY 420

Query: 421 AGKDVKGKEVAAIPYKEQLLFRVFGKDDPLSKDHTVALPDGSYMWVQIKESIPARDRKLE 480
            G D+K + V  IPYK+ LL R+F ++D L  D+T+ LPDGSY+  ++KE IPARDRKLE
Sbjct: 421 LGMDMKNRPVQKIPYKDHLLSRIFNQEDALVTDNTIQLPDGSYVIFKVKEVIPARDRKLE 480

Query: 481 EVLTDVKKDWKTVKTAEEVSSKANQLVLEYSKEGKNFRDIGKNLGASLLTTNQINRM--D 538
           EVLT+VKKDWK+++  E V +KA  LVL  +K GK+F D+  +L   +   + I RM  +
Sbjct: 481 EVLTEVKKDWKSIQQTEAVLNKAQNLVLACNK-GKSFADMASSLRKFISVKSNITRMTKE 539

Query: 539 NENKFFGYDGISQVFSGPVEMVKCFPIENGLSYVVFKVTNSKVGPVQEKDKFISYLTQMM 598
           +E      DGIS+VFSGPV MVK FPI+NG   VVFKV  SK+ P+ +K KFI  L +M+
Sbjct: 540 SEEGILENDGISRVFSGPVGMVKSFPIKNGAEQVVFKVVRSKINPMDDKKKFILSLEKMI 599

Query: 599 NKDLLDSVIAYLKSQYSVTVHDNLIQRYLDGEK 631
            KD+LDS IAYL+ QY V V+++LI +Y D  K
Sbjct: 600 GKDMLDSSIAYLRQQYPVYVNESLITKYFDQNK 632


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|241204737|ref|YP_002975833.1| peptidyl-prolyl cis-trans isomerase D signal peptide protein [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 630 Back     alignment and organism information
>gi|86357790|ref|YP_469682.1| peptidyl prolyl cis-trans isomerase D signal peptide protein [Rhizobium etli CFN 42] Length = 646 Back     alignment and organism information
>gi|116252238|ref|YP_768076.1| peptidyl-prolyl cis-trans isomerase D [Rhizobium leguminosarum bv. viciae 3841] Length = 630 Back     alignment and organism information
>gi|209549414|ref|YP_002281331.1| peptidyl-prolyl cis-trans isomerase D signal peptide protein [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 630 Back     alignment and organism information
>gi|190891851|ref|YP_001978393.1| peptidyl-prolyl cis-trans isomerase D signal peptide protein [Rhizobium etli CIAT 652] Length = 630 Back     alignment and organism information
>gi|327192898|gb|EGE59819.1| peptidyl-prolyl cis-trans isomerase D signal peptide protein [Rhizobium etli CNPAF512] Length = 630 Back     alignment and organism information
>gi|222086022|ref|YP_002544554.1| peptidyl prolyl cis-trans isomerase D signal peptide protein [Agrobacterium radiobacter K84] Length = 630 Back     alignment and organism information
>gi|222148891|ref|YP_002549848.1| peptidyl-prolyl cis-trans isomerase [Agrobacterium vitis S4] Length = 629 Back     alignment and organism information
>gi|218675330|ref|ZP_03524999.1| peptidyl prolyl cis-trans isomerase D signal peptide protein [Rhizobium etli GR56] Length = 579 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target631 peptidyl prolyl cis-trans isomerase D signal peptide pr
PRK00059336 PRK00059, prsA, peptidylprolyl isomerase; Provisional 9e-08
PRK10788623 PRK10788, PRK10788, periplasmic folding chaperone; Prov 9e-31
>gnl|CDD|178832 PRK00059, prsA, peptidylprolyl isomerase; Provisional Back     alignment and domain information
>gnl|CDD|182731 PRK10788, PRK10788, periplasmic folding chaperone; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 631 peptidyl prolyl cis-trans isomerase D signal peptide pr
PRK10788622 peptidyl-prolyl cis-trans isomerase (rotamase D); Provi 100.0
PRK00059336 prsA peptidylprolyl isomerase; Provisional 100.0
PRK03002285 prsA peptidylprolyl isomerase; Reviewed 100.0
PRK01326310 prsA foldase protein PrsA; Reviewed 99.97
PRK12450309 foldase protein PrsA; Reviewed 99.97
COG0760320 SurA Parvulin-like peptidyl-prolyl isomerase [Posttrans 99.84
PRK10770428 peptidyl-prolyl cis-trans isomerase SurA; Provisional 100.0
PRK04405298 prsA peptidylprolyl isomerase; Provisional 100.0
TIGR02925236 cis_trans_EpsD peptidyl-prolyl cis-trans isomerase, Eps 99.63
PRK03095287 prsA peptidylprolyl isomerase; Reviewed 100.0
PRK02998283 prsA peptidylprolyl isomerase; Reviewed 100.0
PRK10788622 peptidyl-prolyl cis-trans isomerase (rotamase D); Provi 99.92
PRK10770428 peptidyl-prolyl cis-trans isomerase SurA; Provisional 99.83
TIGR02933270 nifM_nitrog nitrogen fixation protein NifM; InterPro: I 99.82
pfam09312118 SurA_N SurA N-terminal domain. This domain is found at 99.65
pfam05698162 Trigger_C Bacterial trigger factor protein (TF) C-termi 94.63
pfam0063995 Rotamase PPIC-type PPIASE domain. Rotamases increase th 99.42
KOG3258133 consensus 99.19
KOG3259163 consensus 99.08
PRK00059336 prsA peptidylprolyl isomerase; Provisional 99.0
PRK03095287 prsA peptidylprolyl isomerase; Reviewed 98.67
PRK03002285 prsA peptidylprolyl isomerase; Reviewed 98.62
PRK04405298 prsA peptidylprolyl isomerase; Provisional 98.54
PRK02998283 prsA peptidylprolyl isomerase; Reviewed 98.51
PRK01326310 prsA foldase protein PrsA; Reviewed 98.39
PRK12450309 foldase protein PrsA; Reviewed 98.33
PRK01490435 tig trigger factor; Provisional 96.71
pfam0063995 Rotamase PPIC-type PPIASE domain. Rotamases increase th 95.84
TIGR02933270 nifM_nitrog nitrogen fixation protein NifM; InterPro: I 95.35
pfam05698162 Trigger_C Bacterial trigger factor protein (TF) C-termi 95.3
PRK00315195 potassium-transporting ATPase subunit C; Reviewed 93.8
>PRK10788 peptidyl-prolyl cis-trans isomerase (rotamase D); Provisional Back     alignment and domain information
>PRK00059 prsA peptidylprolyl isomerase; Provisional Back     alignment and domain information
>PRK03002 prsA peptidylprolyl isomerase; Reviewed Back     alignment and domain information
>PRK01326 prsA foldase protein PrsA; Reviewed Back     alignment and domain information
>PRK12450 foldase protein PrsA; Reviewed Back     alignment and domain information
>COG0760 SurA Parvulin-like peptidyl-prolyl isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10770 peptidyl-prolyl cis-trans isomerase SurA; Provisional Back     alignment and domain information
>PRK04405 prsA peptidylprolyl isomerase; Provisional Back     alignment and domain information
>TIGR02925 cis_trans_EpsD peptidyl-prolyl cis-trans isomerase, EpsD family; InterPro: IPR014274 Proteins in this entry include EpsD from Methylobacillus sp Back     alignment and domain information
>PRK03095 prsA peptidylprolyl isomerase; Reviewed Back     alignment and domain information
>PRK02998 prsA peptidylprolyl isomerase; Reviewed Back     alignment and domain information
>PRK10788 peptidyl-prolyl cis-trans isomerase (rotamase D); Provisional Back     alignment and domain information
>PRK10770 peptidyl-prolyl cis-trans isomerase SurA; Provisional Back     alignment and domain information
>TIGR02933 nifM_nitrog nitrogen fixation protein NifM; InterPro: IPR014282 Members of this entry are found in a subset of nitrogen-fixing bacteria and are annotated as nitrogen fixation protein NifM Back     alignment and domain information
>pfam09312 SurA_N SurA N-terminal domain Back     alignment and domain information
>pfam05698 Trigger_C Bacterial trigger factor protein (TF) C-terminus Back     alignment and domain information
>pfam00639 Rotamase PPIC-type PPIASE domain Back     alignment and domain information
>KOG3258 consensus Back     alignment and domain information
>KOG3259 consensus Back     alignment and domain information
>PRK00059 prsA peptidylprolyl isomerase; Provisional Back     alignment and domain information
>PRK03095 prsA peptidylprolyl isomerase; Reviewed Back     alignment and domain information
>PRK03002 prsA peptidylprolyl isomerase; Reviewed Back     alignment and domain information
>PRK04405 prsA peptidylprolyl isomerase; Provisional Back     alignment and domain information
>PRK02998 prsA peptidylprolyl isomerase; Reviewed Back     alignment and domain information
>PRK01326 prsA foldase protein PrsA; Reviewed Back     alignment and domain information
>PRK12450 foldase protein PrsA; Reviewed Back     alignment and domain information
>PRK01490 tig trigger factor; Provisional Back     alignment and domain information
>pfam00639 Rotamase PPIC-type PPIASE domain Back     alignment and domain information
>TIGR02933 nifM_nitrog nitrogen fixation protein NifM; InterPro: IPR014282 Members of this entry are found in a subset of nitrogen-fixing bacteria and are annotated as nitrogen fixation protein NifM Back     alignment and domain information
>pfam05698 Trigger_C Bacterial trigger factor protein (TF) C-terminus Back     alignment and domain information
>PRK00315 potassium-transporting ATPase subunit C; Reviewed Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target631 peptidyl prolyl cis-trans isomerase D signal peptide pr
1m5y_A408 Crystallographic Structure Of Sura, A Molecular Cha 3e-04
2pv3_A299 Crystallographic Structure Of Sura Fragment Lacking 0.002
>gi|27065591|pdb|1M5Y|A Chain A, Crystallographic Structure Of Sura, A Molecular Chaperone That Facilitates Outer Membrane Porin Folding Length = 408 Back     alignment and structure
 Score = 52.2 bits (122), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 23/119 (19%), Positives = 44/119 (36%), Gaps = 12/119 (10%)

