254781167

254781167

tRNA-dihydrouridine synthase A

GeneID in NCBI database:8210192Locus tag:CLIBASIA_05370
Protein GI in NCBI database:254781167Protein Accession:YP_003065580.1
Gene range:-(1163027, 1163995)Protein Length:322aa
Gene description:tRNA-dihydrouridine synthase A
COG prediction:[J] tRNA-dihydrouridine synthase
KEGG prediction:tRNA-dihydrouridine synthase A; K05539 tRNA-dihydrouridine synthase A [EC:1.-.-.-]
SEED prediction:tRNA dihydrouridine synthase A (EC 1.-.-.-)
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320--
MVDWTDRHYRFFARLLTNNALLYTEMIVADAILRGDKKNILGFSTQEKPLALQIGGADISKLVEAAKIVEDFGYNEINLNVGCPSARVHEGSFGACLMLNPDIVGDCIAAMCKALSIPVTVKCRIGVDDQIPAVALRNLVKSIKKSGVNGIWIHARKAILKGLSPKDNRKIPNLDYDIVYEIKKENPDLFIGLNGGLEDMSQALKILPSVDGVMIGRAAYKNSAMLTTVDEYFSNPLTGSSPIKTRVDKDFWRKISASMTDYAARHLHSGGKLQQITRHMIGLFHGFPNSRRCRHILTVEAGASTATHHIIETAFNLMIESL
cccccHHHHHHHHHHHccccEEEEccEEEHHHHcccHHHHcccccccccEEEEEEcccHHHHHHHHHHHHHccccEEEEEccccccccccccccHHHHccHHHHHHHHHHHHHHccccEEEEEEEcccccccHHHHHHHHHHHHHccccEEEEEcccccccccccccccccccccHHHHHHHHHHcccccEEEEcccccHHHHHHHHHcccEEEEcHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcc
cccccHHHHHHHHHHHcHHHcHHHHHcccccEEccccHHHccccHHHccHHHHcccccHHHHHHHHHHHHHccccEEEcccccccHHHccccccHHHcccHHHHHHHHHHHHHHccccEEEEEEEcccccccHHHHHHHHHHHHHccccHHEHHHHHHHHcccccccccccccccHHHHHHHHHHccccEEEEEcccccHHHHHHHHHccccEEEcHHHHcccHHHHHHHHHHcccccccccccHHHHHccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHcccccHHHHHHHHHHHcccccccHHHHHHHHHHcHHcc
MVDWTDRHYRFFARLLTNNALLYTEMIVADAILrgdkknilgfstqekplalqiGGADISKLVEAAKIVEdfgyneinlnvgcpsarvhegsfgaclmlnpdiVGDCIAAMCKALSipvtvkcrigvddqiPAVALRNLVKSIKKSGVNGIWIHARKAILkglspkdnrkipnldyDIVYEIkkenpdlfiglnggleDMSQALKILPSVDGVMIGRAAYKNSAMLTTVDeyfsnpltgsspiktrvDKDFWRKISASMTDYAARhlhsggklQQITRHMIGlfhgfpnsrrcrhILTVEAGASTATHHIIETAFNLMIESL
mvdwtdrhYRFFARLLTNNALLYTEMIVADAILRGDKKNILGFSTQEKPLALQIGGADISKLVEAAKIVEDFGYNEINLNVGCPSARVHEGSFGACLMLNPDIVGDCIAAMCKALSIPVTVKCRIGVDDQIPAVALRNLVKSikksgvngiwIHARKailkglspkdnrkipNLDYDIVYEIKKENPDLFIGLNGGLEDMSQALKILPSVDGVMIGRAAYKNSAMLTTVDEyfsnpltgsspiktrvdKDFWRKISASMTDYAARHLHSGGKLQQITRHMIGLFHGFPNSRRCRHILTVEAGASTATHHIIETAFNLMIESL
MVDWTDRHYRFFARLLTNNALLYTEMIVADAILRGDKKNILGFSTQEKPLALQIGGADISKLVEAAKIVEDFGYNEINLNVGCPSARVHEGSFGACLMLNPDIVGDCIAAMCKALSIPVTVKCRIGVDDQIPAVALRNLVKSIKKSGVNGIWIHARKAILKGLSPKDNRKIPNLDYDIVYEIKKENPDLFIGLNGGLEDMSQALKILPSVDGVMIGRAAYKNSAMLTTVDEYFSNPLTGSSPIKTRVDKDFWRKISASMTDYAARHLHSGGKLQQITRHMIGLFHGFPNSRRCRHILTVEAGASTATHHIIETAFNLMIESL
MVDWTDRHYRFFARLLTNNALLYTEMIVADAILRGDKKNILGFSTQEKPLALQIGGADISKLVEAAKIVEDFGYNEINLNVGCPSARVHEGSFGACLMLNPDIVGDCIAAMCKALSIPVTVKCRIGVDDQIPAVALRNLVKSIKKSGVNGIWIHARKAILKGLSPKDNRKIPNLDYDIVYEIKKENPDLFIGLNGGLEDMSQALKILPSVDGVMIGRAAYKNSAMLTTVDEYFSNPLTGSSPIKTRVDKDFWRKISASMTDYAARHLHSGGKLQQITRHMIGLFHGFPNSRRCRHILTVEAGASTATHHIIETAFNLMIES*
MVDWTDRHYRFFARLLTNNALLYTEMIVADAILRGDKKNILGFSTQEKPLALQIGGADISKLVEAAKIVEDFGYNEINLNVGCPSARVHEGSFGACLMLNPDIVGDCIAAMCKALSIPVTVKCRIGVDDQIPAVALRNLVKSIKKSGVNGIWIHARKAILKGLSPKDNRKIPNLDYDIVYEIKKENPDLFIGLNGGLEDMSQALKILPSVDGVMIGRAAYKNSAMLTTVDEYFSNPLTGSSPIKTRVDKDFWRKISASMTDYAARHLHSGGKLQQITRHMIGLFHGFPNSRRCRHILTVEAGASTATHHIIETAFNLMIESL
*VDWTDRHYRFFARLLTNNALLYTEMIVADAILRGDKKNILGFSTQEKPLALQIGGADISKLVEAAKIVEDFGYNEINLNVGCPSARVHEGSFGACLMLNPDIVGDCIAAMCKALSIPVTVKCRIGVDDQIPAVALRNLVKSIKKSGVNGIWIHARKAILKGLSPKDNRKIPNLDYDIVYEIKKENPDLFIGLNGGLEDMSQALKILPSVDGVMIGRAAYKNSAMLTTVDEYFSNPLTGSSPIKTRVDKDFWRKISASMTDYAARHLHSGGKLQQITRHMIGLFHGFPNSRRCRHILTVEAGASTATHHIIETAFNLMIES*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVDWTDRHYRFFARLLTNNALLYTEMIVADAILRGDKKNILGFSTQEKPLALQIGGADISKLVEAAKIVEDFGYNEINLNVGCPSARVHEGSFGACLMLNPDIVGDCIAAMCKALSIPVTVKCRIGVDDQIPAVALRNLVKSIKKSGVNGIWIHARKAILKGLSPKDNRKIPNLDYDIVYEIKKENPDLFIGLNGGLEDMSQALKILPSVDGVMIGRAAYKNSAMLTTVDEYFSNPLTGSSPIKTRVDKDFWRKISASMTDYAARHLHSGGKLQQITRHMIGLFHGFPNSRRCRHILTVEAGASTATHHIIETAFNLMIESL
MVDWTDRHYRFFARLLTNNALLYTEMIVADAILRGDKKNILGFSTQEKPLALQIGGADISKLVEAAKIVEDFGYNEINLNVGCPSARVHEGSFGACLMLNPDIVGDCIAAMCKALSIPVTVKCRIGVDDQIPAVALRNLVKSIKKSGVNGIWIHARKAILKGLSPKDNRKIPNLDYDIVYEIKKENPDLFIGLNGGLEDMSQALKILPSVDGVMIGRAAYKNSAMLTTVDEYFSNPLTGSSPIKTRVDKDFWRKISASMTDYAARHLHSGGKLQQITRHMIGLFHGFPNSRRCRHILTVEAGASTATHHIIETAFNLMIESL
MVDWTDRHYRFFARLLTNNALLYTEMIVADAILRGDKKNILGFSTQEKPLALQIGGADISKLVEAAKIVEDFGYNEINLNVGCPSARVHEGSFGACLMLNPDIVGDCIAAMCKALSIPVTVKCRIGVDDQIPAVALRNLVKSIKKSGVNGIWIHARKAILKGLSPKDNRKIPNLDYDIVYEIKKENPDLFIGLNGGLEDMSQALKILPSVDGVMIGRAAYKNSAMLTTVDEYFSNPLTGSSPIKTRVDKDFWRKISASMTDYAARHLHSGGKLQQITRHMIGLFHGFPNSRRCRHILTVEAGASTATHHIIETAFNLMIESL

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target322 tRNA-dihydrouridine synthase A [Candidatus Liberibacter
315122552352 tRNA-dihydrouridine synthase A [Candidatus Liberibacter 1 1e-156
307321239385 dihydrouridine synthase DuS [Sinorhizobium meliloti AK8 1 1e-110
307315973361 dihydrouridine synthase DuS [Sinorhizobium meliloti BL2 1 1e-110
15965658359 tRNA-dihydrouridine synthase A [Sinorhizobium meliloti 1 1e-110
150396830385 tRNA-dihydrouridine synthase A [Sinorhizobium medicae W 1 1e-106
307310192353 dihydrouridine synthase DuS [Sinorhizobium meliloti BL2 1 1e-106
227822301385 tRNA-dihydrouridine synthase A [Sinorhizobium fredii NG 1 1e-102
209549798333 tRNA-dihydrouridine synthase A [Rhizobium leguminosarum 1 5e-99
116252712333 tRNA-dihydrouridine synthase A [Rhizobium leguminosarum 1 9e-97
241205218333 tRNA-dihydrouridine synthase A [Rhizobium leguminosarum 1 2e-95
>gi|315122552|ref|YP_004063041.1| tRNA-dihydrouridine synthase A [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 352 Back     alignment and organism information
 Score =  556 bits (1434), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 258/322 (80%), Positives = 292/322 (90%)

