254781165

254781165

pyridoxamine 5'-phosphate oxidase

GeneID in NCBI database:8210190Locus tag:CLIBASIA_05360
Protein GI in NCBI database:254781165Protein Accession:YP_003065578.1
Gene range:-(1161129, 1161734)Protein Length:201aa
Gene description:pyridoxamine 5'-phosphate oxidase
COG prediction:[H] Pyridoxamine-phosphate oxidase
KEGG prediction:pdxH; pyridoxamine 5'-phosphate oxidase (EC:1.4.3.5); K00275 pyridoxamine 5'-phosphate oxidase [EC:1.4.3.5]
SEED prediction:Pyridoxamine-phosphate oxidase (EC 1.4.3.5)
Pathway involved in KEGG:Vitamin B6 metabolism [PATH:las00750]
Subsystem involved in SEED:Pyridoxin (Vitamin B6) Biosynthesis
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-
MKQDVPINNDVVFTLLSQWMQEAQSSESHDPHAVVLATADRMGFPNARVVLIKHFDQEGFVFYTNSQSPKGKEILENPKASLCFHWKSLARQLRVRGLVEKYCDLASDHYYASRPRESKIGAWASKQSQKMPSLDDLQKSVQRYSSFYQEKEIPRPVWWHGFRICPLSIEFWSERPYRLHDRLLFSRETIAGKWTQFLLYP
cccccccccccHHHHHHHHHHHHHHcccccccEEEEEEEcccccccEEEEEEEEccccEEEEEEccccHHHHHHHHcccEEEEEEcccccEEEEEEEEEEEccHHHHHHHHHccccccEEEEEEcccccccccHHHHHHHHHHHHHHccccccccccccEEEEEEcEEEEEccccccccEEEEEEEEcccccccEEEEccc
ccccccccccHHHHHHHHHHHHHHHcccccccEEEEEEEcccccEEEEEEEccEEEccEEEEEEEcccHHHHHHHHccEEEEEEEEHHHcEEEEEEEEEEEccHHHHHHHHccccHHHHHHHHHcccccccccHHHHHHHHHHHHHHcccccccccccEEEEEEcccEEEEEEccHHHccEEEEEEEEccEEEcEEEHccc
mkqdvpinNDVVFTLLSQWMQEaqsseshdphAVVLATADRMGFPNARVVLIKhfdqegfvfytnsqspkgkeilenpkaslCFHWKSLARQLRVRGLVEKYCDLasdhyyasrpreskigawaskqsqkmpslddLQKSVQRYSSFyqekeiprpvwwhgfricplsiefwserpyrlhdrllfsrETIAGKWTQFLLYP
MKQDVPINNDVVFTLLSQWMQEAQSSESHDPHAVVLATADRMGFPNARVVLIKHFDQEGFVFYTNSQSPKGKEILENPKASLCFHWKSLARQLRVRGLVEKYCDLASDHYYASRPRESKIGAWASKQSQKMPSLDDLQKSVQRYSSFyqekeiprpvwwhGFRICPLSIEFWSERPYRLHDRLlfsretiagkwtqfllyp
MKQDVPINNDVVFTLLSQWMQEAQSSESHDPHAVVLATADRMGFPNARVVLIKHFDQEGFVFYTNSQSPKGKEILENPKASLCFHWKSLARQLRVRGLVEKYCDLASDHYYASRPRESKIGAWASKQSQKMPSLDDLQKSVQRYSSFYQEKEIPRPVWWHGFRICPLSIEFWSERPYRLHDRLLFSRETIAGKWTQFLLYP
******INNDVVFTLLSQWMQEAQSSESHDPHAVVLATADRMGFPNARVVLIKHFDQEGFVFYTNSQSPKGKEILENPKASLCFHWKSLARQLRVRGLVEKYCDLASDHYYASRPRESKIGAWASKQSQKMPSLDDLQKSVQRYSSFYQEKEIPRPVWWHGFRICPLSIEFWSERPYRLHDRLLFSRETIAGKWTQFLLYP
MKQDVPINNDVVFTLLSQWM***********HAVVLATADRMGFPNARVVLIKHFDQEGFVFYTNSQSPKGKEILENPKASLCFHWKSLARQLRVRGLVEKYCDLASDHYYASRPRESKIGAW*************LQKSVQRYSSFYQEKEIPRPVWWHGFRICPLSIEFWSERPYRLHDRLLFSRETIAGKWTQFLLYP
*****PINNDVVFTLLSQWMQEAQSSESHDPHAVVLATADRMGFPNARVVLIKHFDQEGFVFYTNSQSPKGKEILENPKASLCFHWKSLARQLRVRGLVEKYCDLASDHYYASRPRESKIGAWASKQSQKMPSLDDLQKSVQRYSSFYQEKEIPRPVWWHGFRICPLSIEFWSERPYRLHDRLLFSRETIAGKWTQFLLYP
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKQDVPINNDVVFTLLSQWMQEAQSSESHDPHAVVLATADRMGFPNARVVLIKHFDQEGFVFYTNSQSPKGKEILENPKASLCFHWKSLARQLRVRGLVEKYCDLASDHYYASRPRESKIGAWASKQSQKMPSLDDLQKSVQRYSSFYQEKEIPRPVWWHGFRICPLSIEFWSERPYRLHDRLLFSRETIAGKWTQFLLYP
MKQDVPINNDVVFTLLSQWMQEAQSSESHDPHAVVLATADRMGFPNARVVLIKHFDQEGFVFYTNSQSPKGKEILENPKASLCFHWKSLARQLRVRGLVEKYCDLASDHYYASRPRESKIGAWASKQSQKMPSLDDLQKSVQRYSSFYQEKEIPRPVWWHGFRICPLSIEFWSERPYRLHDRLLFSRETIAGKWTQFLLYP
MKQDVPINNDVVFTLLSQWMQEAQSSESHDPHAVVLATADRMGFPNARVVLIKHFDQEGFVFYTNSQSPKGKEILENPKASLCFHWKSLARQLRVRGLVEKYCDLASDHYYASRPRESKIGAWASKQSQKMPSLDDLQKSVQRYSSFYQEKEIPRPVWWHGFRICPLSIEFWSERPYRLHDRLLFSRETIAGKWTQFLLYP

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target201 pyridoxamine 5'-phosphate oxidase [Candidatus Liberibac
315122548205 pyridoxamine 5'-phosphate oxidase [Candidatus Liberibac 1 2e-80
17987800208 pyridoxamine 5'-phosphate oxidase [Brucella melitensis 1 6e-60
161618391203 pyridoxamine 5'-phosphate oxidase [Brucella canis ATCC 1 7e-60
294851796203 pyridoxamine 5'-phosphate oxidase [Brucella sp. NVSL 07 1 8e-60
49475226207 pyridoxamine 5'-phosphate oxidase [Bartonella henselae 1 1e-59
189036765203 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate oxid 1 2e-59
153007876216 pyridoxamine 5'-phosphate oxidase [Ochrobactrum anthrop 1 2e-59
148558906208 pyridoxamine 5'-phosphate oxidase [Brucella ovis ATCC 2 1 2e-59
110633081209 pyridoxamine 5'-phosphate oxidase [Mesorhizobium sp. BN 1 2e-59
239831288203 pyridoxamine 5'-phosphate oxidase [Ochrobactrum interme 1 4e-59
>gi|315122548|ref|YP_004063037.1| pyridoxamine 5'-phosphate oxidase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 205 Back     alignment and organism information
 Score =  301 bits (772), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 140/195 (71%), Positives = 167/195 (85%), Gaps = 1/195 (0%)

Query: 8   NNDVVFTLLSQWMQEAQSSESHDPHAVVLATADRMGFPNARVVLIKHFDQEGFVFYTNSQ 67
              + FTLLSQWM++A+SSES+DPHA VLATADR GFPNARVVLIK+F++ GFVF+TN+Q
Sbjct: 11  TTKIFFTLLSQWMKKAESSESNDPHAAVLATADRKGFPNARVVLIKYFNKNGFVFFTNTQ 70

Query: 68  SPKGKEILENPKASLCFHWKSLARQLRVRGLVEKYCDLASDHYYASRPRESKIGAWASKQ 127
           S KG+EI ENP+ASLCFHWKSL RQLRVRGLVE YC   SD YYASRPR S+IGAWASKQ
Sbjct: 71  SFKGQEIKENPQASLCFHWKSLCRQLRVRGLVENYCPSKSDDYYASRPRGSQIGAWASKQ 130

Query: 128 SQKMPSLDDLQKSVQRYSSFYQE-KEIPRPVWWHGFRICPLSIEFWSERPYRLHDRLLFS 186
           SQKM S+D L+KSVQ+YS+ Y + +EIPRP+WW GF I PL +EFW ERPYRLH+R++FS
Sbjct: 131 SQKMESIDILKKSVQKYSALYDDSQEIPRPIWWSGFLIRPLYVEFWEERPYRLHERIVFS 190