Query: 56  FINSWKQELGMISQKIGFVVNSERARSVGLDKKILDNLVSGATLDQFIEDIGLEADHGRV 115
            + S K       Q++             L  +I++ L+    + Q  + +G++    ++
Sbjct: 25  LMQSVKLNAAQARQQLPDDAT--------LRHQIMERLIMDQIILQMGQKMGVKISDEQL 76

Query: 116 WGEIARSPLFHGKDNKFSHDVFVSRLAREGINEKEYIDHYTKMLSRTDVVGMFVGGMRP 174
              IA       K N  + D   SRLA +G+N   Y +   K +  ++V    V     
Sbjct: 77  DQAIANI----AKQNNMTLDQMRSRLAYDGLNYNTYRNQIRKEMIISEVRNNEVRRRIT 131


>gi|158429505|pdb|2PV3|A Chain A, Crystallographic Structure Of Sura Fragment Lacking The Second Peptidyl-Prolyl Isomerase Domain Complexed With Peptide Nftlkfwdifrk Length = 299 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target631 peptidyl prolyl cis-trans isomerase D signal peptide pr
2kgj_A102 Peptidyl-prolyl CIS-trans isomerase D; prolyl isomerase 3e-07
1zk6_A93 Foldase protein PRSA; alpha/beta structure, isomerase; 0.001
1jns_A92 Peptidyl-prolyl CIS-trans isomerase C; alpha-beta sandw 0.003
1eq3_A96 Peptidyl-prolyl CIS/trans isomerase (ppiase); parvulin; 0.004
1m5y_A408 SurviVal protein, surviVal protein SURA; surviVal prote 2e-05
>2kgj_A Peptidyl-prolyl CIS-trans isomerase D; prolyl isomerase, parvulin, cell inner membrane, cell membrane, membrane, rotamase, stress response; NMR {Escherichia coli} Length = 102 Back     alignment and structure
 Score = 52.2 bits (125), Expect = 3e-07
 Identities = 23/97 (23%), Positives = 40/97 (41%), Gaps = 7/97 (7%)

Query: 267 PEIRTVEQLVFPNQKEADEAFQSLKKGKKFIQLAEEQGKSLS----DISLGSFSKEYIPD 322
           P+      +    + EA      L KG  F  LA+E+   +        +G      IPD
Sbjct: 3   PQRTRYSIIQTKTEDEAKAVLDELNKGGDFAALAKEKSADIISARNGGDMGWLEDATIPD 62

Query: 323 VSLADSIFSLAKKGDFTPVIHGSFGYVIAHVSNIKPS 359
             L ++     +KG  + VI  S G++I  + +I+ +
Sbjct: 63  -ELKNAGL--KEKGQLSGVIKSSVGFLIVRLDDIQAA 96