Query: 1   MVDWTDRHYRFFARLLTNNALLYTEMIVADAILRGDKKNILGFSTQEKPLALQIGGADIS 60
           MVDWTDRHYRFFARLLTNNA+LYTEMIVADAIL G+++NILGFST+EKPLALQIGG+DI+
Sbjct: 29  MVDWTDRHYRFFARLLTNNAILYTEMIVADAILYGNRQNILGFSTEEKPLALQIGGSDIA 88

Query: 61  KLVEAAKIVEDFGYNEINLNVGCPSARVHEGSFGACLMLNPDIVGDCIAAMCKALSIPVT 120
           KLVE+AKIVEDFGYNEIN NVGCPS  VH GSFGACLML P+ VGDCIAAM  ALSIPVT
Sbjct: 89  KLVESAKIVEDFGYNEINFNVGCPSPNVHAGSFGACLMLTPESVGDCIAAMQNALSIPVT 148

Query: 121 VKCRIGVDDQIPAVALRNLVKSIKKSGVNGIWIHARKAILKGLSPKDNRKIPNLDYDIVY 180
           VKCRIGVD+QIPA+ALRNL+KSIK+SGV GIWIHARKAIL GLSPKDNRKIP LDYDI+Y
Sbjct: 149 VKCRIGVDNQIPAIALRNLIKSIKQSGVKGIWIHARKAILGGLSPKDNRKIPKLDYDIIY 208

Query: 181 EIKKENPDLFIGLNGGLEDMSQALKILPSVDGVMIGRAAYKNSAMLTTVDEYFSNPLTGS 240
           EIKKENPDLFIGLNGGL++M Q L++LP VDGVM+GR+AY+NS +L +VDEYF NPLTGS
Sbjct: 209 EIKKENPDLFIGLNGGLDNMQQILQVLPHVDGVMVGRSAYQNSIILASVDEYFMNPLTGS 268

Query: 241 SPIKTRVDKDFWRKISASMTDYAARHLHSGGKLQQITRHMIGLFHGFPNSRRCRHILTVE 300
           +P K  +DKDFW++IS SM+ YA RH+ +GGKL  ITRHMIGLFHGFP++RRCRHILTVE
Sbjct: 269 APKKKTIDKDFWKQISDSMSKYADRHIKAGGKLSHITRHMIGLFHGFPHARRCRHILTVE 328

Query: 301 AGASTATHHIIETAFNLMIESL 322
           A A TATH +I+TAFNLMIESL
Sbjct: 329 ANAPTATHQLIKTAFNLMIESL 350


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|307321239|ref|ZP_07600641.1| dihydrouridine synthase DuS [Sinorhizobium meliloti AK83] Length = 385 Back     alignment and organism information
>gi|307315973|ref|ZP_07595462.1| dihydrouridine synthase DuS [Sinorhizobium meliloti BL225C] Length = 361 Back     alignment and organism information
>gi|15965658|ref|NP_386011.1| tRNA-dihydrouridine synthase A [Sinorhizobium meliloti 1021] Length = 359 Back     alignment and organism information
>gi|150396830|ref|YP_001327297.1| tRNA-dihydrouridine synthase A [Sinorhizobium medicae WSM419] Length = 385 Back     alignment and organism information
>gi|307310192|ref|ZP_07589841.1| dihydrouridine synthase DuS [Sinorhizobium meliloti BL225C] Length = 353 Back     alignment and organism information
>gi|227822301|ref|YP_002826272.1| tRNA-dihydrouridine synthase A [Sinorhizobium fredii NGR234] Length = 385 Back     alignment and organism information
>gi|209549798|ref|YP_002281715.1| tRNA-dihydrouridine synthase A [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 333 Back     alignment and organism information
>gi|116252712|ref|YP_768550.1| tRNA-dihydrouridine synthase A [Rhizobium leguminosarum bv. viciae 3841] Length = 333 Back     alignment and organism information
>gi|241205218|ref|YP_002976314.1| tRNA-dihydrouridine synthase A [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 333 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target322 tRNA-dihydrouridine synthase A [Candidatus Liberibacter
PRK11815333 PRK11815, PRK11815, tRNA-dihydrouridine synthase A; Pro 1e-133
TIGR00742318 TIGR00742, yjbN, tRNA dihydrouridine synthase A 7e-97
pfam01207309 pfam01207, Dus, Dihydrouridine synthase (Dus) 2e-55
TIGR00737319 TIGR00737, nifR3_yhdG, putative TIM-barrel protein, nif 2e-28
KOG2333614 KOG2333, KOG2333, KOG2333, Uncharacterized conserved pr 7e-18
COG0042323 COG0042, COG0042, tRNA-dihydrouridine synthase [Transla 6e-62
cd02801231 cd02801, DUS_like_FMN, Dihydrouridine synthase-like (DU 1e-57
KOG2335358 KOG2335, KOG2335, KOG2335, tRNA-dihydrouridine synthase 1e-45
PRK10415321 PRK10415, PRK10415, tRNA-dihydrouridine synthase B; Pro 1e-14
KOG2334 477 KOG2334, KOG2334, KOG2334, tRNA-dihydrouridine synthase 2e-13
cd04740296 cd04740, DHOD_1B_like, Dihydroorotate dehydrogenase (DH 5e-09
PRK10550312 PRK10550, PRK10550, tRNA-dihydrouridine synthase C; Pro 1e-07
TIGR01037300 TIGR01037, pyrD_sub1_fam, dihydroorotate dehydrogenase 3e-05
PRK07259301 PRK07259, PRK07259, dihydroorotate dehydrogenase 1B; Re 2e-05
cd02810289 cd02810, DHOD_DHPD_FMN, Dihydroorotate dehydrogenase (D 3e-05
cd02940299 cd02940, DHPD_FMN, Dihydropyrimidine dehydrogenase (DHP 7e-04
>gnl|CDD|183323 PRK11815, PRK11815, tRNA-dihydrouridine synthase A; Provisional Back     alignment and domain information
>gnl|CDD|129825 TIGR00742, yjbN, tRNA dihydrouridine synthase A Back     alignment and domain information
>gnl|CDD|144707 pfam01207, Dus, Dihydrouridine synthase (Dus) Back     alignment and domain information
>gnl|CDD|129820 TIGR00737, nifR3_yhdG, putative TIM-barrel protein, nifR3 family Back     alignment and domain information
>gnl|CDD|37544 KOG2333, KOG2333, KOG2333, Uncharacterized conserved protein [General function prediction only] Back     alignment and domain information
>gnl|CDD|30391 COG0042, COG0042, tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|73368 cd02801, DUS_like_FMN, Dihydrouridine synthase-like (DUS-like) FMN-binding domain Back     alignment and domain information
>gnl|CDD|37546 KOG2335, KOG2335, KOG2335, tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|182440 PRK10415, PRK10415, tRNA-dihydrouridine synthase B; Provisional Back     alignment and domain information
>gnl|CDD|37545 KOG2334, KOG2334, KOG2334, tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|73402 cd04740, DHOD_1B_like, Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain Back     alignment and domain information
>gnl|CDD|182540 PRK10550, PRK10550, tRNA-dihydrouridine synthase C; Provisional Back     alignment and domain information
>gnl|CDD|130109 TIGR01037, pyrD_sub1_fam, dihydroorotate dehydrogenase (subfamily 1) family protein Back     alignment and domain information
>gnl|CDD|180909 PRK07259, PRK07259, dihydroorotate dehydrogenase 1B; Reviewed Back     alignment and domain information
