254781169

254781169

ascorbate-specific PTS system enzyme IIC/IIB

GeneID in NCBI database:8210194Locus tag:CLIBASIA_05380
Protein GI in NCBI database:254781169Protein Accession:YP_003065582.1
Gene range:+(1164410, 1165795)Protein Length:461aa
Gene description:PTS system ascorbate-specific transporter subunit IIC
COG prediction:none
KEGG prediction:ulaA; PTS system ascorbate-specific transporter subunit IIC
SEED prediction:Ascorbate-specific PTS system, EIIC component
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM11 TM-Helix
TOPPRED11 TM-Helix
HMMTOP13 TM-Helix
MEMSAT9 TM-Helix
MEMSAT_SVM11 TM-Helix
PHOBIUS12 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-
MVFFAHCFSFFHSQILTKPAFMLGLIVMLGNILLSKKITTVISSTIQTIVGFLLLRVGADILVKKSKAIITKISVIHHIDGSIIDPYVFMFSCITSLGDKYNFVGYTVLIAFLLNILMVIFRHLTGIRTIVLNGEVMFQQAGLIFIFFHTALNTEIWQSVAYSSCLLALYWGITSNLLYKPTQEITNNAGFSIGHQQQVASWIAYKIAPYLGDRSENINSLKLSKWLVLLNNYVISTAIVMIFFWGIALLSLGIDTVQTMAGKTHWTLYILETGLLFAVGIAIIMQGVSMFVKELTSSFRGISTSLIPGAILAIDCSAIYGFAPNALIWGFIWGAIGQISTILVMLFFHSPILIVPGFIPMFFSNATIGIFANHYGGWRAASKICFVMGVIEILGSIWAIQLAKTDSWMGMADWSLIAPLIMQGFKLTHFFIIPIGLLSVIYMVYARRTLDDKQSNSNHHE
ccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHccHHHHccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHcccccEEEEEHHHHHHHHHHHHHHHcccHHHccHHccccHHHHHHHHcHHHHHHHHHHHHHHHHHHccHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEcccccccHHHHHHHHHccHHHHHHHHHHcccccEEccccHHHHccccHHHEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccc
ccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccHHHHcccHHHHHHHHHHcccccccccHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHcccccccEEccHHHHHHHHHHHHHHHcccccccHHHccccHHHHHHccHHHHHHHHHHHHHHHHHHHHcHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccEEccccccHHHHHHHHHHHHHHHHHHHHHHHcccEEEEcccEEccccccEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc
mvffahcfsffhsqiltkpAFMLGLIVMLGNILLSKKITTVISSTIQTIVGFLLLRVGADILVKKSKAIITKISVIhhidgsiidpYVFMFSCItslgdkynfVGYTVLIAFLLNILMVIFRHLTGIRTIVLNGEVMFQQAGLIFIFFHTALNTEIWQSVAYSSCLLALYWGItsnllykptqeitnnagfsiGHQQQVASWIAYKiapylgdrseninsLKLSKWLVLLNNYVISTAIVMIFFWGIALLSLGIDTVQTMAGKTHWTLYILETGLLFAVGIAIIMQGVSMFVKELTSsfrgistslipgaILAIDCsaiygfapnaLIWGFIWGAIGQISTILVMLFFhspilivpgfipmffsnatigifanhyggwraaSKICFVMGVIEILGSIWAIQLAktdswmgmadWSLIAPLIMQGFKLTHFFIIPIGLLSVIYMVYARrtlddkqsnsnhhe
MVFFAHCFSFFHSQILTKPAFMLGLIVMLGNILLSKKITTVISSTIQTIVGFLLLRVGADILVKKSKAIITKISVIHHIDGSIIDPYVFMFSCITSLGDKYNFVGYTVLIAFLLNILMVIFRHLTGIRTIVLNGEVMFQQAGLIFIFFHTALNTEIWQSVAYSSCLLALYWGITSNLLYKPTQEITNNAGFSIGHQQQVASWIAYKIAPYLGDRSENINSLKLSKWLVLLNNYVISTAIVMIFFWGIALLSLGIDTVQTMAGKTHWTLYILETGLLFAVGIAIIMQGVSMFVKELTSSFRGISTSLIPGAILAIDCSAIYGFAPNALIWGFIWGAIGQISTILVMLFFHSPILIVPGFIPMFFSNATIGIFANHYGGWRAASKICFVMGVIEILGSIWAIQLAKTDSWMGMADWSLIAPLIMQGFKLTHFFIIPIGLLSVIYMVYARRtlddkqsnsnhhe
MVFFAHCFSFFHSQILTKPAFMLGLIVMLGNILLSKKittvisstiqtivGFLLLRVGADILVKKSKAIITKISVIHHIDGSIIDPYVFMFSCITSLGDKYNFVGYTVLIAFLLNILMVIFRHLTGIRTIVLNGEVMFQQAGLIFIFFHTALNTEIWQSVAYSSCLLALYWGITSNLLYKPTQEITNNAGFSIGHQQQVASWIAYKIAPYLGDRSENINSLKLSKWLVLLNNYVISTAIVMIFFWGIALLSLGIDTVQTMAGKTHWTLYILETGLLFAVGIAIIMQGVSMFVKELTSSFRGISTSLIPGAILAIDCSAIYGFAPNALIWGFIWGAIGQISTILVMLFFHSPILIVPGFIPMFFSNATIGIFANHYGGWRAASKICFVMGVIEILGSIWAIQLAKTDSWMGMADWSLIAPLIMQGFKLTHFFIIPIGLLSVIYMVYARRTLDDKQSNSNHHE