>1zk6_A Foldase protein PRSA; alpha/beta structure, isomerase; NMR {Bacillus subtilis} Length = 93 Back     alignment and structure
>1jns_A Peptidyl-prolyl CIS-trans isomerase C; alpha-beta sandwich, CIS peptide bond; NMR {Escherichia coli} SCOP: d.26.1.1 PDB: 1jnt_A Length = 92 Back     alignment and structure
>1eq3_A Peptidyl-prolyl CIS/trans isomerase (ppiase); parvulin; NMR {Homo sapiens} SCOP: d.26.1.1 PDB: 1fjd_A Length = 96 Back     alignment and structure
>1m5y_A SurviVal protein, surviVal protein SURA; surviVal protein A, periplasmic molecular chaperone, membrane protein folding, GRAM negative bacteria; 3.00A {Escherichia coli} SCOP: a.223.1.2 d.26.1.1 d.26.1.1 PDB: 2pv3_A Length = 408 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target631 peptidyl prolyl cis-trans isomerase D signal peptide pr
1m5y_A408 SurviVal protein, surviVal protein SURA; surviVal prote 100.0
1m5y_A408 SurviVal protein, surviVal protein SURA; surviVal prote 99.7
2kgj_A102 Peptidyl-prolyl CIS-trans isomerase D; prolyl isomerase 99.68
1jns_A92 Peptidyl-prolyl CIS-trans isomerase C; alpha-beta sandw 99.67
1eq3_A96 Peptidyl-prolyl CIS/trans isomerase (ppiase); parvulin; 99.62
1yw5_A177 Peptidyl prolyl CIS/trans isomerase; WW-domain, ppiase 99.61
3i6c_A123 Peptidyl-prolyl CIS-trans isomerase NIMA- interacting 1 99.6
2jzv_A111 Foldase protein PRSA; ppiase, parvulin, proline isomera 99.55
2itk_A167 Peptidyl-prolyl CIS-trans isomerase NIMA- interacting 1 99.54
1j6y_A139 Peptidyl-prolyl CIS-trans isomerase; parvulin, PIN1, ph 99.52
3gpk_A112 PPIC-type peptidyl-prolyl CIS-trans isomerase; rotamase 99.52
2pv1_A103 Chaperone SURA; surviVal protein A, peptidyl-prolyl CIS 99.51
1zk6_A93 Foldase protein PRSA; alpha/beta structure, isomerase; 99.5
3gpk_A112 PPIC-type peptidyl-prolyl CIS-trans isomerase; rotamase 96.8
2pv1_A103 Chaperone SURA; surviVal protein A, peptidyl-prolyl CIS 96.58
2jzv_A111 Foldase protein PRSA; ppiase, parvulin, proline isomera 96.03
2itk_A167 Peptidyl-prolyl CIS-trans isomerase NIMA- interacting 1 95.94
1jns_A92 Peptidyl-prolyl CIS-trans isomerase C; alpha-beta sandw 95.92
1zk6_A93 Foldase protein PRSA; alpha/beta structure, isomerase; 95.82
1yw5_A177 Peptidyl prolyl CIS/trans isomerase; WW-domain, ppiase 95.76
1j6y_A139 Peptidyl-prolyl CIS-trans isomerase; parvulin, PIN1, ph 95.47
1eq3_A96 Peptidyl-prolyl CIS/trans isomerase (ppiase); parvulin; 92.74
3i6c_A123 Peptidyl-prolyl CIS-trans isomerase NIMA- interacting 1 96.34
2kgj_A102 Peptidyl-prolyl CIS-trans isomerase D; prolyl isomerase 93.49
3gty_X433 Trigger factor, TF; chaperone-client complex, cell cycl 95.19
1w26_A432 Trigger factor, TF; chaperone, protein folding, ribosom 95.01
2nsa_A170 Trigger factor, TF; chaperone; 1.70A {Thermotoga mariti 93.91
>1m5y_A SurviVal protein, surviVal protein SURA; surviVal protein A, periplasmic molecular chaperone, membrane protein folding, GRAM negative bacteria; 3.00A {Escherichia coli} SCOP: a.223.1.2 d.26.1.1 d.26.1.1 PDB: 2pv3_A Back     alignment and structure
Probab=100.00  E-value=5.3e-37  Score=258.18  Aligned_cols=381  Identities=16%  Similarity=0.129  Sum_probs=238.1

Q ss_pred             CCEEEEECCEECCHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHH
Q ss_conf             84289999878489999999999999999870889997899860138999999999999999999849824889999999
Q gi|254781158|r   40 SSTVVSVGRQKVPFSSFINSWKQELGMISQKIGFVVNSERARSVGLDKKILDNLVSGATLDQFIEDIGLEADHGRVWGEI  119 (631)
Q Consensus        40 ~~~va~V~g~~I~~~~f~~~~~~~~~~~~~~~g~~~~~~~~~~~~l~~qvl~~li~~~ll~~~a~~~gi~vsd~~v~~~i  119 (631)
                      ..+||+|||++||..||+++++....++.+. +..+++++    .+++++|++||++.|+.++|+++||.|||++|.+.|
T Consensus         6 ~~ivA~Vng~~It~~d~~~~~~~~~~~~~~~-~~~~~~~~----~lr~qvl~~LI~~~Ll~q~A~~lgi~vsd~ev~~~i   80 (408)
T 1m5y_A            6 DKVAAVVNNGVVLESDVDGLMQSVKLNAAQA-RQQLPDDA----TLRHQIMERLIMDQIILQMGQKMGVKISDEQLDQAI   80 (408)
T ss_dssp             CCEEEEESSSEEEHHHHHHHHHHHHHHHHTT-TCCCCCHH----HHHHHHHHHHHHHHHHHHHHHHTTCCCCHHHHHHHH
T ss_pred             CEEEEEECCEECCHHHHHHHHHHHHHHHHHC-CCCCCCHH----HHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHH
T ss_conf             7179999999628999999999999987632-46798459----999999999999999999999849997999999999


Q ss_pred             HHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             63476554210239899999998611005677678887754445554301454220022233455432111233321000
Q gi|254781158|r  120 ARSPLFHGKDNKFSHDVFVSRLAREGINEKEYIDHYTKMLSRTDVVGMFVGGMRPSNLLLDQAKRFYFENRSVDYIVLNN  199 (631)
Q Consensus       120 ~~~p~Fq~~~G~Fd~~~~~~~L~~~g~t~~~~~~~~~~~l~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~r~i~~~~~~~  199 (631)
                      .+++.+    +.|+...|.++|...|+++..|++.++.++..+++......                             
T Consensus        81 ~~~~~~----~~~~~~~~~~~l~~~~~~~~~~~~~~~~~l~~~~~~~~~~~-----------------------------  127 (408)
T 1m5y_A           81 ANIAKQ----NNMTLDQMRSRLAYDGLNYNTYRNQIRKEMIISEVRNNEVR-----------------------------  127 (408)
T ss_dssp             HHHHHH----TTCCHHHHHHHHHHHTCCHHHHHHHHHHHHHHHHHHHHHHH-----------------------------
T ss_pred             HHHHHH----CCCCHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHH-----------------------------
T ss_conf             999987----14237889999997388878888878899999998866532-----------------------------


Q ss_pred             CCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             01234567898899999765666555454433222211000000012578899987555545554332112378875300
Q gi|254781158|r  200 RHVPAIADPSNAVLTQWFEKYKDNYRAPEYKRISYILFDVHEKEKKIEISNDELQAEYEKNKEKYFSPEIRTVEQLVFPN  279 (631)
Q Consensus       200 ~~~~~~~~~td~el~~yy~~nk~~f~~pe~~~i~yv~~~~~~~~~~~~vt~~ei~~~Y~~~~~~f~~pe~~~~~~i~~~~  279 (631)
                          +.+.+++.++..||+.+...+..+....+.++.........      .....                      ..
T Consensus       128 ----~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~------~~~~~----------------------~~  175 (408)
T 1m5y_A          128 ----RRITILPQEVESLAQQVGNQNDASTELNLSHILIPLPENPT------SDQVN----------------------EA  175 (408)
T ss_dssp             ----HTCCCCTTHHHHHHHCC-------CCEEEEEEEEECCSSCC------HHHHH----------------------HH
T ss_pred             ----HHCCCCHHHHHHHHHHHHHCCCCCHHHHHHHHHCCCCCCCH------HHHHH----------------------HH
T ss_conf             ----10146635678999874310133103321111012333101------67899----------------------98