>gnl|CDD|73372 cd02810, DHOD_DHPD_FMN, Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>gnl|CDD|73382 cd02940, DHPD_FMN, Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 322 tRNA-dihydrouridine synthase A [Candidatus Liberibacter
PRK11815333 tRNA-dihydrouridine synthase A; Provisional 100.0
TIGR00737336 nifR3_yhdG putative TIM-barrel protein, nifR3 family; I 100.0
PRK10415321 tRNA-dihydrouridine synthase B; Provisional 100.0
pfam01207309 Dus Dihydrouridine synthase (Dus). Members of this fami 100.0
TIGR00742326 yjbN TIM-barrel protein, yjbN family; InterPro: IPR0046 100.0
COG0042323 tRNA-dihydrouridine synthase [Translation, ribosomal st 100.0
PRK10550312 tRNA-dihydrouridine synthase C; Provisional 100.0
KOG2335358 consensus 100.0
KOG2333614 consensus 100.0
cd02801231 DUS_like_FMN Dihydrouridine synthase-like (DUS-like) FM 100.0
cd02911233 arch_FMN Archeal FMN-binding domain. This family of arc 100.0
KOG2334 477 consensus 99.98
TIGR01037308 pyrD_sub1_fam dihydroorotate dehydrogenase family prote 99.91
cd02803327 OYE_like_FMN_family Old yellow enzyme (OYE)-like FMN bi 99.56
TIGR00736234 nifR3_rel_arch TIM-barrel protein, putative; InterPro: 99.5
PRK13523337 NADPH dehydrogenase NamA; Provisional 99.28
cd04733338 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN bind 99.15
cd02931382 ER_like_FMN Enoate reductase (ER)-like FMN-binding doma 99.15
pfam00724336 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase 99.14
cd04734343 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN bind 99.08
cd02930353 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-binding dom 99.04
cd02933338 OYE_like_FMN Old yellow enzyme (OYE)-like FMN binding d 98.98
cd02929370 TMADH_HD_FMN Trimethylamine dehydrogenase (TMADH) and h 98.97
PRK08255770 salicylyl-CoA 5-hydroxylase; Reviewed 98.97
cd04735353 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN bind 98.94
COG1902363 NemA NADH:flavin oxidoreductases, Old Yellow Enzyme fam 98.77
cd04747361 OYE_like_5_FMN Old yellow enzyme (OYE)-related FMN bind 98.6
cd04722200 TIM_phosphate_binding TIM barrel proteins share a struc 98.44
cd04730236 NPD_like 2-Nitropropane dioxygenase (NPD), one of the n 98.01
pfam03060330 NPD 2-nitropropane dioxygenase. Members of this family 97.79
TIGR03151307 enACPred_II putative enoyl-(acyl-carrier-protein) reduc 97.77
COG0107256 HisF Imidazoleglycerol-phosphate synthase [Amino acid t 97.39
), involved in the fourth step of histidine biosynthesis. The bacterial HisF protein is a cyclase which catalyzes the cyclization reaction that produces D-erythro-imidazole glycerol phosphate during the sixth step of histidine biosynthesis. The yeast His7 protein is a bifunctional protein which catalyzes an amido-transferase reaction that generates imidazole-glycerol phosphate and 5-aminoimidazol-4-carboxamide. The latter is the ribonucleotide used for purine biosynthesis. The enzyme also catalyzes the cyclization reaction that produces D-erythro-imidazole glycerol phosphate, and is involved in the fifth and sixth steps in histidine biosynthesis. This family describes the histidine biosynthesis protein, HisF. ; GO: 0000107 imidazoleglycerol-phosphate synthase activity, 0000105 histidine biosynthetic process, 0005737 cytoplasm, 0009382 imidazoleglycerol-phosphate synthase complex." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR00735">TIGR00735312 hisF imidazoleglycerol phosphate synthase, cyclase subu 96.42
PRK07028 429 bifunctional hexulose-6-phosphate synthase/ribonuclease 96.01
PRK11320292 prpB 2-methylisocitrate lyase; Provisional 93.19
PRK04147294 N-acetylneuraminate lyase; Provisional 92.96
cd00952309 CHBPH_aldolase Trans-o-hydroxybenzylidenepyruvate hydra 92.91
cd00405203 PRAI Phosphoribosylanthranilate isomerase (PRAI) cataly 92.78
COG0329299 DapA Dihydrodipicolinate synthase/N-acetylneuraminate l 91.94
PRK03620296 5-dehydro-4-deoxyglucarate dehydratase; Provisional 90.65
cd04740296 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 99.77
PRK08318413 dihydropyrimidine dehydrogenase; Validated 99.77
PRK07259301 dihydroorotate dehydrogenase 1B; Reviewed 99.75
cd02810289 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and D 99.73
PRK07565333 dihydroorotate dehydrogenase 2; Reviewed 99.69
cd02940299 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FMN-bin 99.68
COG0167310 PyrD Dihydroorotate dehydrogenase [Nucleotide transport 99.68
cd04739325 DHOD_like Dihydroorotate dehydrogenase (DHOD) like prot 99.67
pfam01180290 DHO_dh Dihydroorotate dehydrogenase. 99.55
PRK02506308 dihydroorotate dehydrogenase 1A; Reviewed 99.47
cd04738327 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) class 2 99.44
cd04741294 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) class 99.33
PRK05286336 dihydroorotate dehydrogenase 2; Reviewed 99.3
cd02932336 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN bind 99.22
PRK10605362 N-ethylmaleimide reductase; Provisional 98.81
KOG2334477 consensus 98.6
KOG1799471 consensus 98.34
PRK03220257 consensus 98.25
PRK02621254 consensus 98.22
KOG1436398 consensus 98.18
cd02922344 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding domain. 98.17
COG0106241 HisA Phosphoribosylformimino-5-aminoimidazole carboxami 98.16
PRK02083253 imidazole glycerol phosphate synthase subunit HisF; Pro 98.05
TIGR00007241 TIGR00007 phosphoribosylformimino-5-aminoimidazole carb 98.05
cd04729219 NanE N-acetylmannosamine-6-phosphate epimerase (NanE) c 98.05
cd02809299 alpha_hydroxyacid_oxid_FMN Family of homologous FMN-dep 98.05
pfam01070301 FMN_dh FMN-dependent dehydrogenase. 98.03
PRK13585240 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylid 98.03