*VFFAHCFSFFHSQILTKPAFMLGLIVMLGNILLSKKITTVISSTIQTIVGFLLLRVGADILVKKSKAIITKISVIHHIDGSIIDPYVFMFSCITSLGDKYNFVGYTVLIAFLLNILMVIFRHLTGIRTIVLNGEVMFQQAGLIFIFFHTALNTEIWQSVAYSSCLLALYWGITSNLLYKPTQEITNNAGFSIGHQQQVASWIAYKIAPYLGDRSENINSLKLSKWLVLLNNYVISTAIVMIFFWGIALLSLGIDTVQTMAGKTHWTLYILETGLLFAVGIAIIMQGVSMFVKELTSSFRGISTSLIPGAILAIDCSAIYGFAPNALIWGFIWGAIGQISTILVMLFFHSPILIVPGFIPMFFSNATIGIFANHYGGWRAASKICFVMGVIEILGSIWAIQLAKTDSWMGMADWSLIAPLIMQGFKLTHFFIIPIGLLSVIYMVYAR**************
MVFFAHCFSFFHSQILTKPAFMLGLIVMLGNILLSKKITTVISSTIQTIVGFLLLRVGADILVKKSKAIITKISVIHHIDGSIIDPYVFMFSCITSLGDKYNFVGYTVLIAFLLNILMVIFRHLTGIRTIVLNGEVMFQQAGLIFIFFHTALNTEIWQSVAYSSCLLALYWGITSNLLYKPTQEITNNAGFSIGHQQQVASWIAYKIAPYLGDRSENINSLKLSKWLVLLNNYVISTAIVMIFFWGIALLSLGIDTVQTMAGKTHWTLYILETGLLFAVGIAIIMQGVSMFVKELTSSFRGISTSLIPGAILAIDCSAIYGFAPNALIWGFIWGAIGQISTILVMLFFHSPILIVPGFIPMFFSNATIGIFANHYGGWRAASKICFVMGVIEILGSIWAIQLAKTDSWMGMADWSLIAPLIMQGFKLTHFFIIPIGLLSVIYMVYARRTLD**********
MVFFAHCFSFFHSQILTKPAFMLGLIVMLGNILLSKKITTVISSTIQTIVGFLLLRVGADILVKKSKAIITKISVIHHIDGSIIDPYVFMFSCITSLGDKYNFVGYTVLIAFLLNILMVIFRHLTGIRTIVLNGEVMFQQAGLIFIFFHTALNTEIWQSVAYSSCLLALYWGITSNLLYKPTQEITNNAGFSIGHQQQVASWIAYKIAPYLGDRSENINSLKLSKWLVLLNNYVISTAIVMIFFWGIALLSLGIDTVQTMAGKTHWTLYILETGLLFAVGIAIIMQGVSMFVKELTSSFRGISTSLIPGAILAIDCSAIYGFAPNALIWGFIWGAIGQISTILVMLFFHSPILIVPGFIPMFFSNATIGIFANHYGGWRAASKICFVMGVIEILGSIWAIQLAKTDSWMGMADWSLIAPLIMQGFKLTHFFIIPIGLLSVIYMVYARRTLDDKQ*******
ooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiii
xxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxx
ooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiii
ooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiii
oooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSoooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVFFAHCFSFFHSQILTKPAFMLGLIVMLGNILLSKKITTVISSTIQTIVGFLLLRVGADILVKKSKAIITKISVIHHIDGSIIDPYVFMFSCITSLGDKYNFVGYTVLIAFLLNILMVIFRHLTGIRTIVLNGEVMFQQAGLIFIFFHTALNTEIWQSVAYSSCLLALYWGITSNLLYKPTQEITNNAGFSIGHQQQVASWIAYKIAPYLGDRSENINSLKLSKWLVLLNNYVISTAIVMIFFWGIALLSLGIDTVQTMAGKTHWTLYILETGLLFAVGIAIIMQGVSMFVKELTSSFRGISTSLIPGAILAIDCSAIYGFAPNALIWGFIWGAIGQISTILVMLFFHSPILIVPGFIPMFFSNATIGIFANHYGGWRAASKICFVMGVIEILGSIWAIQLAKTDSWMGMADWSLIAPLIMQGFKLTHFFIIPIGLLSVIYMVYARRTLDDKQSNSNHHE
MVFFAHCFSFFHSQILTKPAFMLGLIVMLGNILLSKKITTVISSTIQTIVGFLLLRVGADILVKKSKAIITKISVIHHIDGSIIDPYVFMFSCITSLGDKYNFVGYTVLIAFLLNILMVIFRHLTGIRTIVLNGEVMFQQAGLIFIFFHTALNTEIWQSVAYSSCLLALYWGITSNLLYKPTQEITNNAGFSIGHQQQVASWIAYKIAPYLGDRSENINSLKLSKWLVLLNNYVISTAIVMIFFWGIALLSLGIDTVQTMAGKTHWTLYILETGLLFAVGIAIIMQGVSMFVKELTSSFRGISTSLIPGAILAIDCSAIYGFAPNALIWGFIWGAIGQISTILVMLFFHSPILIVPGFIPMFFSNATIGIFANHYGGWRAASKICFVMGVIEILGSIWAIQLAKTDSWMGMADWSLIAPLIMQGFKLTHFFIIPIGLLSVIYMVYARRTLDDKQSNSNHHE
MVFFAHCFSFFHSQILTKPAFMLGLIVMLGNILLSKKITTVISSTIQTIVGFLLLRVGADILVKKSKAIITKISVIHHIDGSIIDPYVFMFSCITSLGDKYNFVGYTVLIAFLLNILMVIFRHLTGIRTIVLNGEVMFQQAGLIFIFFHTALNTEIWQSVAYSSCLLALYWGITSNLLYKPTQEITNNAGFSIGHQQQVASWIAYKIAPYLGDRSENINSLKLSKWLVLLNNYVISTAIVMIFFWGIALLSLGIDTVQTMAGKTHWTLYILETGLLFAVGIAIIMQGVSMFVKELTSSFRGISTSLIPGAILAIDCSAIYGFAPNALIWGFIWGAIGQISTILVMLFFHSPILIVPGFIPMFFSNATIGIFANHYGGWRAASKICFVMGVIEILGSIWAIQLAKTDSWMGMADWSLIAPLIMQGFKLTHFFIIPIGLLSVIYMVYARRTLDDKQSNSNHHE