Query: 187 RETIAGKWTQFLLYP 201
           RETI G+W +F+LYP
Sbjct: 191 RETITGEWKKFMLYP 205


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|17987800|ref|NP_540434.1| pyridoxamine 5'-phosphate oxidase [Brucella melitensis bv. 1 str. 16M] Length = 208 Back     alignment and organism information
>gi|161618391|ref|YP_001592278.1| pyridoxamine 5'-phosphate oxidase [Brucella canis ATCC 23365] Length = 203 Back     alignment and organism information
>gi|294851796|ref|ZP_06792469.1| pyridoxamine 5'-phosphate oxidase [Brucella sp. NVSL 07-0026] Length = 203 Back     alignment and organism information
>gi|49475226|ref|YP_033267.1| pyridoxamine 5'-phosphate oxidase [Bartonella henselae str. Houston-1] Length = 207 Back     alignment and organism information
>gi|189036765|sp|A6WWA8|PDXH_OCHA4 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate oxidase; AltName: Full=PNP/PMP oxidase; Short=PNPOx; AltName: Full=Pyridoxal 5'-phosphate synthase Length = 203 Back     alignment and organism information
>gi|153007876|ref|YP_001369091.1| pyridoxamine 5'-phosphate oxidase [Ochrobactrum anthropi ATCC 49188] Length = 216 Back     alignment and organism information
>gi|148558906|ref|YP_001258438.1| pyridoxamine 5'-phosphate oxidase [Brucella ovis ATCC 25840] Length = 208 Back     alignment and organism information
>gi|110633081|ref|YP_673289.1| pyridoxamine 5'-phosphate oxidase [Mesorhizobium sp. BNC1] Length = 209 Back     alignment and organism information
>gi|239831288|ref|ZP_04679617.1| pyridoxamine 5'-phosphate oxidase [Ochrobactrum intermedium LMG 3301] Length = 203 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target201 pyridoxamine 5'-phosphate oxidase [Candidatus Liberibac
PRK05679195 PRK05679, PRK05679, pyridoxamine 5'-phosphate oxidase; 7e-70
TIGR00558217 TIGR00558, pdxH, pyridoxamine-phosphate oxidase 6e-51
PLN03049462 PLN03049, PLN03049, pyridoxine (pyridoxamine) 5'-phosph 2e-47
KOG2586228 KOG2586, KOG2586, KOG2586, Pyridoxamine-phosphate oxida 2e-42
PLN02918544 PLN02918, PLN02918, pyridoxine (pyridoxamine) 5'-phosph 1e-40
COG0259214 COG0259, PdxH, Pyridoxamine-phosphate oxidase [Coenzyme 3e-63
pfam0124387 pfam01243, Pyridox_oxidase, Pyridoxamine 5'-phosphate o 3e-19
COG3871145 COG3871, COG3871, Uncharacterized stress protein (gener 6e-04
pfam1059041 pfam10590, PNPOx_C, Pyridoxine 5'-phosphate oxidase C-t 3e-11
>gnl|CDD|180195 PRK05679, PRK05679, pyridoxamine 5'-phosphate oxidase; Provisional Back     alignment and domain information
>gnl|CDD|129649 TIGR00558, pdxH, pyridoxamine-phosphate oxidase Back     alignment and domain information
>gnl|CDD|178609 PLN03049, PLN03049, pyridoxine (pyridoxamine) 5'-phosphate oxidase; Provisional Back     alignment and domain information
>gnl|CDD|37797 KOG2586, KOG2586, KOG2586, Pyridoxamine-phosphate oxidase [Coenzyme transport and metabolism] Back     alignment and domain information
>gnl|CDD|178506 PLN02918, PLN02918, pyridoxine (pyridoxamine) 5'-phosphate oxidase Back     alignment and domain information
>gnl|CDD|30608 COG0259, PdxH, Pyridoxamine-phosphate oxidase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|144728 pfam01243, Pyridox_oxidase, Pyridoxamine 5'-phosphate oxidase Back     alignment and domain information
>gnl|CDD|33661 COG3871, COG3871, Uncharacterized stress protein (general stress protein 26) [General function prediction only] Back     alignment and domain information
>gnl|CDD|151120 pfam10590, PNPOx_C, Pyridoxine 5'-phosphate oxidase C-terminal dimerization region Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 201 pyridoxamine 5'-phosphate oxidase [Candidatus Liberibac
) is a FMN flavoprotein involved in the de novo synthesis of pyridoxine (vitamin B6) and pyridoxal phosphate. It oxidizes pyridoxamine-5-P (PMP) and pyridoxine-5-P (PNP) to pyridoxal-5-P. The sequences of the enzyme from bacterial (genes pdxH or fprA) and fungal (gene PDX3) sources show that this protein has been highly conserved throughout evolution. PdxH is evolutionary related to one of the enzymes in the phenazine biosynthesis protein pathway, phzD (also known as phzG). ; GO: 0004733 pyridoxamine-phosphate oxidase activity, 0008615 pyridoxine biosynthetic process." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR00558">TIGR00558231 pdxH pyridoxamine 5'-phosphate oxidase; InterPro: IPR00 100.0
COG0259214 PdxH Pyridoxamine-phosphate oxidase [Coenzyme metabolis 100.0
PRK05679195 pyridoxamine 5'-phosphate oxidase; Provisional 100.0
KOG2586228 consensus 100.0
COG5135245 Uncharacterized conserved protein [Function unknown] 99.68
KOG4558251 consensus 99.38
COG3871145 Uncharacterized stress protein (general stress protein 99.36
pfam0124387 Pyridox_oxidase Pyridoxamine 5'-phosphate oxidase. 99.67
TIGR03618117 Rv1155_F420 PPOX class probable F420-dependent enzyme. 98.91
TIGR03667130 Rv3369 PPOX class probable F420-dependent enzyme, Rv336 98.82
COG5015132 Uncharacterized conserved protein [Function unknown] 98.15
PRK03467141 hypothetical protein; Provisional 97.94
TIGR03666132 Rv2061_F420 PPOX class probable F420-dependent enzyme, 97.44
PRK06733151 hypothetical protein; Provisional 96.9
COG3467166 Predicted flavin-nucleotide-binding protein [General fu 96.12
pfam04075132 DUF385 Domain of unknown function (DUF385). Family of M 95.61
TIGR03668141 Rv0121_F420 PPOX class probable F420-dependent enzyme, 93.73
COG3576173 Predicted flavin-nucleotide-binding protein structurall 93.24
TIGR00026122 hi_GC_TIGR00026 conserved hypothetical protein TIGR0002 91.17
pfam1059041 PNPOx_C Pyridoxine 5'-phosphate oxidase C-terminal dime 99.45
>TIGR00558 pdxH pyridoxamine 5'-phosphate oxidase; InterPro: IPR000659 Pyridoxamine 5'-phosphate oxidase (Back     alignment and domain information
>COG0259 PdxH Pyridoxamine-phosphate oxidase [Coenzyme metabolism] Back     alignment and domain information
>PRK05679 pyridoxamine 5'-phosphate oxidase; Provisional Back     alignment and domain information
>KOG2586 consensus Back     alignment and domain information
>COG5135 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4558 consensus Back     alignment and domain information
>COG3871 Uncharacterized stress protein (general stress protein 26) [General function prediction only] Back     alignment and domain information
>pfam01243 Pyridox_oxidase Pyridoxamine 5'-phosphate oxidase Back     alignment and domain information
>TIGR03618 Rv1155_F420 PPOX class probable F420-dependent enzyme Back     alignment and domain information
>TIGR03667 Rv3369 PPOX class probable F420-dependent enzyme, Rv3369 family Back     alignment and domain information
>COG5015 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK03467 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03666 Rv2061_F420 PPOX class probable F420-dependent enzyme, Rv2061 family Back     alignment and domain information
>PRK06733 hypothetical protein; Provisional Back     alignment and domain information
>COG3467 Predicted flavin-nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>pfam04075 DUF385 Domain of unknown function (DUF385) Back     alignment and domain information
>TIGR03668 Rv0121_F420 PPOX class probable F420-dependent enzyme, Rv0121 family Back     alignment and domain information
>COG3576 Predicted flavin-nucleotide-binding protein structurally related to pyridoxine 5'-phosphate oxidase [General function prediction only] Back     alignment and domain information
>TIGR00026 hi_GC_TIGR00026 conserved hypothetical protein TIGR00026; InterPro: IPR004378 The Mycobacterium tuberculosis paralogous family 11 groups a number of related hypothetical proteins from this organism Back     alignment and domain information
>pfam10590 PNPOx_C Pyridoxine 5'-phosphate oxidase C-terminal dimerization region Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target201 pyridoxamine 5'-phosphate oxidase [Candidatus Liberibac
1g76_A218 X-Ray Structure Of Escherichia Coli Pyridoxine 5'-P 1e-42
1g77_A218 X-Ray Structure Of Escherichia Coli Pyridoxine 5`-P 4e-41
1dnl_A199 X-Ray Structure Of Escherichia Coli Pyridoxine 5'-P 4e-41
1ci0_A228 Pnp Oxidase From Saccharomyces Cerevisiae Length = 3e-38
1nrg_A261 Structure And Properties Of Recombinant Human Pyrid 5e-38
3hy8_A261 Crystal Structure Of Human Pyridoxine 5'-Phosphate 6e-36
2a2j_A246 Crystal Structure Of A Putative Pyridoxine 5'-Phosp 2e-34
1t9m_A214 X-Ray Crystal Structure Of Phzg From Pseudomonas Ae 4e-30
1ty9_A222 X-Ray Crystal Structure Of Phzg From Pseudomonas Fl 1e-29
gi|11513353|pdb|1G76|A Chain A, X-Ray Structure Of Escherichia Coli Pyridoxine 5'-Phosphate Oxidase Complexed With Pyridoxal 5'-Phosphate At 2.0 A Resolution Length = 218 Back     alignment and structure
 Score =  176 bits (447), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 81/200 (40%), Positives = 115/200 (57%), Gaps = 5/200 (2%)

Query: 2   KQDVPINNDVVFTLLSQWMQEAQSSESHDPHAVVLATADRMGFPNARVVLIKHFDQEGFV 61
           ++D+P       TL  +W+ +A  ++  DP A+V+AT D  G P  R+VL+KH+D++G V
Sbjct: 24  RRDLPA---DPLTLFERWLSQACEAKLADPTAMVVATVDEHGQPYQRIVLLKHYDEKGMV 80

Query: 62  FYTNSQSPKGKEILENPKASLCFHWKSLARQLRVRGLVEKYCDLASDHYYASRPRESKIG 121
           FYTN  S K  +I  NP+ SL F W +L RQ+ V G  E+   L    Y+ SRPR+S+IG
Sbjct: 81  FYTNLGSRKAHQIENNPRVSLLFPWHTLERQVMVIGKAERLSTLEVMKYFHSRPRDSQIG 140

Query: 122 AWASKQSQKMPSLDDLQKSVQRYSSFYQEKEIPRPVWWHGFRICPLSIEFWSERPYRLHD 181
           AW SKQS ++ +   L+         +Q+ E+P P +W GFR+    IEFW    +RLHD
Sbjct: 141 AWVSKQSSRISARGILESKFLELKQKFQQGEVPLPSFWGGFRVSLEQIEFWQGGEHRLHD 200