PRK13597252 imidazole glycerol phosphate synthase subunit HisF; Pro 98.02
cd04731243 HisF The cyclase subunit of imidazoleglycerol phosphate 98.02
PRK05211248 consensus 98.01
PRK00830273 consensus 98.0
PRK13587234 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylid 97.98
PRK01659252 consensus 97.91
cd03332383 LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-binding dom 97.9
PRK00748241 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylid 97.89
PRK02747257 consensus 97.89
pfam00977229 His_biosynth Histidine biosynthesis protein. Proteins i 97.88
cd02811326 IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl diphosp 97.88
TIGR01036370 pyrD_sub2 dihydroorotate oxidase; InterPro: IPR005719 D 97.88
cd04737351 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding domain 97.86
PRK05437351 isopentenyl pyrophosphate isomerase; Provisional 97.85
PRK02145257 consensus 97.83
cd04732234 HisA HisA. Phosphoribosylformimino-5-aminoimidazole car 97.83
PRK04281254 consensus 97.8
cd04736361 MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-binding 97.78
TIGR03572232 WbuZ glycosyl amidation-associated protein WbuZ. This c 97.78
PRK01033253 imidazole glycerol phosphate synthase subunit HisF; Pro 97.77
COG0214296 SNZ1 Pyridoxine biosynthesis enzyme [Coenzyme metabolis 97.77
PRK11197381 lldD L-lactate dehydrogenase; Provisional 97.65
cd04727283 pdxS PdxS is a subunit of the pyridoxal 5'-phosphate (P 97.62
PRK04180293 pyridoxine biosynthesis protein; Provisional 97.62
PRK13586231 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylid 97.61
PRK01130222 N-acetylmannosamine-6-phosphate 2-epimerase; Provisiona 97.49
KOG1606296 consensus 97.46
PRK13129267 consensus 97.36
cd00381325 IMPDH IMPDH: The catalytic domain of the inosine monoph 97.35
pfam01645367 Glu_synthase Conserved region in glutamate synthase. Th 97.31
pfam04131192 NanE Putative N-acetylmannosamine-6-phosphate epimerase 97.3
cd02808392 GltS_FMN Glutamate synthase (GltS) FMN-binding domain. 97.27
TIGR01304376 IMP_DH_rel_2 IMP dehydrogenase family protein; InterPro 97.26
CHL00200263 trpA tryptophan synthase alpha subunit; Provisional 97.25
PRK13135267 consensus 97.24
PRK13118269 consensus 97.24
PRK13121265 consensus 97.18
KOG0134400 consensus 97.17
pfam00478467 IMPDH IMP dehydrogenase / GMP reductase domain. This fa 97.12
PRK13111256 trpA tryptophan synthase subunit alpha; Provisional 97.12
PTZ00314499 inosine-5'-monophosphate dehydrogenase; Provisional 97.11
PRK05567486 inositol-5'-monophosphate dehydrogenase; Reviewed 97.1
PRK05283258 deoxyribose-phosphate aldolase; Provisional 97.1
PRK13134257 consensus 97.09
PRK13139254 consensus 97.08
PRK13112279 consensus 97.07
PRK13119261 consensus 97.02
PRK13140257 consensus 97.02
PRK13127262 consensus 97.01
PRK13124257 consensus 96.98
COG0159265 TrpA Tryptophan synthase alpha chain [Amino acid transp 96.98
PRK13115269 consensus 96.98
PRK13117268 consensus 96.97
pfam00290258 Trp_syntA Tryptophan synthase alpha chain. 96.96
PRK13116278 consensus 96.92
cd03315265 MLE_like Muconate lactonizing enzyme (MLE) like subgrou 96.88
PRK13114266 consensus 96.87
PRK00507221 deoxyribose-phosphate aldolase; Provisional 96.83
PRK13138264 consensus 96.83
PRK13113263 consensus 96.81
PRK13122242 consensus 96.8
PRK13136253 consensus 96.79
PRK06843404 inositol-5-monophosphate dehydrogenase; Validated 96.77
cd00945201 Aldolase_Class_I Class I aldolases. The class I aldolas 96.77
PRK13133267 consensus 96.77
cd03319316 L-Ala-DL-Glu_epimerase L-Ala-D/L-Glu epimerase catalyze 96.75
PRK07807479 inositol-5-monophosphate dehydrogenase; Validated 96.75
PRK13123256 consensus 96.73
cd04723233 HisA_HisF Phosphoribosylformimino-5-aminoimidazole carb 96.54
cd00959203 DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of the D 96.5
PRK08005210 ribulose-phosphate 3-epimerase; Validated 96.49
PRK13137266 consensus 96.42
COG0274228 DeoC Deoxyribose-phosphate aldolase [Nucleotide transpo 96.38
cd03325352 D-galactonate_dehydratase D-galactonate dehydratase cat 96.33
PRK07226266 fructose-bisphosphate aldolase; Provisional 96.31
PRK04128228 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylid 96.3
PRK08227291 aldolase; Validated 96.25
PRK13131257 consensus 96.23
cd00958235 DhnA Class I fructose-1,6-bisphosphate (FBP) aldolases 96.19
TIGR02708368 L_lactate_ox L-lactate oxidase; InterPro: IPR014080 Mem 96.19
PRK13132246 consensus 96.18
pfam00218254 IGPS Indole-3-glycerol phosphate synthase. 96.16
PRK07107497 inositol-5-monophosphate dehydrogenase; Validated 96.04
pfam01791231 DeoC DeoC/LacD family aldolase. This family includes di 95.95
COG0036220 Rpe Pentose-5-phosphate-3-epimerase [Carbohydrate trans 95.92
cd03316357 MR_like Mandelate racemase (MR)-like subfamily of the e 95.91
cd04722200 TIM_phosphate_binding TIM barrel proteins share a struc 95.87
PRK00278261 trpC indole-3-glycerol-phosphate synthase; Reviewed 95.81
KOG0538363 consensus 95.8
PRK05581220 ribulose-phosphate 3-epimerase; Validated 95.8
TIGR02151349 IPP_isom_2 isopentenyl-diphosphate delta-isomerase, typ 95.74
cd00429211 RPE Ribulose-5-phosphate 3-epimerase (RPE). This enzyme 95.67
PRK05096347 guanosine 5'-monophosphate oxidoreductase; Provisional 95.62
PRK08673335 3-deoxy-7-phosphoheptulonate synthase; Reviewed 95.62
COG4948372 L-alanine-DL-glutamate epimerase and related enzymes of 95.57
cd03318365 MLE Muconate Lactonizing Enzyme (MLE), an homooctameric 95.54
TIGR03128206 RuMP_HxlA 3-hexulose-6-phosphate synthase. at the cost 95.34
pfam03437254 BtpA BtpA family. The BtpA protein is tightly associate 95.3
PRK11197381 lldD L-lactate dehydrogenase; Provisional 95.29