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target461 ascorbate-specific PTS system enzyme IIC/IIB [Candidatu
315122560457 PTS system ascorbate-specific transporter subunit IIC [ 1 0.0
320159319 586 ascorbate-specific PTS system, EIIC component [Vibrio v 1 1e-150
27367470 586 PTS system ascorbate-specific transporter subunits IICB 1 1e-150
261346717 591 putative PTS system, membrane component [Providencia ru 1 1e-150
37677264 586 ascorbate-specific PTS system enzyme IIC/IIB [Vibrio vu 1 1e-150
268593236 584 putative PTS system, sugar-specific IIC component [Prov 1 1e-149
330447474 585 ulaA domain protein [Photobacterium leiognathi subsp. m 1 1e-149
212712637 587 hypothetical protein PROVALCAL_03732 [Providencia alcal 1 1e-149
269959503 586 hypothetical protein VME_02690 [Vibrio harveyi 1DA3] Le 1 1e-149
149187854 586 ascorbate-specific PTS system enzyme IIC/IIB [Vibrio sh 1 1e-148
>gi|315122560|ref|YP_004063049.1| PTS system ascorbate-specific transporter subunit IIC [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 457 Back     alignment and organism information
 Score =  743 bits (1917), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/455 (81%), Positives = 413/455 (90%)