Query: 182 RLLFSRETIAGKWTQFLLYP 201
           R L+ RE     W    L P
Sbjct: 201 RFLYQRE--NDAWKIDRLAP 218


>gi|11513355|pdb|1G77|A Chain A, X-Ray Structure Of Escherichia Coli Pyridoxine 5`-Phosphate Oxidase Complexed With Pyridoxal 5'-Phosphate At 2.0 A Resolution Length = 218 Back     alignment and structure
>gi|6730422|pdb|1DNL|A Chain A, X-Ray Structure Of Escherichia Coli Pyridoxine 5'-Phosphate Oxidase Complexed With Fmn At 1.8 Angstrom Resolution Length = 199 Back     alignment and structure
gi|6137743|pdb|1CI0|A Chain A, Pnp Oxidase From Saccharomyces Cerevisiae Length = 228 Back     alignment and structure
gi|28948989|pdb|1NRG|A Chain A, Structure And Properties Of Recombinant Human Pyridoxine-5'- Phosphate Oxidase Length = 261 Back     alignment and structure
>gi|254839583|pdb|3HY8|A Chain A, Crystal Structure Of Human Pyridoxine 5'-Phosphate Oxidase R229w Mutant Length = 261 Back     alignment and structure
>gi|75766013|pdb|2A2J|A Chain A, Crystal Structure Of A Putative Pyridoxine 5'-Phosphate Oxidase (Rv2607) From Mycobacterium Tuberculosis Length = 246 Back     alignment and structure
gi|56553849|pdb|1T9M|A Chain A, X-Ray Crystal Structure Of Phzg From Pseudomonas Aeruginosa Length = 214 Back     alignment and structure
gi|56966170|pdb|1TY9|A Chain A, X-Ray Crystal Structure Of Phzg From Pseudomonas Fluorescens Length = 222 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target201 pyridoxamine 5'-phosphate oxidase [Candidatus Liberibac
1nrg_A261 Pyridoxine 5'-phosphate oxidase; PLP, FMN, oxidoreducta 4e-55
2a2j_A246 Pyridoxamine 5'-phosphate oxidase; beta barrel, structu 2e-39
1dnl_A199 Pyridoxine 5'-phosphate oxidase; beta barrel, protein-F 5e-39
1ci0_A228 Protein (PNP oxidase); B6 metabolism, structural genomi 1e-35
1ty9_A222 Phenazine biosynthesis protein PHZG; chorismate, oxidor 9e-34
2i51_A195 Uncharacterized conserved protein of COG5135; ZP_001096 2e-27
2ou5_A175 Pyridoxamine 5'-phosphate oxidase-related, FMN- binding 2e-16
2fhq_A141 Putative general stress protein; alpha-beta structure, 3e-16
3dmb_A147 Putative general stress protein 26 with A PNP- oxidase 8e-16
2i02_A148 General stress protein of COG3871; ZP_00108720.1, , str 2e-15
2re7_A134 Uncharacterized protein; YP_263493.1, general stress pr 4e-14
2hq7_A146 Protein, related to general stress protein 26(GS26) of 8e-13
3ec6_A139 General stress protein 26; alpha-beta structure, struct 3e-08
1rfe_A162 Hypothetical protein RV2991; structural genomics, TB, F 2e-05
2iab_A155 Hypothetical protein; NP_828636.1, structural genomics, 3e-05
2hhz_A150 Pyridoxamine 5'-phosphate oxidase-related; ZP_00875725. 1e-27
2ig6_A150 NIMC/NIMA family protein; NP_349178.1, structural genom 3e-09
3f7e_A131 Pyridoxamine 5'-phosphate oxidase-related, FMN- binding 4e-09
3ba3_A145 Protein LP_0091, pyridoxamine 5'-phosphate oxidase-like 9e-09
2aq6_A147 Pyridoxine 5'-phosphate oxidase; pyridoxal 5'-phosphate 1e-07
1vl7_A157 Hypothetical protein ALR5027; 17134165, structural geno 6e-06
3dnh_A258 Uncharacterized protein ATU2129; APC6114, agrobacterium 0.002
3in6_A148 FMN-binding protein; YP_752906.1, structural genomics, 0.002
3db0_A128 LIN2891 protein; putative pyridoxamine 5'-phosphate oxi 0.002
3gas_A259 Heme oxygenase; FMN-binding split barrel, oxidoreductas 0.003
2q9k_A151 Uncharacterized protein; ZP_00539648.1, structural geno 2e-05
2htd_A140 Predicted flavin-nucleotide-binding protein from COG357 4e-04
>1nrg_A Pyridoxine 5'-phosphate oxidase; PLP, FMN, oxidoreductase; HET: FMN PLP; 1.95A {Homo sapiens} SCOP: b.45.1.1 PDB: 3hy8_A* Length = 261 Back     alignment and structure
 Score =  209 bits (532), Expect = 4e-55
 Identities = 77/203 (37%), Positives = 116/203 (57%), Gaps = 14/203 (6%)

Query: 13  FTLLSQWMQEA-QSSESHDPHAVVLATADRMGFPNARVVLIKHFDQEGFVFYTNSQSPKG 71
               + W +EA Q  +  + +A+ LAT  R G P+AR++L+K F ++GF F+TN +S KG
Sbjct: 59  VKQFAAWFEEAVQCPDIGEANAMCLATCTRDGKPSARMLLLKGFGKDGFRFFTNFESRKG 118

Query: 72  KEILENPKASLCFHWKSLARQLRVRGLVEKYCDLASDHYYASRPRESKIGAWASKQSQKM 131
           KE+  NP ASL F+W+ L RQ+RV G V+K  +  ++ Y+ SRP+ S+IGA  S QS  +
Sbjct: 119 KELDSNPFASLVFYWEPLNRQVRVEGPVKKLPEEEAECYFHSRPKSSQIGAVVSHQSSVI 178

Query: 132 PSLDDLQKSVQRYSSFYQEKEIPRPVWWHGFRICPLSIEFWSERPYRLHDRLLFSRETIA 191
           P  + L+K  +     YQ++E+P+P  W G+ + P  +EFW  +  RLHDR++F R    
Sbjct: 179 PDREYLRKKNEELEQLYQDQEVPKPKSWGGYVLYPQVMEFWQGQTNRLHDRIVFRRGLPT 238

Query: 192 G-------------KWTQFLLYP 201
           G              W    L P
Sbjct: 239 GDSPLGPMTHRGEEDWLYERLAP 261


>2a2j_A Pyridoxamine 5'-phosphate oxidase; beta barrel, structural genomics, mycobacterium tuberculosis structural proteomics project, XMTB; HET: CME; 2.50A {Mycobacterium tuberculosis} SCOP: b.45.1.1 Length = 246 Back     alignment and structure
>1dnl_A Pyridoxine 5'-phosphate oxidase; beta barrel, protein-FMN complex, oxidoreductase; HET: MSE FMN; 1.80A {Escherichia coli} SCOP: b.45.1.1 PDB: 1g79_A* 1g76_A* 1g78_A* 1g77_A* 1jnw_A* 1wv4_A* Length = 199 Back     alignment and structure
>1ci0_A Protein (PNP oxidase); B6 metabolism, structural genomics, PSI, protein structure initiative; HET: FMN; 2.70A {Saccharomyces cerevisiae} SCOP: b.45.1.1 Length = 228 Back     alignment and structure
>1ty9_A Phenazine biosynthesis protein PHZG; chorismate, oxidoreductase; HET: FMN; 1.80A {Pseudomonas fluorescens} SCOP: b.45.1.1 PDB: 1t9m_A* Length = 222 Back     alignment and structure
>2i51_A Uncharacterized conserved protein of COG5135; ZP_00109616.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE FMN; 1.40A {Nostoc punctiforme pcc 73102} Length = 195 Back     alignment and structure
>2ou5_A Pyridoxamine 5'-phosphate oxidase-related, FMN- binding; YP_508196.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE FMN; 1.60A {Jannaschia SP} Length = 175 Back     alignment and structure
>2fhq_A Putative general stress protein; alpha-beta structure, structural genomics, PSI, protein structure initiative; HET: MSE; 1.87A {Bacteroides thetaiotaomicron vpi-5482} SCOP: b.45.1.1 Length = 141 Back     alignment and structure
>3dmb_A Putative general stress protein 26 with A PNP- oxidase like fold; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 2.30A {Xanthomonas campestris PV} Length = 147 Back     alignment and structure
>2i02_A General stress protein of COG3871; ZP_00108720.1, , structural genomics, PSI-2, protein structure initiative; HET: MSE FMN P33; 1.80A {Nostoc punctiforme pcc 73102} SCOP: b.45.1.1 Length = 148 Back     alignment and structure
>2re7_A Uncharacterized protein; YP_263493.1, general stress protein COG3871, pyridoxamine 5'-phosphate oxidase, structural genomics; 2.50A {Psychrobacter arcticus 273-4} Length = 134 Back     alignment and structure
>2hq7_A Protein, related to general stress protein 26(GS26) of B.subtilis; NP_350077.1, joint center for structural genomics, JCSG; 2.00A {Clostridium acetobutylicum} SCOP: b.45.1.1 Length = 146 Back     alignment and structure
>3ec6_A General stress protein 26; alpha-beta structure, structural genomics of niaid; HET: FAD; 1.60A {Bacillus anthracis} Length = 139 Back     alignment and structure
>1rfe_A Hypothetical protein RV2991; structural genomics, TB, FMN binding, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis H37RV} SCOP: b.45.1.1 Length = 162 Back     alignment and structure
>2iab_A Hypothetical protein; NP_828636.1, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI; 2.00A {Streptomyces avermitilis} Length = 155 Back     alignment and structure
>2hhz_A Pyridoxamine 5'-phosphate oxidase-related; ZP_00875725.1, structural genomics, joint center for structural genomics, JCSG; 2.00A {Streptococcus suis 89} Length = 150 Back     alignment and structure
>2ig6_A NIMC/NIMA family protein; NP_349178.1, structural genomics, PSI-2, protein structure initiative, joint center for structural genomics; HET: FMN; 1.80A {Clostridium acetobutylicum} Length = 150 Back     alignment and structure
>3f7e_A Pyridoxamine 5'-phosphate oxidase-related, FMN- binding; F420 dependent reductase, unknown function; HET: MSE; 1.23A {Mycobacterium smegmatis} Length = 131 Back     alignment and structure
>3ba3_A Protein LP_0091, pyridoxamine 5'-phosphate oxidase-like protein; NP_783940.1, structural genomics; HET: MSE; 1.55A {Lactobacillus plantarum WCFS1} Length = 145 Back     alignment and structure
>2aq6_A Pyridoxine 5'-phosphate oxidase; pyridoxal 5'-phosphate, structural genomics, PSI, protein structure initiative; HET: PLP; 1.70A {Mycobacterium tuberculosis} SCOP: b.45.1.1 PDB: 1xxo_A 1y30_A* 1w9a_A* Length = 147 Back     alignment and structure
>1vl7_A Hypothetical protein ALR5027; 17134165, structural genomics, JCSG, protein structure initiative, PSI, joint center for structural genomics; 1.50A {Nostoc SP} SCOP: b.45.1.1 Length = 157 Back     alignment and structure
>3dnh_A Uncharacterized protein ATU2129; APC6114, agrobacterium tumefaciens STR. C58, structural genomics, PSI-2; 1.94A {Agrobacterium tumefaciens str} Length = 258 Back     alignment and structure
>3in6_A FMN-binding protein; YP_752906.1, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: FMN; 2.12A {Syntrophomonas wolfei subsp} Length = 148 Back     alignment and structure
>3db0_A LIN2891 protein; putative pyridoxamine 5'-phosphate oxidase, structural genomics, joint center for structural genomics, JCSG; 2.00A {Listeria innocua} Length = 128 Back     alignment and structure
>3gas_A Heme oxygenase; FMN-binding split barrel, oxidoreductase; HET: HEM; 1.80A {Helicobacter pylori} Length = 259 Back     alignment and structure
>2q9k_A Uncharacterized protein; ZP_00539648.1, structural genomics, joint center for structural genomics, JCSG; HET: UNL; 1.59A {Exiguobacterium sibiricum 255-15} Length = 151 Back     alignment and structure
>2htd_A Predicted flavin-nucleotide-binding protein from COG3576 family structurally related...; ZP_00387536.1, structural genomics; HET: MSE; 1.60A {Lactobacillus delbrueckii subsp} Length = 140 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target201 pyridoxamine 5'-phosphate oxidase [Candidatus Liberibac
1nrg_A261 Pyridoxine 5'-phosphate oxidase; PLP, FMN, oxidoreducta 100.0
2a2j_A246 Pyridoxamine 5'-phosphate oxidase; beta barrel, structu 100.0
1dnl_A199 Pyridoxine 5'-phosphate oxidase; beta barrel, protein-F 100.0
1ci0_A228 Protein (PNP oxidase); B6 metabolism, structural genomi 100.0
1ty9_A222 Phenazine biosynthesis protein PHZG; chorismate, oxidor 100.0
2i51_A195 Uncharacterized conserved protein of COG5135; pyridoxam 100.0
2ou5_A175 Pyridoxamine 5'-phosphate oxidase-related, FMN- binding 100.0
2hhz_A150 Pyridoxamine 5'-phosphate oxidase-related; ZP_00875725. 99.86
3dmb_A147 Putative general stress protein 26 with A PNP- oxidase 99.83
2fhq_A141 Putative general stress protein; alpha-beta structure, 99.8
2hq7_A146 Protein, related to general stress protein 26(GS26) of 99.77
2i02_A148 General stress protein of COG3871; pyridoxamine 5'-phos 99.76
3ec6_A139 General stress protein 26; alpha-beta structure, struct 99.71
2iab_A155 Hypothetical protein; NP_828636.1, structural genomics, 99.67
1rfe_A162 Hypothetical protein RV2991; structural genomics, TB, F 99.39
2qea_A160 Putative general stress protein 26; structural genomics 99.31
2ol5_A202 PAI 2 protein; structural genomics, PSI-2, protein stru 96.18
2re7_A134 Uncharacterized protein; YP_263493.1, general stress pr 99.85
2ig6_A150 NIMC/NIMA family protein; NP_349178.1, structural genom 99.66
3db0_A128 LIN2891 protein; putative pyridoxamine 5'-phosphate oxi 99.54
2asf_A137 Hypothetical protein RV2074; H37RV, structural genomics 99.37
1vl7_A157 Hypothetical protein ALR5027; 17134165, structural geno 99.11
3gas_A259 Heme oxygenase; FMN-binding split barrel, oxidoreductas 98.51
1xhn_A184 CREG, cellular repressor of E1A-stimulated genes; beta- 96.99
2htd_A140 Predicted flavin-nucleotide-binding protein from family 99.32
3f7e_A131 Pyridoxamine 5'-phosphate oxidase-related, FMN- binding 99.31
2aq6_A147 Pyridoxine 5'-phosphate oxidase; pyridoxal 5'-phosphate 99.24
2fg9_A178 5-nitroimidazole antibiotic resistance protein; STR gen 99.22
3ba3_A145 Protein LP_0091, pyridoxamine 5'-phosphate oxidase-like 99.22
3a6r_A122 FMN-binding protein; electron transport, flavoprotein; 99.12
2q9k_A151 Uncharacterized protein; ZP_00539648.1, structural geno 99.02
2hq9_A149 MLL6688 protein; NP_107146.1, hypothetical protein, str 98.78
3in6_A148 FMN-binding protein; YP_752906.1, structural genomics, 98.65
2hti_A185 BH0577 protein; structural genomics, joint center for s 98.53
2arz_A247 Hypothetical protein PA4388; hypothetical protein,struc 98.42
3dnh_A258 Uncharacterized protein ATU2129; APC6114, agrobacterium 98.31
3fkh_A138 Putative pyridoxamine 5'-phosphate oxidase; NP_601736.1 98.21
2vpa_A216 NIMA-related protein; cofactor, atomic resolution, anti 97.76
2fur_A209 Hypothetical protein; structural genomics, joint center 97.63
3cp3_A148 Uncharacterized protein; alpha-beta fold, structural ge 97.3
3h96_A143 Uncharacterized protein; pnpox, F420, flavin, reductase 92.72
>1nrg_A Pyridoxine 5'-phosphate oxidase; PLP, FMN, oxidoreductase; HET: FMN PLP; 1.95A {Homo sapiens} SCOP: b.45.1.1 PDB: 3hy8_A* Back     alignment and structure
Probab=100.00  E-value=0  Score=476.06  Aligned_cols=194  Identities=39%  Similarity=0.692  Sum_probs=187.1