PRK08883220 ribulose-phosphate 3-epimerase; Provisional 95.2
PRK09722227 allulose-6-phosphate 3-epimerase; Provisional 95.2
TIGR01302476 IMP_dehydrog inosine-5'-monophosphate dehydrogenase; In 95.08
COG2513289 PrpB PEP phosphonomutase and related enzymes [Carbohydr 94.97
cd04743320 NPD_PKS 2-Nitropropane dioxygenase (NPD)-like domain, a 94.92
PRK05458326 guanosine 5'-monophosphate oxidoreductase; Provisional 94.86
pfam09370268 TIM-br_sig_trns TIM-barrel signal transduction protein. 94.73
cd00331217 IGPS Indole-3-glycerol phosphate synthase (IGPS); an en 94.71
cd03332383 LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-binding dom 94.6
cd03322361 rpsA The starvation sensing protein RpsA from E.coli an 94.43
PRK13120285 consensus 94.39
cd02922344 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding domain. 94.31
PRK13957247 indole-3-glycerol-phosphate synthase; Provisional 94.09
cd04728248 ThiG Thiazole synthase (ThiG) is the tetrameric enzyme 94.08
cd03327341 MR_like_2 Mandelate racemase (MR)-like subfamily of the 94.02
cd03321355 mandelate_racemase Mandelate racemase (MR) catalyzes th 94.0
PRK08745223 ribulose-phosphate 3-epimerase; Provisional 94.0
PRK00208256 thiG thiazole synthase; Reviewed 93.97
pfam05690246 ThiG Thiazole biosynthesis protein ThiG. This family co 93.97
PTZ00170224 D-ribulose-5-phosphate 3-epimerase; Provisional 93.91
CHL00162267 thiG thiamin biosynthesis protein G; Validated 93.68
PRK11320292 prpB 2-methylisocitrate lyase; Provisional 93.49
PRK13398266 3-deoxy-7-phosphoheptulonate synthase; Provisional 93.42
COG0069485 GltB Glutamate synthase domain 2 [Amino acid transport 93.4
cd03328352 MR_like_3 Mandelate racemase (MR)-like subfamily of the 93.37
PRK13396352 3-deoxy-7-phosphoheptulonate synthase; Provisional 93.31
cd03329368 MR_like_4 Mandelate racemase (MR)-like subfamily of the 93.31
cd04737351 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding domain 93.12
cd00740252 MeTr MeTr subgroup of pterin binding enzymes. This fami 92.89
TIGR01949259 AroFGH_arch predicted phospho-2-dehydro-3-deoxyheptonat 92.8
COG2513289 PrpB PEP phosphonomutase and related enzymes [Carbohydr 92.39
PRK13802 695 bifunctional indole-3-glycerol phosphate synthase/trypt 91.91
PRK07455210 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphoglucon 91.52
cd00377243 ICL_PEPM Members of the ICL/PEPM enzyme family catalyze 91.5
COG2876286 AroA 3-deoxy-D-arabino-heptulosonate 7-phosphate (DAHP) 91.32
pfam01680209 SOR_SNZ SOR/SNZ family. Members of this family are enzy 91.02
PRK09140206 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; Review 90.87
COG0434263 SgcQ Predicted TIM-barrel enzyme [General function pred 90.42
TIGR02090371 LEU1_arch isopropylmalate/citramalate/homocitrate synth 90.24
TIGR01919246 hisA-trpF bifunctional HisA/TrpF protein; InterPro: IPR 97.67
cd00381325 IMPDH IMPDH: The catalytic domain of the inosine monoph 96.52
cd02809299 alpha_hydroxyacid_oxid_FMN Family of homologous FMN-dep 96.17
COG2070336 Dioxygenases related to 2-nitropropane dioxygenase [Gen 96.04
pfam01070301 FMN_dh FMN-dependent dehydrogenase. 95.81
PRK12595360 bifunctional 3-deoxy-7-phosphoheptulonate synthase/chor 95.71
COG0134254 TrpC Indole-3-glycerol phosphate synthase [Amino acid t 94.8
PRK05458326 guanosine 5'-monophosphate oxidoreductase; Provisional 94.43
PRK09427 459 bifunctional indole-3-glycerol phosphate synthase/phosp 93.94
PRK05096347 guanosine 5'-monophosphate oxidoreductase; Provisional 93.54
cd04730236 NPD_like 2-Nitropropane dioxygenase (NPD), one of the n 91.15
pfam04131192 NanE Putative N-acetylmannosamine-6-phosphate epimerase 90.79
PRK12457281 2-dehydro-3-deoxyphosphooctonate aldolase; Provisional 90.63
PRK05211248 consensus 97.62
PRK13597252 imidazole glycerol phosphate synthase subunit HisF; Pro 97.41
PRK01033253 imidazole glycerol phosphate synthase subunit HisF; Pro 97.34
TIGR03572232 WbuZ glycosyl amidation-associated protein WbuZ. This c 97.33
PRK02747257 consensus 97.31
PRK13586231 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylid 97.3
PRK00748241 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylid 97.29
PRK13585240 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylid 97.28
PRK02145257 consensus 97.28
PRK02621254 consensus 97.27
PRK03220257 consensus 97.26
PRK02083253 imidazole glycerol phosphate synthase subunit HisF; Pro 97.23
cd04731243 HisF The cyclase subunit of imidazoleglycerol phosphate 97.19
PRK00830273 consensus 97.18
PRK04281254 consensus 97.16
PRK01659252 consensus 97.1
TIGR00007241 TIGR00007 phosphoribosylformimino-5-aminoimidazole carb 97.05
pfam00977229 His_biosynth Histidine biosynthesis protein. Proteins i 96.67
COG0107256 HisF Imidazoleglycerol-phosphate synthase [Amino acid t 96.64
PRK06843404 inositol-5-monophosphate dehydrogenase; Validated 96.56
cd04723233 HisA_HisF Phosphoribosylformimino-5-aminoimidazole carb 96.52
cd04732234 HisA HisA. Phosphoribosylformimino-5-aminoimidazole car 96.5
PRK13587234 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylid 96.2
PRK04128228 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylid 96.01
pfam00478467 IMPDH IMP dehydrogenase / GMP reductase domain. This fa 96.0
COG0106241 HisA Phosphoribosylformimino-5-aminoimidazole carboxami 95.95
cd02812219 PcrB_like PcrB_like proteins. One member of this family 95.73
PTZ00314499 inosine-5'-monophosphate dehydrogenase; Provisional 95.57
PRK05567486 inositol-5'-monophosphate dehydrogenase; Reviewed 95.51
COG1304360 idi Isopentenyl diphosphate isomerase (BS_ypgA, MTH48 a 95.48
PRK00043210 thiE thiamine-phosphate pyrophosphorylase; Reviewed 95.47
cd04733338 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN bind 95.37