Q ss_pred             HHHHHHHHHHHHCCCCHHHHHHHHHCCC---CCCCCCCCCHHHCCCHHHHHHHHCCCCCCCEEEEEEECCCCHHHHHCCC
Q ss_conf             0014788875303651478877520112---3652453162322675677764202366722567861772112110233
Q gi|254781158|r  280 QKEADEAFQSLKKGKKFIQLAEEQGKSL---SDISLGSFSKEYIPDVSLADSIFSLAKKGDFTPVIHGSFGYVIAHVSNI  356 (631)
Q Consensus       280 ~~~A~~~~~~l~~g~~F~~la~~~~~~~---~~~~lg~~~~~~~~~~~~~~a~f~l~~~G~is~pv~t~~G~~iikv~~~  356 (631)
                      ...++......+.|.+|++++..++.+.   .++..||+..+.++ +.+...++.+ ++|++++|+....|||++++.+.
T Consensus       176 ~~~~~~~~~~~~~~~~F~~~~~~~s~~~~~~~~~~~~~~~~~~l~-~~~~~~~~~l-~~g~i~~~~~~~~~~~~~~~~~~  253 (408)
T 1m5y_A          176 ESQARAIVDQARNGADFGKLAIAHSADQQALNGGQMGWGRIQELP-GIFAQALSTA-KKGDIVGPIRSGVGFHILKVNDL  253 (408)
T ss_dssp             HHHHHHHHHHHHTTCCHHHHHHHHCCSTTGGGTTEEEEECGGGSC-HHHHTGGGTC-CTTCEEEEEEETTEEEEEEEEEE
T ss_pred             HHHHHHHHHHHHCCCHHHHHHHHHCCCHHHHHCCCCCCCCHHHCC-HHHHHHHHHH-CCCCCCCCCCCCCHHHHHHHHHH
T ss_conf             877899999875100499998871236265526863323301100-1678887651-35764454235542799999987


Q ss_pred             CCHHHH-HHHHHH--HHHHHH---HHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             301344-554322--333345---67999988888655657765420110012455408532001344411234565432
Q gi|254781158|r  357 KPSFTV-SFQEVK--KDIANQ---MRITKASEKVKEDYKRLEEFLALGTSMDEISRREKIVSIDLPLVDFAGKDVKGKEV  430 (631)
Q Consensus       357 ~~~~~~-~~~evk--~~I~~~---l~~~~a~~~~~~~~~~i~d~~~~g~~l~~~a~~~~~~~~~~~~~~~~~~~~~~~~~  430 (631)
                      ...... +.+.++  +.+...   -....+...+....   .+...++.+|.++|..++....+...    |.. .|...
T Consensus       254 ~~~~~~~~~~~v~~~~il~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~F~~~a~~~s~d~~s~~~----gg~-lg~~~  325 (408)
T 1m5y_A          254 RGESKNISVTEVHARHILLKPSPIMTDEQARVKLEQIA---ADIKSGKTTFAAAAKEFSQDPGSANQ----GGD-LGWAT  325 (408)
T ss_dssp             CCCCCCCCCEEEEEEEEEECCCSSSCHHHHHHHHHHHH---HHHHTTSSCHHHHHHHHCCCTTTGGG----TTE-EEEEC
T ss_pred             HHHHCCCCCCCCEEEEEEECCCCCCCHHHHHHHHHHHH---HHHHHCCCHHHHHHHHHCCCCCCHHH----CCC-CCCCC
T ss_conf             62100133320203444414877633389999999999---99872632389999982889550420----575-66677


Q ss_pred             CCCCCHHHHHHHHHHCCCCCCCCCCEECCCCEEEEEEEECCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             21111168888753112346776511136974999998023223346678889999999999999999999999
Q gi|254781158|r  431 AAIPYKEQLLFRVFGKDDPLSKDHTVALPDGSYMWVQIKESIPARDRKLEEVLTDVKKDWKTVKTAEEVSSKAN  504 (631)
Q Consensus       431 ~~~~~~~~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~l~evk~~V~~~~~~~k~~~~~~~~a~  504 (631)
                      ++ ...++....+|+.+. +..+.++....| |.+++|.++.+.. .+++++|+.|...+..+++.+.......
T Consensus       326 ~~-~~~~~~~~ai~~l~~-G~is~pv~t~~G-~hii~v~~~~~~~-~~~~~~~~~i~~~l~~~k~~~~~~~~l~  395 (408)
T 1m5y_A          326 PD-IFDPAFRDALTRLNK-GQMSAPVHSSFG-WHLIELLDTRNVD-KTDAAQKDRAYRMLMNRKFSEEAASWMQ  395 (408)
T ss_dssp             GG-GSCHHHHHHHHTCCT-TCBCCCEECSSC-EEEEEEEEEEECC---------HHHHHHHHHHHHHHHHHHHH
T ss_pred             CC-CCCHHHHHHHHCCCC-CCCCCCEECCCE-EEEEEEEEECCCC-CCCHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             45-478899999981899-990874783884-8999998740688-8746579999999999999999999999