Q ss_pred             CCCCHHHHHHHHHHHHHHC-CCCCCCEEEEEEECCCCCEEEEEEEHHEEECCEEEEEECCCCCCHHHHHCCCCEEEEEEC
Q ss_conf             8769799999999999985-888955799985859987732210130000330589951785201223118947999736
Q gi|254781165|r    8 NNDVVFTLLSQWMQEAQSS-ESHDPHAVVLATADRMGFPNARVVLIKHFDQEGFVFYTNSQSPKGKEILENPKASLCFHW   86 (201)
Q Consensus         8 ~~~~P~~lf~~W~~~A~~~-~~~~p~a~~LaTvd~~g~p~~R~V~lr~~~~~g~~f~Tn~~S~K~~~l~~np~~al~f~w   86 (201)
                      ...|||++|+.||++|.+. ++.+||||+|||||++|.|++|||+||+|+++||+|||||+|+|+++|+.||+|||+|||
T Consensus        54 ~~~dP~~lF~~W~~eA~~~~~~~ePnAm~LATvd~dG~PssR~VlLK~i~~~GfvFfTN~~SrKg~eL~~Np~asl~F~W  133 (261)
T 1nrg_A           54 TSLDPVKQFAAWFEEAVQCPDIGEANAMCLATCTRDGKPSARMLLLKGFGKDGFRFFTNFESRKGKELDSNPFASLVFYW  133 (261)
T ss_dssp             SCSSHHHHHHHHHHHHHHCTTCSCTTEEEEEEECTTSCEEEEEEECCCEETTEEEEEEETTSHHHHHHHHSCEEEEEEEE
T ss_pred             CCCCHHHHHHHHHHHHHHCCCCCCCCEEEEEEECCCCCEEEEEEEEEEECCCCEEEEEECCCCHHHHHHHCCEEEEEEEE
T ss_conf             88998999999999999738999986769987779998868899985775884699961575011436429805999852


Q ss_pred             CCCEEEEEEEEEEECCCHHHHHHHHHCCCCCCCEEEEECCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCEEEEEEE
Q ss_conf             66408999998752176378889752388333502662177656787777888888888750578877979732799970
Q gi|254781165|r   87 KSLARQLRVRGLVEKYCDLASDHYYASRPRESKIGAWASKQSQKMPSLDDLQKSVQRYSSFYQEKEIPRPVWWHGFRICP  166 (201)
Q Consensus        87 ~~~~rQiRi~G~~~~l~~~~~d~yf~~Rp~~sqi~a~~s~QS~~i~s~~~l~~~~~~~~~~~~~~~ip~P~~w~g~~i~P  166 (201)
                      ++++|||||+|.|++++++++|+||++||++|||+||+|+||++|++++.|+++++++.++|.+++||||++||||+|+|
T Consensus       134 ~~l~RQVRI~G~~~kl~~e~sd~yf~sRP~~sqi~A~~S~QS~~i~~r~~L~~~~~~~~~~~~~~~iprP~~WgGy~l~P  213 (261)
T 1nrg_A          134 EPLNRQVRVEGPVKKLPEEEAECYFHSRPKSSQIGAVVSHQSSVIPDREYLRKKNEELEQLYQDQEVPKPKSWGGYVLYP  213 (261)
T ss_dssp             GGGTEEEEEEEEEEECCHHHHHHHHHHSCHHHHHHHHHCCTTSCCSCHHHHHHHHHHHHHHTTTSCCCCCTTEEEEEECC
T ss_pred             CCCCEEEEEEEEEEECCCHHHHHHHHCCCHHHCCEEEECCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCEEEEEEE
T ss_conf             67786999999999837277788875398554240782267576888999999999999871679998999867799980


Q ss_pred             EEEEECCCCCCCCCEEEEEEEE-------------CCCCCEEEEECCC
Q ss_conf             0799613789864026999881-------------5899707996289
Q gi|254781165|r  167 LSIEFWSERPYRLHDRLLFSRE-------------TIAGKWTQFLLYP  201 (201)
Q Consensus       167 ~~iEFw~~~~~rlHdR~~y~~~-------------~~~~~W~~~~L~P  201 (201)
                      ++||||||+++|||||++|+|.             ..+++|.++||+|
T Consensus       214 ~~iEFWqg~~~RlHdR~~y~R~~~~~~~~~~~~~~~~~~~W~~~RL~P  261 (261)
T 1nrg_A          214 QVMEFWQGQTNRLHDRIVFRRGLPTGDSPLGPMTHRGEEDWLYERLAP  261 (261)
T ss_dssp             SEEEEEECCTTSCCEEEEEEECSSTTSCCCCTTCEECSTTEEEEECCC
T ss_pred             CEEEECCCCCCCCEEEEEEEECCCCCCCCCCCCCCCCCCCEEEEEECC
T ss_conf             699966899987551699994487655443322456789846997069