PRK13523337 NADPH dehydrogenase NamA; Provisional 94.84
cd04734343 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN bind 94.59
PRK07807479 inositol-5-monophosphate dehydrogenase; Validated 94.5
TIGR00693210 thiE thiamine-phosphate pyrophosphorylase; InterPro: IP 93.7
cd02930353 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-binding dom 93.61
PRK07107497 inositol-5-monophosphate dehydrogenase; Validated 93.24
PRK03512211 thiamine-phosphate pyrophosphorylase; Provisional 93.21
cd00564196 TMP_TenI Thiamine monophosphate synthase (TMP synthase) 92.98
TIGR01302476 IMP_dehydrog inosine-5'-monophosphate dehydrogenase; In 92.84
PRK08649368 inositol-5-monophosphate dehydrogenase; Validated 92.77
PRK08649368 inositol-5-monophosphate dehydrogenase; Validated 92.73
cd02931382 ER_like_FMN Enoate reductase (ER)-like FMN-binding doma 92.43
KOG2550503 consensus 92.33
PRK11840327 bifunctional sulfur carrier protein/thiazole synthase p 92.29
PRK07695202 transcriptional regulator TenI; Provisional 92.11
cd02932336 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN bind 91.84
pfam01884231 PcrB PcrB family. This family contains proteins that ar 91.82
COG0352211 ThiE Thiamine monophosphate synthase [Coenzyme metaboli 90.76
), involved in the fourth step of histidine biosynthesis. The bacterial HisF protein is a cyclase which catalyzes the cyclization reaction that produces D-erythro-imidazole glycerol phosphate during the sixth step of histidine biosynthesis. The yeast His7 protein is a bifunctional protein which catalyzes an amido-transferase reaction that generates imidazole-glycerol phosphate and 5-aminoimidazol-4-carboxamide. The latter is the ribonucleotide used for purine biosynthesis. The enzyme also catalyzes the cyclization reaction that produces D-erythro-imidazole glycerol phosphate, and is involved in the fifth and sixth steps in histidine biosynthesis. This family describes the histidine biosynthesis protein, HisF. ; GO: 0000107 imidazoleglycerol-phosphate synthase activity, 0000105 histidine biosynthetic process, 0005737 cytoplasm, 0009382 imidazoleglycerol-phosphate synthase complex." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR00735">TIGR00735312 hisF imidazoleglycerol phosphate synthase, cyclase subu 90.54
TIGR01163216 rpe ribulose-phosphate 3-epimerase; InterPro: IPR000056 96.97
pfam00834201 Ribul_P_3_epim Ribulose-phosphate 3 epimerase family. T 95.87
TIGR01496268 DHPS dihydropteroate synthase; InterPro: IPR006390 This 92.85
pfam00809208 Pterin_bind Pterin binding enzyme. This family includes 91.83
PRK07534335 methionine synthase I; Validated 91.8
PRK02227239 hypothetical protein; Provisional 90.9
KOG4175268 consensus 90.15
cd04724242 Tryptophan_synthase_alpha Ttryptophan synthase (TRPS) a 96.78
COG3010229 NanE Putative N-acetylmannosamine-6-phosphate epimerase 96.39
PRK13125247 trpA tryptophan synthase subunit alpha; Provisional 95.37
PRK04169229 geranylgeranylglyceryl phosphate synthase-like protein; 94.79
COG1646240 Predicted phosphate-binding enzymes, TIM-barrel fold [G 90.97
PRK12330 499 oxaloacetate decarboxylase; Provisional 96.76
PRK12581 468 oxaloacetate decarboxylase; Provisional 93.42
PRK08645 608 bifunctional homocysteine S-methyltransferase/5,10-meth 96.41
TIGR01108 616 oadA oxaloacetate decarboxylase alpha subunit; InterPro 96.11
pfam00682237 HMGL-like HMGL-like. This family contains a diverse set 92.42
pfam0118898 MR_MLE Mandelate racemase / muconate lactonizing enzyme 92.34
PRK01222212 N-(5'-phosphoribosyl)anthranilate isomerase; Provisiona 95.27
PRK07535268 methyltetrahydrofolate:corrinoid/iron-sulfur protein me 93.63
cd00423258 Pterin_binding Pterin binding enzymes. This family incl 92.96
PRK09485308 mmuM homocysteine methyltransferase; Provisional 92.93
PRK11613282 folP dihydropteroate synthase; Provisional 91.9
PRK09282 580 pyruvate carboxylase subunit B; Validated 93.1
PRK06857209 consensus 92.88
PRK06015212 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphoglucon 92.55
PRK13397250 3-deoxy-7-phosphoheptulonate synthase; Provisional 92.62
PRK09490 1229 metH B12-dependent methionine synthase; Provisional 91.97
COG5016472 Pyruvate/oxaloacetate carboxyltransferase [Energy produ 90.43
PRK07565333 dihydroorotate dehydrogenase 2; Reviewed 91.71
>PRK11815 tRNA-dihydrouridine synthase A; Provisional Back     alignment and domain information
>TIGR00737 nifR3_yhdG putative TIM-barrel protein, nifR3 family; InterPro: IPR004652 This family represents one branch of COG0042 from COG (Predicted TIM-barrel enzymes, possibly dehydrogenases, nifR3 family) and includes NifR3 itself, from Rhodobacter capsulatus Back     alignment and domain information
>PRK10415 tRNA-dihydrouridine synthase B; Provisional Back     alignment and domain information
>pfam01207 Dus Dihydrouridine synthase (Dus) Back     alignment and domain information
>TIGR00742 yjbN TIM-barrel protein, yjbN family; InterPro: IPR004653 This family represents one branch of COG0042 from COG (Predicted TIM-barrel enzymes, possibly dehydrogenases, nifR3 family) although NifR3 itself, a protein of unknown function associated with nitrogen regulation in Rhodobacter capsulatus, is not a member of this branch Back     alignment and domain information
>COG0042 tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK10550 tRNA-dihydrouridine synthase C; Provisional Back     alignment and domain information
>KOG2335 consensus Back     alignment and domain information
>KOG2333 consensus Back     alignment and domain information
>cd02801 DUS_like_FMN Dihydrouridine synthase-like (DUS-like) FMN-binding domain Back     alignment and domain information