>1m5y_A SurviVal protein, surviVal protein SURA; surviVal protein A, periplasmic molecular chaperone, membrane protein folding, GRAM negative bacteria; 3.00A {Escherichia coli} SCOP: a.223.1.2 d.26.1.1 d.26.1.1 PDB: 2pv3_A Back     alignment and structure
>2kgj_A Peptidyl-prolyl CIS-trans isomerase D; prolyl isomerase, parvulin, cell inner membrane, cell membrane, membrane, rotamase, stress response; NMR {Escherichia coli} Back     alignment and structure
>1jns_A Peptidyl-prolyl CIS-trans isomerase C; alpha-beta sandwich, CIS peptide bond; NMR {Escherichia coli} SCOP: d.26.1.1 PDB: 1jnt_A Back     alignment and structure
>1eq3_A Peptidyl-prolyl CIS/trans isomerase (ppiase); parvulin; NMR {Homo sapiens} SCOP: d.26.1.1 PDB: 1fjd_A Back     alignment and structure
>1yw5_A Peptidyl prolyl CIS/trans isomerase; WW-domain, ppiase domain, ordered linker; 1.60A {Candida albicans} Back     alignment and structure
>3i6c_A Peptidyl-prolyl CIS-trans isomerase NIMA- interacting 1; SBDD, small molecule, ppiase, cell cycle, nucleus, phosphoprotein, rotamase; HET: GIA; 1.30A {Homo sapiens} PDB: 3ik8_A 3ikd_A* 3ikg_A* 3jyj_A* 3kac_A* 1nmw_A Back     alignment and structure
>2jzv_A Foldase protein PRSA; ppiase, parvulin, proline isomerase, lipoprotein, membrane, palmitate, rotamase; NMR {Staphylococcus aureus} Back     alignment and structure
>2itk_A Peptidyl-prolyl CIS-trans isomerase NIMA- interacting 1; PIN1, isomerase, WW domain; HET: D11 NAL PE4; 1.45A {Homo sapiens} SCOP: b.72.1.1 d.26.1.1 PDB: 2q5a_A* 3kab_A* 3kag_A* 3kah_A* 3kai_A* 3kce_A* 1f8a_B* 3kad_A* 3kaf_A* 2zr6_A* 1nmv_A 1pin_A* 2zr4_A* 2zr5_A* 2zqt_A* 2zqs_A* 2zqv_A* 2zqu_A 2f21_A* 1zcn_A* ... Back     alignment and structure
>1j6y_A Peptidyl-prolyl CIS-trans isomerase; parvulin, PIN1, phosphorylation; NMR {Arabidopsis thaliana} SCOP: d.26.1.1 Back     alignment and structure
>3gpk_A PPIC-type peptidyl-prolyl CIS-trans isomerase; rotamase,ppiase domain, NYSGXRC,11189O3,PSI2., structural genomics; 1.55A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>2pv1_A Chaperone SURA; surviVal protein A, peptidyl-prolyl CIS-trans isomerase domain, peptide, complex; 1.30A {Escherichia coli} SCOP: d.26.1.1 PDB: 2pv2_A Back     alignment and structure
>1zk6_A Foldase protein PRSA; alpha/beta structure, isomerase; NMR {Bacillus subtilis} Back     alignment and structure
>3gpk_A PPIC-type peptidyl-prolyl CIS-trans isomerase; rotamase,ppiase domain, NYSGXRC,11189O3,PSI2., structural genomics; 1.55A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>2pv1_A Chaperone SURA; surviVal protein A, peptidyl-prolyl CIS-trans isomerase domain, peptide, complex; 1.30A {Escherichia coli} SCOP: d.26.1.1 PDB: 2pv2_A Back     alignment and structure
>2jzv_A Foldase protein PRSA; ppiase, parvulin, proline isomerase, lipoprotein, membrane, palmitate, rotamase; NMR {Staphylococcus aureus} Back     alignment and structure
>2itk_A Peptidyl-prolyl CIS-trans isomerase NIMA- interacting 1; PIN1, isomerase, WW domain; HET: D11 NAL PE4; 1.45A {Homo sapiens} SCOP: b.72.1.1 d.26.1.1 PDB: 2q5a_A* 3kab_A* 3kag_A* 3kah_A* 3kai_A* 3kce_A* 1f8a_B* 3kad_A* 3kaf_A* 2zr6_A* 1nmv_A 1pin_A* 2zr4_A* 2zr5_A* 2zqt_A* 2zqs_A* 2zqv_A* 2zqu_A 2f21_A* 1zcn_A* ... Back     alignment and structure
>1jns_A Peptidyl-prolyl CIS-trans isomerase C; alpha-beta sandwich, CIS peptide bond; NMR {Escherichia coli} SCOP: d.26.1.1 PDB: 1jnt_A Back     alignment and structure
>1zk6_A Foldase protein PRSA; alpha/beta structure, isomerase; NMR {Bacillus subtilis} Back     alignment and structure
>1yw5_A Peptidyl prolyl CIS/trans isomerase; WW-domain, ppiase domain, ordered linker; 1.60A {Candida albicans} Back     alignment and structure
>1j6y_A Peptidyl-prolyl CIS-trans isomerase; parvulin, PIN1, phosphorylation; NMR {Arabidopsis thaliana} SCOP: d.26.1.1 Back     alignment and structure
>1eq3_A Peptidyl-prolyl CIS/trans isomerase (ppiase); parvulin; NMR {Homo sapiens} SCOP: d.26.1.1 PDB: 1fjd_A Back     alignment and structure
>3i6c_A Peptidyl-prolyl CIS-trans isomerase NIMA- interacting 1; SBDD, small molecule, ppiase, cell cycle, nucleus, phosphoprotein, rotamase; HET: GIA; 1.30A {Homo sapiens} PDB: 3ik8_A 3ikd_A* 3ikg_A* 3jyj_A* 3kac_A* 1nmw_A Back     alignment and structure
>2kgj_A Peptidyl-prolyl CIS-trans isomerase D; prolyl isomerase, parvulin, cell inner membrane, cell membrane, membrane, rotamase, stress response; NMR {Escherichia coli} Back     alignment and structure
>3gty_X Trigger factor, TF; chaperone-client complex, cell cycle, cell division, chaperone, isomerase, rotamase, ribonucleoprotein; 3.40A {Thermotoga maritima} PDB: 3gu0_A Back     alignment and structure
>1w26_A Trigger factor, TF; chaperone, protein folding, ribosome associated protein, nascent chain, cell division, isomerase; 2.7A {Escherichia coli} SCOP: a.223.1.1 d.241.2.1 d.26.1.1 PDB: 2vrh_A 1w2b_5 Back     alignment and structure
>2nsa_A Trigger factor, TF; chaperone; 1.70A {Thermotoga maritima} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target631 peptidyl prolyl cis-trans isomerase D signal peptide pr
d1m5ya1173 Porin chaperone SurA, peptide-binding domain {Escherich 99.77
d1jnsa_92 Parvulin 10 (rotamase C) {Escherichia coli [TaxId: 562] 99.67
d1eq3a_96 Parvulin {Human (Homo sapiens), hpar14 [TaxId: 9606]} 99.63
d1pina2119 Mitotic rotamase PIN1, domain 2 {Human (Homo sapiens) [ 99.61
d1j6ya_120 Mitotic rotamase PIN1, domain 2 {Thale cress (Arabidops 99.56
d2pv2a1103 Porin chaperone SurA, PPIase domains {Escherichia coli 99.51
d1m5ya3108 Porin chaperone SurA, PPIase domains {Escherichia coli 99.5
d2pv2a1103 Porin chaperone SurA, PPIase domains {Escherichia coli 96.58
d1pina2119 Mitotic rotamase PIN1, domain 2 {Human (Homo sapiens) [ 96.26
d1jnsa_92 Parvulin 10 (rotamase C) {Escherichia coli [TaxId: 562] 96.16
d1m5ya3108 Porin chaperone SurA, PPIase domains {Escherichia coli 95.94
d1j6ya_120 Mitotic rotamase PIN1, domain 2 {Thale cress (Arabidops 95.49
d1eq3a_96 Parvulin {Human (Homo sapiens), hpar14 [TaxId: 9606]} 94.09
d1w26a1185 Trigger factor, C-terminal domain {Escherichia coli [Ta 95.35
>d1m5ya1 a.223.1.2 (A:25-164,A:395-427) Porin chaperone SurA, peptide-binding domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All alpha proteins
fold: Triger factor/SurA peptide-binding domain-like
superfamily: Triger factor/SurA peptide-binding domain-like
family: Porin chaperone SurA, peptide-binding domain
domain: Porin chaperone SurA, peptide-binding domain
species: Escherichia coli [TaxId: 562]
Probab=99.77  E-value=2e-17  Score=128.66  Aligned_cols=143  Identities=18%  Similarity=0.163  Sum_probs=116.3