>2a2j_A Pyridoxamine 5'-phosphate oxidase; beta barrel, structural genomics, mycobacterium tuberculosis structural proteomics project, XMTB; HET: CME; 2.50A {Mycobacterium tuberculosis} SCOP: b.45.1.1 Back     alignment and structure
>1dnl_A Pyridoxine 5'-phosphate oxidase; beta barrel, protein-FMN complex, oxidoreductase; HET: MSE FMN; 1.80A {Escherichia coli K12} SCOP: b.45.1.1 PDB: 1g79_A* 1g76_A* 1g78_A* 1g77_A* 1jnw_A* 1wv4_A* Back     alignment and structure
>1ci0_A Protein (PNP oxidase); B6 metabolism, structural genomics, PSI, protein structure initiative; HET: FMN; 2.70A {Saccharomyces cerevisiae} SCOP: b.45.1.1 Back     alignment and structure
>1ty9_A Phenazine biosynthesis protein PHZG; chorismate, oxidoreductase; HET: FMN; 1.80A {Pseudomonas fluorescens} SCOP: b.45.1.1 PDB: 1t9m_A* Back     alignment and structure
>2i51_A Uncharacterized conserved protein of COG5135; pyridoxamine 5'-phosphate oxidase-related protein, structura genomics; HET: MSE FMN; 1.40A {Nostoc punctiforme pcc 73102} Back     alignment and structure
>2ou5_A Pyridoxamine 5'-phosphate oxidase-related, FMN- binding; YP_508196.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE FMN; 1.60A {Jannaschia SP} Back     alignment and structure
>2hhz_A Pyridoxamine 5'-phosphate oxidase-related; ZP_00875725.1, structural genomics, joint center for structural genomics, JCSG; 2.00A {Streptococcus suis 89} Back     alignment and structure
>3dmb_A Putative general stress protein 26 with A PNP- oxidase like fold; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 2.30A {Xanthomonas campestris PV} Back     alignment and structure
>2fhq_A Putative general stress protein; alpha-beta structure, structural genomics, PSI, protein structure initiative; HET: MSE; 1.87A {Bacteroides thetaiotaomicron vpi-5482} SCOP: b.45.1.1 Back     alignment and structure
>2hq7_A Protein, related to general stress protein 26(GS26) of B.subtilis; NP_350077.1, joint center for structural genomics, JCSG; 2.00A {Clostridium acetobutylicum} SCOP: b.45.1.1 Back     alignment and structure
>2i02_A General stress protein of COG3871; pyridoxamine 5'-phosphate like family protein, structural genomics; HET: MSE FMN P33; 1.80A {Nostoc punctiforme pcc 73102} SCOP: b.45.1.1 Back     alignment and structure
>3ec6_A General stress protein 26; alpha-beta structure, structural genomics of niaid; HET: FAD; 1.60A {Bacillus anthracis} Back     alignment and structure
>2iab_A Hypothetical protein; NP_828636.1, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI; 2.00A {Streptomyces avermitilis} Back     alignment and structure
>1rfe_A Hypothetical protein RV2991; structural genomics, TB, FMN binding, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis H37RV} SCOP: b.45.1.1 Back     alignment and structure
>2qea_A Putative general stress protein 26; structural genomics, JOI for structural genomics, JCSG, protein structure initiative oxidoreductase; 2.46A {Jannaschia SP} Back     alignment and structure
>2ol5_A PAI 2 protein; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.50A {Geobacillus stearothermophilus} Back     alignment and structure
>2re7_A Uncharacterized protein; YP_263493.1, general stress protein COG3871, pyridoxamine 5'-phosphate oxidase, structural genomics; 2.50A {Psychrobacter arcticus 273-4} Back     alignment and structure
>2ig6_A NIMC/NIMA family protein; NP_349178.1, structural genomics, PSI-2, protein structure initiative, joint center for structural genomics; HET: FMN; 1.80A {Clostridium acetobutylicum} Back     alignment and structure
>3db0_A LIN2891 protein; putative pyridoxamine 5'-phosphate oxidase, structural genomics, joint center for structural genomics, JCSG; 2.00A {Listeria innocua} Back     alignment and structure
>2asf_A Hypothetical protein RV2074; H37RV, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: CIT; 1.60A {Mycobacterium tuberculosis} SCOP: b.45.1.1 Back     alignment and structure
>1vl7_A Hypothetical protein ALR5027; 17134165, structural genomics, JCSG, protein structure initiative, PSI, joint center for structural genomics; 1.50A {Nostoc SP} SCOP: b.45.1.1 Back     alignment and structure
>3gas_A Heme oxygenase; FMN-binding split barrel, oxidoreductase; HET: HEM; 1.80A {Helicobacter pylori} Back     alignment and structure
>1xhn_A CREG, cellular repressor of E1A-stimulated genes; beta-barrel, unknown function; HET: MSE; 1.95A {Homo sapiens} SCOP: b.45.1.1 Back     alignment and structure
>2htd_A Predicted flavin-nucleotide-binding protein from family structurally related to pyridoxine...; putative pyridoxamine 5'-phosphate oxidase; HET: MSE; 1.60A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>3f7e_A Pyridoxamine 5'-phosphate oxidase-related, FMN- binding; F420 dependent reductase, unknown function; HET: MSE; 1.23A {Mycobacterium smegmatis} Back     alignment and structure
>2aq6_A Pyridoxine 5'-phosphate oxidase; pyridoxal 5'-phosphate, structural genomics, PSI, protein structure initiative; HET: PLP; 1.70A {Mycobacterium tuberculosis} SCOP: b.45.1.1 PDB: 1xxo_A 1y30_A* 1w9a_A* Back     alignment and structure
>2fg9_A 5-nitroimidazole antibiotic resistance protein; STR genomics, joint center for structural genomics, JCSG; HET: FAD; 2.20A {Bacteroides thetaiotaomicron vpi-5482} SCOP: b.45.1.1 Back     alignment and structure
>3ba3_A Protein LP_0091, pyridoxamine 5'-phosphate oxidase-like protein; NP_783940.1, structural genomics; HET: MSE; 1.55A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3a6r_A FMN-binding protein; electron transport, flavoprotein; HET: FMN; 1.20A {Desulfovibrio vulgaris} PDB: 1axj_A* 1flm_A* 3a6q_A* 1wll_A* 3a20_A* 1wli_A* 1wlk_A* 2e83_A* Back     alignment and structure
>2q9k_A Uncharacterized protein; ZP_00539648.1, structural genomics, joint center for structural genomics, JCSG; HET: UNL; 1.59A {Exiguobacterium sibiricum 255-15} Back     alignment and structure
>2hq9_A MLL6688 protein; NP_107146.1, hypothetical protein, structural genomics, joint center for structural genomics, JCSG; HET: FAD; 1.95A {Mesorhizobium loti} SCOP: b.45.1.1 Back     alignment and structure
>3in6_A FMN-binding protein; YP_752906.1, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: FMN; 2.12A {Syntrophomonas wolfei subsp} Back     alignment and structure
>2hti_A BH0577 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, FMN-binding protein; HET: FAD; 2.50A {Bacillus halodurans} SCOP: b.45.1.1 Back     alignment and structure
>2arz_A Hypothetical protein PA4388; hypothetical protein,structural genomics,MCSG, PSI, protein structure initiative; 2.00A {Pseudomonas aeruginosa PAO1} SCOP: b.45.1.1 Back     alignment and structure
>3dnh_A Uncharacterized protein ATU2129; APC6114, agrobacterium tumefaciens STR. C58, structural genomics, PSI-2; 1.94A {Agrobacterium tumefaciens str} Back     alignment and structure
>3fkh_A Putative pyridoxamine 5'-phosphate oxidase; NP_601736.1, structural genomics, joint center for structural genomics, JCSG; HET: P33; 2.51A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2vpa_A NIMA-related protein; cofactor, atomic resolution, antibiotic resistance, oxidoreductase; 1.2A {Deinococcus radiodurans} SCOP: b.45.1.1 PDB: 1w3p_A 1w3q_A 1w3r_A* 1w3o_A Back     alignment and structure
>2fur_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.80A {Thermoplasma acidophilum} SCOP: b.45.1.1 Back     alignment and structure
>3cp3_A Uncharacterized protein; alpha-beta fold, structural genomics, PSI-2, protein structure initiative; 2.00A {Corynebacterium diphtheriae NCTC13129} Back     alignment and structure
>3h96_A Uncharacterized protein; pnpox, F420, flavin, reductase, aflatoxin, flavoprotein; 2.00A {Mycobacterium smegmatis str} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 201 pyridoxamine 5'-phosphate oxidase [Candidatus Liberibac
d1dnla_199 b.45.1.1 (A:) Pyridoxine 5'-phoshate oxidase (PNP oxida 2e-38
d1ci0a_205 b.45.1.1 (A:) Pyridoxine 5'-phoshate oxidase (PNP oxida 5e-36
d1nrga_213 b.45.1.1 (A:) Pyridoxine 5'-phoshate oxidase (PNP oxida 1e-35
d1t9ma_204 b.45.1.1 (A:) Pyridoxine 5'-phoshate oxidase (PNP oxida 1e-32
d2a2ja1201 b.45.1.1 (A:24-224) Pyridoxine 5'-phoshate oxidase (PNP 2e-32
d2fhqa1135 b.45.1.1 (A:3-137) Putative general stress protein BT14 1e-17
d2i02a1143 b.45.1.1 (A:5-147) General stress protein 26 {Nostoc pu 5e-17
d2hq7a1141 b.45.1.1 (A:2-142) Hypotheical protein CAC3491 {Clostri 2e-12
d1rfea_160 b.45.1.1 (A:) Hypothetical protein Rv2991 {Mycobacteriu 1e-10
d1w9aa_142 b.45.1.1 (A:) Hypothetical protein Rv1155 {Mycobacteriu 2e-10
d2asfa1125 b.45.1.1 (A:11-135) Hypothetical protein Rv2074 {Mycoba 2e-05
d1vl7a_135 b.45.1.1 (A:) Hypothetical protein Alr5027 {Cyanobacter 8e-05
d2arza1238 b.45.1.1 (A:2-239) Hypothetical protein PA4388 {Pseudom 5e-04
>d1dnla_ b.45.1.1 (A:) Pyridoxine 5'-phoshate oxidase (PNP oxidase) {Escherichia coli [TaxId: 562]} Length = 199 Back     information, alignment and structure

class: All beta proteins
fold: Split barrel-like
superfamily: FMN-binding split barrel
family: PNP-oxidase like
domain: Pyridoxine 5'-phoshate oxidase (PNP oxidase)
species: Escherichia coli [TaxId: 562]
 Score =  152 bits (384), Expect = 2e-38
 Identities = 79/189 (41%), Positives = 110/189 (58%), Gaps = 2/189 (1%)

Query: 13  FTLLSQWMQEAQSSESHDPHAVVLATADRMGFPNARVVLIKHFDQEGFVFYTNSQSPKGK 72
            TL  +W+ +A  ++  DP A+V+AT D  G P  R+VL+KH+D++G VFYTN  S K  
Sbjct: 13  LTLFERWLSQACEAKLADPTAMVVATVDEHGQPYQRIVLLKHYDEKGMVFYTNLGSRKAH 72

Query: 73  EILENPKASLCFHWKSLARQLRVRGLVEKYCDLASDHYYASRPRESKIGAWASKQSQKMP 132
           +I  NP+ SL F W +L RQ+ V G  E+   L    Y+ SRPR+S+IGAW SKQS ++ 
Sbjct: 73  QIENNPRVSLLFPWHTLERQVMVIGKAERLSTLEVMKYFHSRPRDSQIGAWVSKQSSRIS 132

Query: 133 SLDDLQKSVQRYSSFYQEKEIPRPVWWHGFRICPLSIEFWSERPYRLHDRLLFSRETIAG 192
           +   L+         +Q+ E+P P +W GFR+    IEFW    +RLHDR L+ RE    
Sbjct: 133 ARGILESKFLELKQKFQQGEVPLPSFWGGFRVSLEQIEFWQGGEHRLHDRFLYQRE--ND 190