>cd02911 arch_FMN Archeal FMN-binding domain Back     alignment and domain information
>KOG2334 consensus Back     alignment and domain information
>TIGR01037 pyrD_sub1_fam dihydroorotate dehydrogenase family protein; InterPro: IPR005720 Dihydroorotate dehydrogenase (1 Back     alignment and domain information
>cd02803 OYE_like_FMN_family Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>TIGR00736 nifR3_rel_arch TIM-barrel protein, putative; InterPro: IPR005270 The function of this family is unknown, but it may include TIM-barrel proteins Back     alignment and domain information
>PRK13523 NADPH dehydrogenase NamA; Provisional Back     alignment and domain information
>cd04733 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 2 Back     alignment and domain information
>cd02931 ER_like_FMN Enoate reductase (ER)-like FMN-binding domain Back     alignment and domain information
>pfam00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family Back     alignment and domain information
>cd04734 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 3 Back     alignment and domain information
>cd02930 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-binding domain Back     alignment and domain information
>cd02933 OYE_like_FMN Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>cd02929 TMADH_HD_FMN Trimethylamine dehydrogenase (TMADH) and histamine dehydrogenase (HD) FMN-binding domain Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>cd04735 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 4 Back     alignment and domain information
>COG1902 NemA NADH:flavin oxidoreductases, Old Yellow Enzyme family [Energy production and conversion] Back     alignment and domain information
>cd04747 OYE_like_5_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 5 Back     alignment and domain information
>cd04722 TIM_phosphate_binding TIM barrel proteins share a structurally conserved phosphate binding motif and in general share an eight beta/alpha closed barrel structure Back     alignment and domain information
>cd04730 NPD_like 2-Nitropropane dioxygenase (NPD), one of the nitroalkane oxidizing enzyme families, catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites Back     alignment and domain information
>pfam03060 NPD 2-nitropropane dioxygenase Back     alignment and domain information
>TIGR03151 enACPred_II putative enoyl-(acyl-carrier-protein) reductase II Back     alignment and domain information
>COG0107 HisF Imidazoleglycerol-phosphate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00735 hisF imidazoleglycerol phosphate synthase, cyclase subunit; InterPro: IPR004651 Histidine is formed by several complex and distinct biochemical reactions catalysed by eight enzymes Back     alignment and domain information
>PRK07028 bifunctional hexulose-6-phosphate synthase/ribonuclease regulator; Validated Back     alignment and domain information
>PRK11320 prpB 2-methylisocitrate lyase; Provisional Back     alignment and domain information
>PRK04147 N-acetylneuraminate lyase; Provisional Back     alignment and domain information
>cd00952 CHBPH_aldolase Trans-o-hydroxybenzylidenepyruvate hydratase-aldolase (HBPHA) and trans-2'-carboxybenzalpyruvate hydratase-aldolase (CBPHA) Back     alignment and domain information
>cd00405 PRAI Phosphoribosylanthranilate isomerase (PRAI) catalyzes the fourth step of the tryptophan biosynthesis, the conversion of N-(5'- phosphoribosyl)-anthranilate (PRA) to 1-(o-carboxyphenylamino)- 1-deoxyribulose 5-phosphate (CdRP) Back     alignment and domain information
>COG0329 DapA Dihydrodipicolinate synthase/N-acetylneuraminate lyase [Amino acid transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK03620 5-dehydro-4-deoxyglucarate dehydratase; Provisional Back     alignment and domain information
>cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain Back     alignment and domain information
>PRK08318 dihydropyrimidine dehydrogenase; Validated Back     alignment and domain information
>PRK07259 dihydroorotate dehydrogenase 1B; Reviewed Back     alignment and domain information
>cd02810 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>PRK07565 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>cd02940 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>COG0167 PyrD Dihydroorotate dehydrogenase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd04739 DHOD_like Dihydroorotate dehydrogenase (DHOD) like proteins Back     alignment and domain information
>pfam01180 DHO_dh Dihydroorotate dehydrogenase Back     alignment and domain information
>PRK02506 dihydroorotate dehydrogenase 1A; Reviewed Back     alignment and domain information
>cd04738 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) class 2 Back     alignment and domain information
>cd04741 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) class 1A FMN-binding domain Back     alignment and domain information
>PRK05286 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>cd02932 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN binding domain Back     alignment and domain information
>PRK10605 N-ethylmaleimide reductase; Provisional Back     alignment and domain information
>KOG2334 consensus Back     alignment and domain information
>KOG1799 consensus Back     alignment and domain information
>PRK03220 consensus Back     alignment and domain information
>PRK02621 consensus Back     alignment and domain information
>KOG1436 consensus Back     alignment and domain information
>cd02922 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding domain Back     alignment and domain information