Q ss_pred             CEEEEECCEECCHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHH
Q ss_conf             42899998784899999999999999998708899978998601389999999999999999998498248899999996
Q gi|254781158|r   41 STVVSVGRQKVPFSSFINSWKQELGMISQKIGFVVNSERARSVGLDKKILDNLVSGATLDQFIEDIGLEADHGRVWGEIA  120 (631)
Q Consensus        41 ~~va~V~g~~I~~~~f~~~~~~~~~~~~~~~g~~~~~~~~~~~~l~~qvl~~li~~~ll~~~a~~~gi~vsd~~v~~~i~  120 (631)
                      .+||+|||++||..|+..++.....++.++ |...+..+    .++.++|++||++.|+.++|+++||.||+++|...|.
T Consensus         3 ~VvA~Vn~~~It~~dl~~~~~~~~~~~~~~-~~~~~~~~----~l~~~vl~~LI~~~Ll~q~a~~~~i~vs~~ev~~~i~   77 (173)
T d1m5ya1           3 KVAAVVNNGVVLESDVDGLMQSVKLNAAQA-RQQLPDDA----TLRHQIMERLIMDQIILQMGQKMGVKISDEQLDQAIA   77 (173)
T ss_dssp             CEEEEESSSEEEHHHHHHHHHHHHHHHHTT-TCCCCCHH----HHHHHHHHHHHHHHHHHHHHHHTTCCCCHHHHHHHHH
T ss_pred             EEEEEECCEEECHHHHHHHHHHHHHHHHHC-CCCCCCHH----HHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHH
T ss_conf             389988998577999999999999998753-57798424----7999999999999999999987044589999999999


Q ss_pred             HHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             34765542102398999999986110056776788877544455543014542200222334554321112333210000
Q gi|254781158|r  121 RSPLFHGKDNKFSHDVFVSRLAREGINEKEYIDHYTKMLSRTDVVGMFVGGMRPSNLLLDQAKRFYFENRSVDYIVLNNR  200 (631)
Q Consensus       121 ~~p~Fq~~~G~Fd~~~~~~~L~~~g~t~~~~~~~~~~~l~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~r~i~~~~~~~~  200 (631)
                      ++ +   ..+.+|.+.|..+|..+|+|+..|++.++.++..+++.+...                               
T Consensus        78 ~~-~---~~~~~~~~~f~~~L~~~g~~~~~~~~~ir~~l~~~~l~~~~v-------------------------------  122 (173)
T d1m5ya1          78 NI-A---KQNNMTLDQMRSRLAYDGLNYNTYRNQIRKEMIISEVRNNEV-------------------------------  122 (173)
T ss_dssp             HH-H---HHTTCCHHHHHHHHHHHTCCHHHHHHHHHHHHHHHHHHHHHH-------------------------------
T ss_pred             HH-H---HHCCCCHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHH-------------------------------
T ss_conf             99-9---885898999999998739989999999999999999999983-------------------------------


Q ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             1234567898899999765666555
Q gi|254781158|r  201 HVPAIADPSNAVLTQWFEKYKDNYR  225 (631)
Q Consensus       201 ~~~~~~~~td~el~~yy~~nk~~f~  225 (631)
                        .+.+.||++|+++||+.+...|.
T Consensus       123 --~~~i~Vt~~Ei~~~~~~~~~~~~  145 (173)
T d1m5ya1         123 --RRRITILPQEVESLAQQVDRAYR  145 (173)
T ss_dssp             --HHTCCCCTTHHHHHHHCCCHHHH
T ss_pred             --CCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             --16898699999999998878887



>d1jnsa_ d.26.1.1 (A:) Parvulin 10 (rotamase C) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1eq3a_ d.26.1.1 (A:) Parvulin {Human (Homo sapiens), hpar14 [TaxId: 9606]} Back     information, alignment and structure
>d1pina2 d.26.1.1 (A:45-163) Mitotic rotamase PIN1, domain 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j6ya_ d.26.1.1 (A:) Mitotic rotamase PIN1, domain 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2pv2a1 d.26.1.1 (A:172-274) Porin chaperone SurA, PPIase domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m5ya3 d.26.1.1 (A:279-386) Porin chaperone SurA, PPIase domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pv2a1 d.26.1.1 (A:172-274) Porin chaperone SurA, PPIase domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pina2 d.26.1.1 (A:45-163) Mitotic rotamase PIN1, domain 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jnsa_ d.26.1.1 (A:) Parvulin 10 (rotamase C) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m5ya3 d.26.1.1 (A:279-386) Porin chaperone SurA, PPIase domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j6ya_ d.26.1.1 (A:) Mitotic rotamase PIN1, domain 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1eq3a_ d.26.1.1 (A:) Parvulin {Human (Homo sapiens), hpar14 [TaxId: 9606]} Back     information, alignment and structure
>d1w26a1 a.223.1.1 (A:248-432) Trigger factor, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 631 peptidyl prolyl cis-trans isomerase D signal pepti
2itk_A_167 (A:) Peptidyl-prolyl CIS-trans isomerase NIMA- int 4e-14
1j6y_A_139 (A:) Peptidyl-prolyl CIS-trans isomerase; parvulin 9e-10
1zk6_A_93 (A:) Foldase protein PRSA; alpha/beta structure, i 6e-08
1jns_A_92 (A:) Peptidyl-prolyl CIS-trans isomerase C; alpha- 1e-07
2pv1_A_103 (A:) Chaperone SURA; surviVal protein A, peptidyl- 2e-07
2kgj_A_102 (A:) Peptidyl-prolyl CIS-trans isomerase D; prolyl 3e-07
1m5y_A_149-258110 (A:149-258) SurviVal protein, surviVal protein SUR 7e-07
3gpk_A_112 (A:) PPIC-type peptidyl-prolyl CIS-trans isomerase 5e-06
1yw5_A_62-177116 (A:62-177) Peptidyl prolyl CIS/trans isomerase; WW 3e-05
1eq3_A_96 (A:) Peptidyl-prolyl CIS/trans isomerase (ppiase); 1e-04
>2itk_A (A:) Peptidyl-prolyl CIS-trans isomerase NIMA- interacting 1; PIN1, isomerase, WW domain; HET: D11 NAL PE4; 1.45A {Homo sapiens}Length = 167 Back     alignment and structure
 Score = 74.4 bits (182), Expect = 4e-14
 Identities = 17/150 (11%), Positives = 51/150 (34%), Gaps = 7/150 (4%)

Query: 208 PSNAVLTQWFEKYKDNYRAPEYKRISYILFDVHEKEKKIEISNDELQAEYEKNKEKYFSP 267
            S +    ++  +  N    E    +      + + +   +    L  ++ +++      
Sbjct: 19  MSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWR 78

Query: 268 EIRTVEQLVFPNQKEADEAFQSLKKGKKFIQLA----EEQGKSLSDISLGSFSKEYIPDV 323
           + +          +  +   Q +K G++  +       +   + +   LG+FS+  +   
Sbjct: 79  QEKITRTKEE-ALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQK- 136

Query: 324 SLADSIFSLAKKGDFTPVIHGSFGYVIAHV 353
              D+ F+L + G+ +  +    G  I   
Sbjct: 137 PFEDASFAL-RTGEMSGPVFTDSGIHIILR 165