Query: 193 KWTQFLLYP 201
            W    L P
Sbjct: 191 AWKIDRLAP 199


>d1ci0a_ b.45.1.1 (A:) Pyridoxine 5'-phoshate oxidase (PNP oxidase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 205 Back     information, alignment and structure
>d1nrga_ b.45.1.1 (A:) Pyridoxine 5'-phoshate oxidase (PNP oxidase) {Human (Homo sapiens) [TaxId: 9606]} Length = 213 Back     information, alignment and structure
>d1t9ma_ b.45.1.1 (A:) Pyridoxine 5'-phoshate oxidase (PNP oxidase) {Pseudomonas aeruginosa [TaxId: 287]} Length = 204 Back     information, alignment and structure
>d2a2ja1 b.45.1.1 (A:24-224) Pyridoxine 5'-phoshate oxidase (PNP oxidase) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 201 Back     information, alignment and structure
>d2fhqa1 b.45.1.1 (A:3-137) Putative general stress protein BT1439 {Bacteroides thetaiotaomicron [TaxId: 818]} Length = 135 Back     information, alignment and structure
>d2i02a1 b.45.1.1 (A:5-147) General stress protein 26 {Nostoc punctiforme pcc 73102 [TaxId: 63737]} Length = 143 Back     information, alignment and structure
>d2hq7a1 b.45.1.1 (A:2-142) Hypotheical protein CAC3491 {Clostridium acetobutylicum [TaxId: 1488]} Length = 141 Back     information, alignment and structure
>d1rfea_ b.45.1.1 (A:) Hypothetical protein Rv2991 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 160 Back     information, alignment and structure
>d1w9aa_ b.45.1.1 (A:) Hypothetical protein Rv1155 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 142 Back     information, alignment and structure
>d2asfa1 b.45.1.1 (A:11-135) Hypothetical protein Rv2074 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 125 Back     information, alignment and structure
>d1vl7a_ b.45.1.1 (A:) Hypothetical protein Alr5027 {Cyanobacterium (Nostoc sp. PCC 7120) [TaxId: 103690]} Length = 135 Back     information, alignment and structure
>d2arza1 b.45.1.1 (A:2-239) Hypothetical protein PA4388 {Pseudomonas aeruginosa [TaxId: 287]} Length = 238 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target201 pyridoxamine 5'-phosphate oxidase [Candidatus Liberibac
d1nrga_213 Pyridoxine 5'-phoshate oxidase (PNP oxidase) {Human (Ho 100.0
d1dnla_199 Pyridoxine 5'-phoshate oxidase (PNP oxidase) {Escherich 100.0
d1ci0a_205 Pyridoxine 5'-phoshate oxidase (PNP oxidase) {Baker's y 100.0
d2a2ja1201 Pyridoxine 5'-phoshate oxidase (PNP oxidase) {Mycobacte 100.0
d1t9ma_204 Pyridoxine 5'-phoshate oxidase (PNP oxidase) {Pseudomon 100.0
d2fhqa1135 Putative general stress protein BT1439 {Bacteroides the 99.83
d2hq7a1141 Hypotheical protein CAC3491 {Clostridium acetobutylicum 99.83
d2i02a1143 General stress protein 26 {Nostoc punctiforme pcc 73102 99.82
d1rfea_160 Hypothetical protein Rv2991 {Mycobacterium tuberculosis 99.41
d2asfa1125 Hypothetical protein Rv2074 {Mycobacterium tuberculosis 99.34
d1xhna1170 Cellular repressor of E1A-stimulated genes CREG1 {Human 97.28
d1w9aa_142 Hypothetical protein Rv1155 {Mycobacterium tuberculosis 99.36
d2fg9a1157 5-nitroimidazole resistance protein BT3078 {Bacteroides 99.14
d1flma_122 FMN-binding protein {Desulfovibrio vulgaris, strain Miy 99.13
d1vl7a_135 Hypothetical protein Alr5027 {Cyanobacterium (Nostoc sp 98.99
d2htia1156 Hypothetical protein BH0577 {Bacillus halodurans [TaxId 98.74
d2hq9a1148 Hypothetical protein Mll6688 {Mesorhizobium loti [TaxId 98.63
d2arza1238 Hypothetical protein PA4388 {Pseudomonas aeruginosa [Ta 98.34
d2fura1193 Hypothetical protein Ta1372 {Thermoplasma acidophilum [ 97.91
d2vpaa1194 NimA-related protein DR0842 {Deinococcus radiodurans [T 97.44
>d1nrga_ b.45.1.1 (A:) Pyridoxine 5'-phoshate oxidase (PNP oxidase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: Split barrel-like
superfamily: FMN-binding split barrel
family: PNP-oxidase like
domain: Pyridoxine 5'-phoshate oxidase (PNP oxidase)
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=0  Score=458.29  Aligned_cols=197  Identities=38%  Similarity=0.684  Sum_probs=188.9

Q ss_pred             CCCCCCCHHHHHHHHHHHHHHC-CCCCCCEEEEEEECCCCCEEEEEEEHHEEECCEEEEEECCCCCCHHHHHCCCCEEEE
Q ss_conf             8898769799999999999985-888955799985859987732210130000330589951785201223118947999
Q gi|254781165|r    5 VPINNDVVFTLLSQWMQEAQSS-ESHDPHAVVLATADRMGFPNARVVLIKHFDQEGFVFYTNSQSPKGKEILENPKASLC   83 (201)
Q Consensus         5 ~~~~~~~P~~lf~~W~~~A~~~-~~~~p~a~~LaTvd~~g~p~~R~V~lr~~~~~g~~f~Tn~~S~K~~~l~~np~~al~   83 (201)
                      -.+...||+++|+.||++|.+. ++.+|+||||||||.+|.|++|||+||+|+++||+||||++|+|+++|+.||+||++
T Consensus         3 ~~~~~~dP~~~F~~W~~eA~~~~~~~ep~am~LATvd~~G~P~~R~Vllk~i~~~g~~FfTn~~S~K~~el~~Np~aal~   82 (213)
T d1nrga_           3 THLTSLDPVKQFAAWFEEAVQCPDIGEANAMCLATCTRDGKPSARMLLLKGFGKDGFRFFTNFESRKGKELDSNPFASLV   82 (213)
T ss_dssp             SSCSCSSHHHHHHHHHHHHHHCTTCSCTTEEEEEEECTTSCEEEEEEECCCEETTEEEEEEETTSHHHHHHHHSCEEEEE
T ss_pred             CCCCCCCHHHHHHHHHHHHHHCCCCCCCCEEEEEEECCCCCEEEEEEEEEHHHCCCEEEEECCCCHHHHHHHCCCCEEEE
T ss_conf             55677898999999999999759999851789999878897777777400210352489965675322313128815999


Q ss_pred             EECCCCEEEEEEEEEEECCCHHHHHHHHHCCCCCCCEEEEECCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCEEEE
Q ss_conf             73666408999998752176378889752388333502662177656787777888888888750578877979732799
Q gi|254781165|r   84 FHWKSLARQLRVRGLVEKYCDLASDHYYASRPRESKIGAWASKQSQKMPSLDDLQKSVQRYSSFYQEKEIPRPVWWHGFR  163 (201)
Q Consensus        84 f~w~~~~rQiRi~G~~~~l~~~~~d~yf~~Rp~~sqi~a~~s~QS~~i~s~~~l~~~~~~~~~~~~~~~ip~P~~w~g~~  163 (201)
                      |||++++|||||+|+|++++++++++||++||++|||+||+|+||++|++++.|+++++++++++.+++||||++||||+
T Consensus        83 f~W~~l~RQvRi~G~~~~l~~~~~~~yf~~Rp~~sqi~a~~s~QS~~i~~~~~l~~~~~~~~~~~~~~~vp~P~~w~Gy~  162 (213)
T d1nrga_          83 FYWEPLNRQVRVEGPVKKLPEEEAECYFHSRPKSSQIGAVVSHQSSVIPDREYLRKKNEELEQLYQDQEVPKPKSWGGYV  162 (213)
T ss_dssp             EEEGGGTEEEEEEEEEEECCHHHHHHHHHHSCHHHHHHHHHCCTTSCCSCHHHHHHHHHHHHHHTTTSCCCCCTTEEEEE
T ss_pred             EECHHHHEEEEEEEEEEECCCHHHHHHHHCCCCCCCCCEEECCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCEEEE
T ss_conf             85004413435667643055276667886489655432430466677887899999999889870589988888515999


Q ss_pred             EEEEEEEECCCCCCCCCEEEEEEEE-------------CCCCCEEEEECCC
Q ss_conf             9700799613789864026999881-------------5899707996289
Q gi|254781165|r  164 ICPLSIEFWSERPYRLHDRLLFSRE-------------TIAGKWTQFLLYP  201 (201)
Q Consensus       164 i~P~~iEFw~~~~~rlHdR~~y~~~-------------~~~~~W~~~~L~P  201 (201)
                      |.|++|||||++++|||||++|+|.             ..+++|.++||+|
T Consensus       163 l~P~~iEFwq~~~~RlHdR~~y~R~~~~~~~~~~~~~~~~~~~W~~~rL~P  213 (213)
T d1nrga_         163 LYPQVMEFWQGQTNRLHDRIVFRRGLPTGDSPLGPMTHRGEEDWLYERLAP  213 (213)
T ss_dssp             ECCSEEEEEECCTTSCCEEEEEEECSSTTSCCCCTTCEECSTTEEEEECCC
T ss_pred             EECCEEEECCCCCCCCEEEEEEEECCCCCCCCCCCCCCCCCCCEEEEEECC
T ss_conf             860599974799987576899994487665544322445689826998169