>COG0106 HisA Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK02083 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>TIGR00007 TIGR00007 phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase; InterPro: IPR006063 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase (5 Back     alignment and domain information
>cd04729 NanE N-acetylmannosamine-6-phosphate epimerase (NanE) converts N-acetylmannosamine-6-phosphate to N-acetylglucosamine-6-phosphate Back     alignment and domain information
>cd02809 alpha_hydroxyacid_oxid_FMN Family of homologous FMN-dependent alpha-hydroxyacid oxidizing enzymes Back     alignment and domain information
>pfam01070 FMN_dh FMN-dependent dehydrogenase Back     alignment and domain information
>PRK13585 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PRK13597 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>cd04731 HisF The cyclase subunit of imidazoleglycerol phosphate synthase (HisF) Back     alignment and domain information
>PRK05211 consensus Back     alignment and domain information
>PRK00830 consensus Back     alignment and domain information
>PRK13587 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PRK01659 consensus Back     alignment and domain information
>cd03332 LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-binding domain Back     alignment and domain information
>PRK00748 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Validated Back     alignment and domain information
>PRK02747 consensus Back     alignment and domain information
>pfam00977 His_biosynth Histidine biosynthesis protein Back     alignment and domain information
>cd02811 IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl diphosphate isomerase type 2 (IDI-2) FMN-binding domain Back     alignment and domain information
>TIGR01036 pyrD_sub2 dihydroorotate oxidase; InterPro: IPR005719 Dihydroorotate dehydrogenase (1 Back     alignment and domain information
>cd04737 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding domain Back     alignment and domain information
>PRK05437 isopentenyl pyrophosphate isomerase; Provisional Back     alignment and domain information
>PRK02145 consensus Back     alignment and domain information
>cd04732 HisA HisA Back     alignment and domain information
>PRK04281 consensus Back     alignment and domain information
>cd04736 MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-binding domain Back     alignment and domain information
>TIGR03572 WbuZ glycosyl amidation-associated protein WbuZ Back     alignment and domain information
>PRK01033 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>COG0214 SNZ1 Pyridoxine biosynthesis enzyme [Coenzyme metabolism] Back     alignment and domain information
>PRK11197 lldD L-lactate dehydrogenase; Provisional Back     alignment and domain information
>cd04727 pdxS PdxS is a subunit of the pyridoxal 5'-phosphate (PLP) synthase, an important enzyme in deoxyxylulose 5-phosphate (DXP)-independent pathway for de novo biosynthesis of PLP, present in some eubacteria, in archaea, fungi, plants, plasmodia, and some metazoa Back     alignment and domain information
>PRK04180 pyridoxine biosynthesis protein; Provisional Back     alignment and domain information
>PRK13586 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PRK01130 N-acetylmannosamine-6-phosphate 2-epimerase; Provisional Back     alignment and domain information
>KOG1606 consensus Back     alignment and domain information
>PRK13129 consensus Back     alignment and domain information
>cd00381 IMPDH IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase Back     alignment and domain information
>pfam01645 Glu_synthase Conserved region in glutamate synthase Back     alignment and domain information
>pfam04131 NanE Putative N-acetylmannosamine-6-phosphate epimerase Back     alignment and domain information
>cd02808 GltS_FMN Glutamate synthase (GltS) FMN-binding domain Back     alignment and domain information
>TIGR01304 IMP_DH_rel_2 IMP dehydrogenase family protein; InterPro: IPR005992 This family of proteins, often annotated as a putative IMP dehydrogenase, are related to IMP dehydrogenase and GMP reductase Back     alignment and domain information
>CHL00200 trpA tryptophan synthase alpha subunit; Provisional Back     alignment and domain information
>PRK13135 consensus Back     alignment and domain information
>PRK13118 consensus Back     alignment and domain information
>PRK13121 consensus Back     alignment and domain information
>KOG0134 consensus Back     alignment and domain information
>pfam00478 IMPDH IMP dehydrogenase / GMP reductase domain Back     alignment and domain information
>PRK13111 trpA tryptophan synthase subunit alpha; Provisional Back     alignment and domain information
>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK05567 inositol-5'-monophosphate dehydrogenase; Reviewed Back     alignment and domain information
>PRK05283 deoxyribose-phosphate aldolase; Provisional Back     alignment and domain information
>PRK13134 consensus Back     alignment and domain information
>PRK13139 consensus Back     alignment and domain information
>PRK13112 consensus Back     alignment and domain information
>PRK13119 consensus Back     alignment and domain information
>PRK13140 consensus Back     alignment and domain information
>PRK13127 consensus Back     alignment and domain information
>PRK13124 consensus Back     alignment and domain information
>COG0159 TrpA Tryptophan synthase alpha chain [Amino acid transport and metabolism] Back     alignment and domain information