>1j6y_A (A:) Peptidyl-prolyl CIS-trans isomerase; parvulin, PIN1, phosphorylation; NMR {Arabidopsis thaliana}Length = 139 Back     alignment and structure
>1zk6_A (A:) Foldase protein PRSA; alpha/beta structure, isomerase; NMR {Bacillus subtilis}Length = 93 Back     alignment and structure
>1jns_A (A:) Peptidyl-prolyl CIS-trans isomerase C; alpha-beta sandwich, CIS peptide bond; NMR {Escherichia coli}Length = 92 Back     alignment and structure
>2pv1_A (A:) Chaperone SURA; surviVal protein A, peptidyl-prolyl CIS-trans isomerase domain, peptide, complex; 1.30A {Escherichia coli}Length = 103 Back     alignment and structure
>2kgj_A (A:) Peptidyl-prolyl CIS-trans isomerase D; prolyl isomerase, parvulin, cell inner membrane, cell membrane, membrane, rotamase, stress response; NMR {Escherichia coli}Length = 102 Back     alignment and structure
>1m5y_A (A:149-258) SurviVal protein, surviVal protein SURA; surviVal protein A, periplasmic molecular chaperone, membrane protein folding, GRAM negative bacteria; 3.00A {Escherichia coli}Length = 110 Back     alignment and structure
>3gpk_A (A:) PPIC-type peptidyl-prolyl CIS-trans isomerase; rotamase,ppiase domain, NYSGXRC,11189O3,PSI2., structural genomics; 1.55A {Novosphingobium aromaticivorans DSM12444}Length = 112 Back     alignment and structure
>1yw5_A (A:62-177) Peptidyl prolyl CIS/trans isomerase; WW-domain, ppiase domain, ordered linker; 1.60A {Candida albicans}Length = 116 Back     alignment and structure
>1eq3_A (A:) Peptidyl-prolyl CIS/trans isomerase (ppiase); parvulin; NMR {Homo sapiens}Length = 96 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target631 peptidyl prolyl cis-trans isomerase D signal peptide pr
2itk_A_167 Peptidyl-prolyl CIS-trans isomerase NIMA- interact 99.7
1j6y_A_139 Peptidyl-prolyl CIS-trans isomerase; parvulin, PIN 99.69
2kgj_A_102 Peptidyl-prolyl CIS-trans isomerase D; prolyl isom 99.65
1jns_A_92 Peptidyl-prolyl CIS-trans isomerase C; alpha-beta 99.6
3gpk_A_112 PPIC-type peptidyl-prolyl CIS-trans isomerase; rot 99.6
1zk6_A_93 Foldase protein PRSA; alpha/beta structure, isomer 99.58
1m5y_A_149-258110 SurviVal protein, surviVal protein SURA; surviVal 99.56
2jzv_A_111 Foldase protein PRSA; ppiase, parvulin, proline is 99.56
1eq3_A_96 Peptidyl-prolyl CIS/trans isomerase (ppiase); parv 99.55
1yw5_A_62-177116 Peptidyl prolyl CIS/trans isomerase; WW-domain, pp 99.54
2pv1_A_103 Chaperone SURA; surviVal protein A, peptidyl-proly 99.54
1m5y_A_259-369111 SurviVal protein, surviVal protein SURA; surviVal 99.53
1m5y_A_1-70_401-40878 SurviVal protein, surviVal protein SURA; surviVal 98.78
2nsa_A_170 Trigger factor, TF; chaperone; 1.70A {Thermotoga m 98.09
1m5y_A_71-132_370-40093 SurviVal protein, surviVal protein SURA; surviVal 97.24
2pv1_A_103 Chaperone SURA; surviVal protein A, peptidyl-proly 97.23
1m5y_A_149-258110 SurviVal protein, surviVal protein SURA; surviVal 97.21
3gpk_A_112 PPIC-type peptidyl-prolyl CIS-trans isomerase; rot 97.19
1m5y_A_259-369111 SurviVal protein, surviVal protein SURA; surviVal 96.93
1jns_A_92 Peptidyl-prolyl CIS-trans isomerase C; alpha-beta 96.87
2jzv_A_111 Foldase protein PRSA; ppiase, parvulin, proline is 96.6
1j6y_A_139 Peptidyl-prolyl CIS-trans isomerase; parvulin, PIN 96.4
1yw5_A_62-177116 Peptidyl prolyl CIS/trans isomerase; WW-domain, pp 96.21
2itk_A_167 Peptidyl-prolyl CIS-trans isomerase NIMA- interact 96.18
1zk6_A_93 Foldase protein PRSA; alpha/beta structure, isomer 96.03
1eq3_A_96 Peptidyl-prolyl CIS/trans isomerase (ppiase); parv 95.63
2kgj_A_102 Peptidyl-prolyl CIS-trans isomerase D; prolyl isom 95.13
1t11_A_121-151_258-392166 Trigger factor, TF; helix-turn-helix, four-helix-b 94.24
1t11_A_121-151_258-392166 Trigger factor, TF; helix-turn-helix, four-helix-b 92.96
1zxj_A_218 MPN555, hypothetical protein Mg377 homolog; mostly 91.45
>2itk_A (A:) Peptidyl-prolyl CIS-trans isomerase NIMA- interacting 1; PIN1, isomerase, WW domain; HET: D11 NAL PE4; 1.45A {Homo sapiens} Back     alignment and structure
Probab=99.70  E-value=4.4e-20  Score=148.61  Aligned_cols=147  Identities=12%  Similarity=0.081  Sum_probs=129.8

Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             67898899999765666555454433222211000000012578899987555545554332112378875300001478
Q gi|254781158|r  206 ADPSNAVLTQWFEKYKDNYRAPEYKRISYILFDVHEKEKKIEISNDELQAEYEKNKEKYFSPEIRTVEQLVFPNQKEADE  285 (631)
Q Consensus       206 ~~~td~el~~yy~~nk~~f~~pe~~~i~yv~~~~~~~~~~~~vt~~ei~~~Y~~~~~~f~~pe~~~~~~i~~~~~~~A~~  285 (631)
                      ..++.++++.++..+...+...+.+...++..+...+.....+++++++.+|+.+...|..|+.+ ..+++..+++.|++
T Consensus        17 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~a~~   95 (167)
T 2itk_A           17 KAMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEK-ITRTKEEALELING   95 (167)
T ss_dssp             EEECTTTCCEEEEETTTCCEESSCCC------------CCSCEEEEEEEECCTTSSSCCCSSCSS-CCCCHHHHHHHHHH
T ss_pred             EEECCCCCCEEEEECCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCC-CCCCHHHHHHHHHH
T ss_conf             98828889578872677637766325665333454333355444332147632656774423333-20029999999999