>d1dnla_ b.45.1.1 (A:) Pyridoxine 5'-phoshate oxidase (PNP oxidase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ci0a_ b.45.1.1 (A:) Pyridoxine 5'-phoshate oxidase (PNP oxidase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2a2ja1 b.45.1.1 (A:24-224) Pyridoxine 5'-phoshate oxidase (PNP oxidase) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1t9ma_ b.45.1.1 (A:) Pyridoxine 5'-phoshate oxidase (PNP oxidase) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2fhqa1 b.45.1.1 (A:3-137) Putative general stress protein BT1439 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2hq7a1 b.45.1.1 (A:2-142) Hypotheical protein CAC3491 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d2i02a1 b.45.1.1 (A:5-147) General stress protein 26 {Nostoc punctiforme pcc 73102 [TaxId: 63737]} Back     information, alignment and structure
>d1rfea_ b.45.1.1 (A:) Hypothetical protein Rv2991 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2asfa1 b.45.1.1 (A:11-135) Hypothetical protein Rv2074 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xhna1 b.45.1.1 (A:13-182) Cellular repressor of E1A-stimulated genes CREG1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w9aa_ b.45.1.1 (A:) Hypothetical protein Rv1155 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2fg9a1 b.45.1.1 (A:1-157) 5-nitroimidazole resistance protein BT3078 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1flma_ b.45.1.1 (A:) FMN-binding protein {Desulfovibrio vulgaris, strain Miyazaki F [TaxId: 881]} Back     information, alignment and structure
>d1vl7a_ b.45.1.1 (A:) Hypothetical protein Alr5027 {Cyanobacterium (Nostoc sp. PCC 7120) [TaxId: 103690]} Back     information, alignment and structure
>d2htia1 b.45.1.1 (A:10-165) Hypothetical protein BH0577 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d2hq9a1 b.45.1.1 (A:1-148) Hypothetical protein Mll6688 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d2arza1 b.45.1.1 (A:2-239) Hypothetical protein PA4388 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2fura1 b.45.1.1 (A:16-208) Hypothetical protein Ta1372 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2vpaa1 b.45.1.1 (A:2-195) NimA-related protein DR0842 {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 201 pyridoxamine 5'-phosphate oxidase [Candidatus Libe
2a2j_A_246 (A:) Pyridoxamine 5'-phosphate oxidase; beta barre 4e-47
1nrg_A_261 (A:) Pyridoxine 5'-phosphate oxidase; PLP, FMN, ox 2e-44
1dnl_A_199 (A:) Pyridoxine 5'-phosphate oxidase; beta barrel, 2e-43
1ty9_A_222 (A:) Phenazine biosynthesis protein PHZG; chorisma 1e-42
1ci0_A_53-228176 (A:53-228) Protein (PNP oxidase); B6 metabolism, s 2e-41
2i51_A_195 (A:) Uncharacterized conserved protein of COG5135; 4e-41
2ou5_A_175 (A:) Pyridoxamine 5'-phosphate oxidase-related, FM 2e-30
2qea_A_160 (A:) Putative general stress protein 26; YP_508897 6e-26
3dmb_A_147 (A:) Putative general stress protein 26 with A PNP 8e-26
2aq6_A_147 (A:) Pyridoxine 5'-phosphate oxidase; pyridoxal 5' 1e-25
2i02_A_148 (A:) General stress protein of COG3871; ZP_0010872 9e-24
1rfe_A_162 (A:) Hypothetical protein RV2991; structural genom 1e-22
2ig6_A_150 (A:) NIMC/NIMA family protein; NP_349178.1, struct 1e-22
2re7_A_134 (A:) Uncharacterized protein; YP_263493.1, general 1e-22
2hq7_A_146 (A:) Protein, related to general stress protein 26 4e-22
2fhq_A_141 (A:) Putative general stress protein; alpha-beta s 2e-21
1vl7_A_157 (A:) Hypothetical protein ALR5027; 17134165, struc 3e-21
2iab_A_155 (A:) Hypothetical protein; NP_828636.1, structural 9e-21
3dnh_A_1-168168 (A:1-168) Uncharacterized protein ATU2129; APC6114 2e-20
3gas_A_81-259179 (A:81-259) Heme oxygenase; FMN-binding split barre 2e-20
3ba3_A_145 (A:) Protein LP_0091, pyridoxamine 5'-phosphate ox 3e-19
2arz_A_1-155155 (A:1-155) Hypothetical protein PA4388; hypothetica 4e-19
3ec6_A_139 (A:) General stress protein 26; alpha-beta structu 6e-19
3db0_A_128 (A:) LIN2891 protein; putative pyridoxamine 5'-pho 8e-18
2hhz_A_150 (A:) Pyridoxamine 5'-phosphate oxidase-related; ZP 5e-28
2fg9_A_178 (A:) 5-nitroimidazole antibiotic resistance protei 2e-11
2htd_A_140 (A:) Predicted flavin-nucleotide-binding protein f 2e-24
2q9k_A_151 (A:) Uncharacterized protein; ZP_00539648.1, struc 2e-20
3f7e_A_131 (A:) Pyridoxamine 5'-phosphate oxidase-related, FM 6e-19
2asf_A_137 (A:) Hypothetical protein RV2074; H37RV, structura 8e-19
2e83_A_122 (A:) FMN-binding protein; beta sheet, electron tra 1e-16
3cp3_A_148 (A:) Uncharacterized protein; alpha-beta fold, str 9e-10
>2a2j_A (A:) Pyridoxamine 5'-phosphate oxidase; beta barrel, structural genomics, mycobacterium tuberculosis structural proteomics project, XMTB; HET: CME; 2.50A {Mycobacterium tuberculosis}Length = 246 Back     alignment and structure
 Score =  182 bits (462), Expect = 4e-47
 Identities = 67/190 (35%), Positives = 101/190 (53%), Gaps = 8/190 (4%)

Query: 13  FTLLSQWMQEAQSSESHDPHAVVLATADRMGFPNARVVLIKHFDQEGFVFYTNSQSPKGK 72
            TLL +W+ +AQ +   +P+A+VLAT    G P  R VL K  D+ G  F+T+  S KG+
Sbjct: 62  LTLLRRWLNDAQRAGVSEPNAMVLATVAD-GKPVTRSVLCKILDESGVAFFTSYTSAKGE 120

Query: 73  EILENPKASLCFHWKSLARQLRVRGLVEKYCDLASDHYYASRPRESKIGAWASKQSQKMP 132
           ++   P AS  F W  L RQ  V+G V K        Y++ RPR +++GAWAS+QS+ + 
Sbjct: 121 QLAVTPYASATFPWYQLGRQAHVQGPVSKVSTEEIFTYWSMRPRGAQLGAWASQQSRPVG 180

Query: 133 SLDDLQKSVQRYSSFYQEK-EIPRPVWWHGFRICPLSIEFWSERPYRLHDRLLFSRETIA 191
           S   L   +   +  + ++ +IP P  W G+RI P  +EFW  R  R+H+R+  +     
Sbjct: 181 SRAQLDNQLAEVTRRFADQDQIPVPPGWGGYRIAPEIVEFWQGRENRMHNRIRVAN---- 236