Q ss_pred             HHHHHHCCCCHHHHHHHHHCC----CCCCCCCCCCHHHCCCHHHHHHHHCCCCCCCEEEEEEECCCCHHHHHCC
Q ss_conf             887530365147887752011----2365245316232267567776420236672256786177211211023
Q gi|254781158|r  286 AFQSLKKGKKFIQLAEEQGKS----LSDISLGSFSKEYIPDVSLADSIFSLAKKGDFTPVIHGSFGYVIAHVSN  355 (631)
Q Consensus       286 ~~~~l~~g~~F~~la~~~~~~----~~~~~lg~~~~~~~~~~~~~~a~f~l~~~G~is~pv~t~~G~~iikv~~  355 (631)
                      ++.+|++|.+|.+++..++++    .++|++||+.++.++ |+|++++|+| ++|+||+||+|++|||||||++
T Consensus        96 ~~~~l~~g~~f~~~aa~~~s~~~sa~~gG~lg~~~~~~l~-~~~~~~~~~l-~~Geis~pi~t~~G~~iikv~d  167 (167)
T 2itk_A           96 YIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQ-KPFEDASFAL-RTGEMSGPVFTDSGIHIILRTE  167 (167)
T ss_dssp             HHHHHHHTSSCHHHHHHHHCSSGGGGGTTEEEEECTTSSC-HHHHHHHHHS-CTTCBCCCEEETTEEEEEEECC
T ss_pred             HHHHHHHCCCCHHHHHHHHCCCCCCCCCHHHCCCCCCCCC-HHHHHHHHCC-CCCCCCCCEECCCCEEEEEEEC
T ss_conf             9998750212499999870778543322011135434346-9999999818-9998378788699179999949



>1j6y_A (A:) Peptidyl-prolyl CIS-trans isomerase; parvulin, PIN1, phosphorylation; NMR {Arabidopsis thaliana} Back     alignment and structure
>2kgj_A (A:) Peptidyl-prolyl CIS-trans isomerase D; prolyl isomerase, parvulin, cell inner membrane, cell membrane, membrane, rotamase, stress response; NMR {Escherichia coli} Back     alignment and structure
>1jns_A (A:) Peptidyl-prolyl CIS-trans isomerase C; alpha-beta sandwich, CIS peptide bond; NMR {Escherichia coli} Back     alignment and structure
>3gpk_A (A:) PPIC-type peptidyl-prolyl CIS-trans isomerase; rotamase,ppiase domain, NYSGXRC,11189O3,PSI2., structural genomics; 1.55A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>1zk6_A (A:) Foldase protein PRSA; alpha/beta structure, isomerase; NMR {Bacillus subtilis} Back     alignment and structure
>1m5y_A (A:149-258) SurviVal protein, surviVal protein SURA; surviVal protein A, periplasmic molecular chaperone, membrane protein folding, GRAM negative bacteria; 3.00A {Escherichia coli} Back     alignment and structure
>2jzv_A (A:) Foldase protein PRSA; ppiase, parvulin, proline isomerase, lipoprotein, membrane, palmitate, rotamase; NMR {Staphylococcus aureus} Back     alignment and structure
>1eq3_A (A:) Peptidyl-prolyl CIS/trans isomerase (ppiase); parvulin; NMR {Homo sapiens} Back     alignment and structure
>1yw5_A (A:62-177) Peptidyl prolyl CIS/trans isomerase; WW-domain, ppiase domain, ordered linker; 1.60A {Candida albicans} Back     alignment and structure
>2pv1_A (A:) Chaperone SURA; surviVal protein A, peptidyl-prolyl CIS-trans isomerase domain, peptide, complex; 1.30A {Escherichia coli} Back     alignment and structure
>1m5y_A (A:259-369) SurviVal protein, surviVal protein SURA; surviVal protein A, periplasmic molecular chaperone, membrane protein folding, GRAM negative bacteria; 3.00A {Escherichia coli} Back     alignment and structure
>1m5y_A (A:1-70,A:401-408) SurviVal protein, surviVal protein SURA; surviVal protein A, periplasmic molecular chaperone, membrane protein folding, GRAM negative bacteria; 3.00A {Escherichia coli} Back     alignment and structure
>2nsa_A (A:) Trigger factor, TF; chaperone; 1.70A {Thermotoga maritima} Back     alignment and structure
>1m5y_A (A:71-132,A:370-400) SurviVal protein, surviVal protein SURA; surviVal protein A, periplasmic molecular chaperone, membrane protein folding, GRAM negative bacteria; 3.00A {Escherichia coli} Back     alignment and structure
>2pv1_A (A:) Chaperone SURA; surviVal protein A, peptidyl-prolyl CIS-trans isomerase domain, peptide, complex; 1.30A {Escherichia coli} Back     alignment and structure
>1m5y_A (A:149-258) SurviVal protein, surviVal protein SURA; surviVal protein A, periplasmic molecular chaperone, membrane protein folding, GRAM negative bacteria; 3.00A {Escherichia coli} Back     alignment and structure
>3gpk_A (A:) PPIC-type peptidyl-prolyl CIS-trans isomerase; rotamase,ppiase domain, NYSGXRC,11189O3,PSI2., structural genomics; 1.55A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>1m5y_A (A:259-369) SurviVal protein, surviVal protein SURA; surviVal protein A, periplasmic molecular chaperone, membrane protein folding, GRAM negative bacteria; 3.00A {Escherichia coli} Back     alignment and structure
>1jns_A (A:) Peptidyl-prolyl CIS-trans isomerase C; alpha-beta sandwich, CIS peptide bond; NMR {Escherichia coli} Back     alignment and structure
>2jzv_A (A:) Foldase protein PRSA; ppiase, parvulin, proline isomerase, lipoprotein, membrane, palmitate, rotamase; NMR {Staphylococcus aureus} Back     alignment and structure
>1j6y_A (A:) Peptidyl-prolyl CIS-trans isomerase; parvulin, PIN1, phosphorylation; NMR {Arabidopsis thaliana} Back     alignment and structure
>1yw5_A (A:62-177) Peptidyl prolyl CIS/trans isomerase; WW-domain, ppiase domain, ordered linker; 1.60A {Candida albicans} Back     alignment and structure
>2itk_A (A:) Peptidyl-prolyl CIS-trans isomerase NIMA- interacting 1; PIN1, isomerase, WW domain; HET: D11 NAL PE4; 1.45A {Homo sapiens} Back     alignment and structure
>1zk6_A (A:) Foldase protein PRSA; alpha/beta structure, isomerase; NMR {Bacillus subtilis} Back     alignment and structure
>1eq3_A (A:) Peptidyl-prolyl CIS/trans isomerase (ppiase); parvulin; NMR {Homo sapiens} Back     alignment and structure
>2kgj_A (A:) Peptidyl-prolyl CIS-trans isomerase D; prolyl isomerase, parvulin, cell inner membrane, cell membrane, membrane, rotamase, stress response; NMR {Escherichia coli} Back     alignment and structure
>1t11_A (A:121-151,A:258-392) Trigger factor, TF; helix-turn-helix, four-helix-bundle, ppiase, chaperone; 2.50A {Vibrio cholerae} Back     alignment and structure
>1t11_A (A:121-151,A:258-392) Trigger factor, TF; helix-turn-helix, four-helix-bundle, ppiase, chaperone; 2.50A {Vibrio cholerae} Back     alignment and structure
>1zxj_A (A:) MPN555, hypothetical protein Mg377 homolog; mostly alpha helical protein, TRI-lobal structure, structural genomics, PSI; 2.80A {Mycoplasma pneumoniae} Back     alignment and structure