Query: 192 GKWTQFLLYP 201
                  L P
Sbjct: 237 --GRLERLQP 244


>1nrg_A (A:) Pyridoxine 5'-phosphate oxidase; PLP, FMN, oxidoreductase; HET: FMN PLP; 1.95A {Homo sapiens}Length = 261 Back     alignment and structure
>1dnl_A (A:) Pyridoxine 5'-phosphate oxidase; beta barrel, protein-FMN complex, oxidoreductase; HET: MSE FMN; 1.80A {Escherichia coli}Length = 199 Back     alignment and structure
>1ty9_A (A:) Phenazine biosynthesis protein PHZG; chorismate, oxidoreductase; HET: FMN; 1.80A {Pseudomonas fluorescens}Length = 222 Back     alignment and structure
>1ci0_A (A:53-228) Protein (PNP oxidase); B6 metabolism, structural genomics, PSI, protein structure initiative; HET: FMN; 2.70A {Saccharomyces cerevisiae}Length = 176 Back     alignment and structure
>2i51_A (A:) Uncharacterized conserved protein of COG5135; ZP_00109616.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE FMN; 1.40A {Nostoc punctiforme pcc 73102}Length = 195 Back     alignment and structure
>2ou5_A (A:) Pyridoxamine 5'-phosphate oxidase-related, FMN- binding; YP_508196.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE FMN; 1.60A {Jannaschia SP}Length = 175 Back     alignment and structure
>2qea_A (A:) Putative general stress protein 26; YP_508897.1, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.46A {Jannaschia SP}Length = 160 Back     alignment and structure
>3dmb_A (A:) Putative general stress protein 26 with A PNP- oxidase like fold; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 2.30A {Xanthomonas campestris PV}Length = 147 Back     alignment and structure
>2aq6_A (A:) Pyridoxine 5'-phosphate oxidase; pyridoxal 5'-phosphate, structural genomics, PSI, protein structure initiative; HET: PLP; 1.70A {Mycobacterium tuberculosis}Length = 147 Back     alignment and structure
>2i02_A (A:) General stress protein of COG3871; ZP_00108720.1, , structural genomics, PSI-2, protein structure initiative; HET: MSE FMN P33; 1.80A {Nostoc punctiforme pcc 73102}Length = 148 Back     alignment and structure
>1rfe_A (A:) Hypothetical protein RV2991; structural genomics, TB, FMN binding, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis H37RV}Length = 162 Back     alignment and structure
>2ig6_A (A:) NIMC/NIMA family protein; NP_349178.1, structural genomics, PSI-2, protein structure initiative, joint center for structural genomics; HET: FMN; 1.80A {Clostridium acetobutylicum}Length = 150 Back     alignment and structure
>2re7_A (A:) Uncharacterized protein; YP_263493.1, general stress protein COG3871, pyridoxamine 5'-phosphate oxidase, structural genomics; 2.50A {Psychrobacter arcticus 273-4}Length = 134 Back     alignment and structure
>2hq7_A (A:) Protein, related to general stress protein 26(GS26) of B.subtilis; NP_350077.1, joint center for structural genomics, JCSG; 2.00A {Clostridium acetobutylicum}Length = 146 Back     alignment and structure
>2fhq_A (A:) Putative general stress protein; alpha-beta structure, structural genomics, PSI, protein structure initiative; HET: MSE; 1.87A {Bacteroides thetaiotaomicron vpi-5482}Length = 141 Back     alignment and structure
>1vl7_A (A:) Hypothetical protein ALR5027; 17134165, structural genomics, JCSG, protein structure initiative, PSI, joint center for structural genomics; 1.50A {Nostoc SP}Length = 157 Back     alignment and structure
>2iab_A (A:) Hypothetical protein; NP_828636.1, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI; 2.00A {Streptomyces avermitilis}Length = 155 Back     alignment and structure
>3dnh_A (A:1-168) Uncharacterized protein ATU2129; APC6114, agrobacterium tumefaciens STR. C58, structural genomics, PSI-2; 1.94A {Agrobacterium tumefaciens str}Length = 168 Back     alignment and structure
>3gas_A (A:81-259) Heme oxygenase; FMN-binding split barrel, oxidoreductase; HET: HEM; 1.80A {Helicobacter pylori}Length = 179 Back     alignment and structure
>3ba3_A (A:) Protein LP_0091, pyridoxamine 5'-phosphate oxidase-like protein; NP_783940.1, structural genomics; HET: MSE; 1.55A {Lactobacillus plantarum WCFS1}Length = 145 Back     alignment and structure
>2arz_A (A:1-155) Hypothetical protein PA4388; hypothetical protein,structural genomics,MCSG, PSI, protein structure initiative; 2.00A {Pseudomonas aeruginosa PAO1}Length = 155 Back     alignment and structure
>3ec6_A (A:) General stress protein 26; alpha-beta structure, structural genomics of niaid; HET: FAD; 1.60A {Bacillus anthracis}Length = 139 Back     alignment and structure
>3db0_A (A:) LIN2891 protein; putative pyridoxamine 5'-phosphate oxidase, structural genomics, joint center for structural genomics, JCSG; 2.00A {Listeria innocua}Length = 128 Back     alignment and structure
>2hhz_A (A:) Pyridoxamine 5'-phosphate oxidase-related; ZP_00875725.1, structural genomics, joint center for structural genomics, JCSG; 2.00A {Streptococcus suis 89}Length = 150 Back     alignment and structure
>2fg9_A (A:) 5-nitroimidazole antibiotic resistance protein; NP_811990.1, structural genomics, joint center for structural genomics; HET: FAD; 2.20A {Bacteroides thetaiotaomicron vpi-5482}Length = 178 Back     alignment and structure
>2htd_A (A:) Predicted flavin-nucleotide-binding protein from COG3576 family structurally related...; ZP_00387536.1, structural genomics; HET: MSE; 1.60A {Lactobacillus delbrueckii subsp}Length = 140 Back     alignment and structure
>2q9k_A (A:) Uncharacterized protein; ZP_00539648.1, structural genomics, joint center for structural genomics, JCSG; HET: UNL; 1.59A {Exiguobacterium sibiricum 255-15}Length = 151 Back     alignment and structure
>3f7e_A (A:) Pyridoxamine 5'-phosphate oxidase-related, FMN- binding; F420 dependent reductase, unknown function; HET: MSE; 1.23A {Mycobacterium smegmatis}Length = 131 Back     alignment and structure
>2asf_A (A:) Hypothetical protein RV2074; H37RV, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: CIT; 1.60A {Mycobacterium tuberculosis}Length = 137 Back     alignment and structure
>2e83_A (A:) FMN-binding protein; beta sheet, electron transport; HET: FMN; 1.52A {Desulfovibrio vulgaris str} PDB: 1axj_A* 1flm_A* 1wli_A* 1wll_A* 3a20_A* 1wlk_A*Length = 122 Back     alignment and structure
>3cp3_A (A:) Uncharacterized protein; alpha-beta fold, structural genomics, PSI-2, protein structure initiative; 2.00A {Corynebacterium diphtheriae NCTC13129}Length = 148 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target201 pyridoxamine 5'-phosphate oxidase [Candidatus Liberibac
2a2j_A_246 Pyridoxamine 5'-phosphate oxidase; beta barrel, st 100.0
1nrg_A_261 Pyridoxine 5'-phosphate oxidase; PLP, FMN, oxidore 100.0
1ci0_A_53-228176 Protein (PNP oxidase); B6 metabolism, structural g 100.0
1dnl_A_199 Pyridoxine 5'-phosphate oxidase; beta barrel, prot 100.0
1ty9_A_222 Phenazine biosynthesis protein PHZG; chorismate, o 100.0
2i51_A_195 Uncharacterized conserved protein of COG5135; ZP_0 100.0
2ou5_A_175 Pyridoxamine 5'-phosphate oxidase-related, FMN- bi 99.94
2i02_A_148 General stress protein of COG3871; ZP_00108720.1, 99.86
2hq7_A_146 Protein, related to general stress protein 26(GS26 99.84
2iab_A_155 Hypothetical protein; NP_828636.1, structural geno 99.83
3dmb_A_147 Putative general stress protein 26 with A PNP- oxi 99.78
3dnh_A_1-168168 Uncharacterized protein ATU2129; APC6114, agrobact 99.76
2aq6_A_147 Pyridoxine 5'-phosphate oxidase; pyridoxal 5'-phos 99.75
2qea_A_160 Putative general stress protein 26; YP_508897.1, s 99.75
3ec6_A_139 General stress protein 26; alpha-beta structure, s 99.73
2fhq_A_141 Putative general stress protein; alpha-beta struct 99.73
3gas_A_81-259179 Heme oxygenase; FMN-binding split barrel, oxidored 99.72
2ig6_A_150 NIMC/NIMA family protein; NP_349178.1, structural 99.69
1rfe_A_162 Hypothetical protein RV2991; structural genomics, 99.68
2arz_A_1-155155 Hypothetical protein PA4388; hypothetical protein, 99.64
2asf_A_137 Hypothetical protein RV2074; H37RV, structural gen 99.54
3ba3_A_145 Protein LP_0091, pyridoxamine 5'-phosphate oxidase 99.35
2hhz_A_150 Pyridoxamine 5'-phosphate oxidase-related; ZP_0087 99.83
2re7_A_134 Uncharacterized protein; YP_263493.1, general stre 99.8
1vl7_A_157 Hypothetical protein ALR5027; 17134165, structural 99.71
3db0_A_128 LIN2891 protein; putative pyridoxamine 5'-phosphat 99.58
3f7e_A_131 Pyridoxamine 5'-phosphate oxidase-related, FMN- bi 99.57
2fg9_A_178 5-nitroimidazole antibiotic resistance protein; NP 99.43
2hq9_A_149 MLL6688 protein; NP_107146.1, hypothetical protein 99.13
2fur_A_1-185185 Hypothetical protein; 10640715, structural genomic 99.09
2hti_A_185 BH0577 protein; 10173191, structural genomics, joi 98.93
3fkh_A_138 Putative pyridoxamine 5'-phosphate oxidase; NP_601 98.92
3cp3_A_148 Uncharacterized protein; alpha-beta fold, structur 98.9
1xhn_A_184 CREG, cellular repressor of E1A-stimulated genes; 98.72
2htd_A_140 Predicted flavin-nucleotide-binding protein from C 99.72
2q9k_A_151 Uncharacterized protein; ZP_00539648.1, structural 99.56
2e83_A_122 FMN-binding protein; beta sheet, electron transpor 99.36
2vpa_A_28-216189 NIMA-related protein; cofactor, atomic resolution, 98.72
2ol5_A_202 PAI 2 protein; structural genomics, PSI-2, protein 98.59
>2a2j_A (A:) Pyridoxamine 5'-phosphate oxidase; beta barrel, structural genomics, mycobacterium tuberculosis structural proteomics project, XMTB; HET: CME; 2.50A {Mycobacterium tuberculosis} Back     alignment and structure
Probab=100.00  E-value=0  Score=381.47  Aligned_cols=186  Identities=37%  Similarity=0.640  Sum_probs=180.7

Q ss_pred             CCCHHHHHHHHHHHHHHCCCCCCCEEEEEEECCCCCEEEEEEEHHEEECCEEEEEECCCCCCHHHHHCCCCEEEEEECCC
Q ss_conf             76979999999999998588895579998585998773221013000033058995178520122311894799973666
Q gi|254781165|r    9 NDVVFTLLSQWMQEAQSSESHDPHAVVLATADRMGFPNARVVLIKHFDQEGFVFYTNSQSPKGKEILENPKASLCFHWKS   88 (201)
Q Consensus         9 ~~~P~~lf~~W~~~A~~~~~~~p~a~~LaTvd~~g~p~~R~V~lr~~~~~g~~f~Tn~~S~K~~~l~~np~~al~f~w~~   88 (201)
                      .++|+.+|+.||++|++.+..+|++|+|||+|+ |.|++|+|+||+++++||+||||++|+|++||++||+|+|||||+.
T Consensus        58 ~~~P~~~f~~wl~eA~~~~~~~~~a~~LAT~~d-G~P~~R~V~lr~~d~~g~~F~T~~~S~K~~eL~~NP~val~f~~~~  136 (246)
T 2a2j_A           58 DDGWLTLLRRWLNDAQRAGVSEPNAMVLATVAD-GKPVTRSVLCKILDESGVAFFTSYTSAKGEQLAVTPYASATFPWYQ  136 (246)
T ss_dssp             TTHHHHHHHHHHHHHHHTTCSSTTEEEEEEEET-TEEEEEEEEEEEEETTEEEEEEETTSHHHHHHHHSCEEEEEEEEGG
T ss_pred             CCCHHHHHHHHHHHHHHCCCCCCCEEEEEECCC-CCEEEEEEEEEEEECCCEEEEEECCCHHHHHHHCCCCEEEEEECHH
T ss_conf             798899999999999876899864668886138-9462689998898069489996468714443312772179884225


Q ss_pred             CEEEEEEEEEEECCCHHHHHHHHHCCCCCCCEEEEECCCCCCCCCHHHHHHHHHHHHHHCCC-CCCCCCCCCEEEEEEEE
Q ss_conf             40899999875217637888975238833350266217765678777788888888875057-88779797327999700
Q gi|254781165|r   89 LARQLRVRGLVEKYCDLASDHYYASRPRESKIGAWASKQSQKMPSLDDLQKSVQRYSSFYQE-KEIPRPVWWHGFRICPL  167 (201)
Q Consensus        89 ~~rQiRi~G~~~~l~~~~~d~yf~~Rp~~sqi~a~~s~QS~~i~s~~~l~~~~~~~~~~~~~-~~ip~P~~w~g~~i~P~  167 (201)
                      +.+||||+|+|++++++++++||.+||+.+||++|+|+||++|.+++.+++.+.++...+.+ +++|+|++||||+|+|+
T Consensus       137 ~~rQVRI~G~a~~v~d~~~~~~f~~rp~~sri~a~~s~qs~~i~~r~~le~~~~~l~~~~~~~~~ip~P~~w~g~~i~P~  216 (246)
T 2a2j_A          137 LGRQAHVQGPVSKVSTEEIFTYWSMRPRGAQLGAWASQQSRPVGSRAQLDNQLAEVTRRFADQDQIPVPPGWGGYRIAPE  216 (246)
T ss_dssp             GTEEEEEEEEEEECCHHHHHHHHHHSCHHHHHHHHHSCTTCCCCCSHHHHHHHHHHHHHHTTCSSCCCCTTEEEEEECCS
T ss_pred             HHEEEEEEEEEEECCCHHHHHHHHCCCCCCCCCCEECCCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCEEEEEEEC
T ss_conf             60776888888860546778876305533323310035567772156677899999998366998969998644998706


Q ss_pred             EEEECCCCCCCCCEEEEEEEECCCCCEEEEECCC
Q ss_conf             7996137898640269998815899707996289
Q gi|254781165|r  168 SIEFWSERPYRLHDRLLFSRETIAGKWTQFLLYP  201 (201)
Q Consensus       168 ~iEFw~~~~~rlHdR~~y~~~~~~~~W~~~~L~P  201 (201)
                      +|||||++.+|+|||++|++      |..++|+|
T Consensus       217 ~vEfwq~~~~rlhdR~~y~~------W~~~rL~P  244 (246)
T 2a2j_A          217 IVEFWQGRENRMHNRIRVAN------GRLERLQP  244 (246)
T ss_dssp             EEEEEECCTTSCCEEEEEET------TEEEECCT
T ss_pred             EEEECCCCCCCCEEEEEECC------CCEEEECC
T ss_conf             99977899987671799548------82899289



>1nrg_A (A:) Pyridoxine 5'-phosphate oxidase; PLP, FMN, oxidoreductase; HET: FMN PLP; 1.95A {Homo sapiens} Back     alignment and structure
>1ci0_A (A:53-228) Protein (PNP oxidase); B6 metabolism, structural genomics, PSI, protein structure initiative; HET: FMN; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1dnl_A (A:) Pyridoxine 5'-phosphate oxidase; beta barrel, protein-FMN complex, oxidoreductase; HET: MSE FMN; 1.80A {Escherichia coli} Back     alignment and structure