Query: 1   MVFFAHCFSFFHSQILTKPAFMLGLIVMLGNILLSKKITTVISSTIQTIVGFLLLRVGAD 60
           M F  + FSFFH QILTKP+FMLG+IVMLGNILL KKI  +ISSTIQTIVGFLLLRVGAD
Sbjct: 1   MPFIENFFSFFHHQILTKPSFMLGIIVMLGNILLGKKIIFIISSTIQTIVGFLLLRVGAD 60

Query: 61  ILVKKSKAIITKISVIHHIDGSIIDPYVFMFSCITSLGDKYNFVGYTVLIAFLLNILMVI 120
           ILV KSKAIITKIS+IHHIDG IIDPYVFMFSCI SLG+KY+FVGYTVLIAF+LNILMVI
Sbjct: 61  ILVNKSKAIITKISIIHHIDGLIIDPYVFMFSCIASLGEKYSFVGYTVLIAFMLNILMVI 120

Query: 121 FRHLTGIRTIVLNGEVMFQQAGLIFIFFHTALNTEIWQSVAYSSCLLALYWGITSNLLYK 180
            R LTGIRTI+LNGEVMFQQAGLIFIFFH AL T+IWQSVAYSSCLLALYWGITSN+LYK
Sbjct: 121 LRRLTGIRTIILNGEVMFQQAGLIFIFFHIALQTDIWQSVAYSSCLLALYWGITSNILYK 180

Query: 181 PTQEITNNAGFSIGHQQQVASWIAYKIAPYLGDRSENINSLKLSKWLVLLNNYVISTAIV 240
           PTQEITNNAGFSIGHQQQVASW+AYKIAPYLG++SENINSLKLSKWL+L NNYVI+T IV
Sbjct: 181 PTQEITNNAGFSIGHQQQVASWLAYKIAPYLGNKSENINSLKLSKWLLLFNNYVIATGIV 240

Query: 241 MIFFWGIALLSLGIDTVQTMAGKTHWTLYILETGLLFAVGIAIIMQGVSMFVKELTSSFR 300
           M  FWG+ALLSLG D +Q MAGKTHWTLYILETG+LF+VGI IIMQGVSMFVKELT SF+
Sbjct: 241 MTLFWGVALLSLGTDVIQEMAGKTHWTLYILETGMLFSVGIVIIMQGVSMFVKELTISFK 300

Query: 301 GISTSLIPGAILAIDCSAIYGFAPNALIWGFIWGAIGQISTILVMLFFHSPILIVPGFIP 360
           GIS SLIPGAILAIDCSAIYGFAPNALIWGF+WGAIGQIS I +M+FF   +LI+PGFIP
Sbjct: 301 GISQSLIPGAILAIDCSAIYGFAPNALIWGFLWGAIGQISAIFMMIFFRFSLLIIPGFIP 360

Query: 361 MFFSNATIGIFANHYGGWRAASKICFVMGVIEILGSIWAIQLAKTDSWMGMADWSLIAPL 420
           MFFSNATIGIFANHYGGWRAAS ICF MG+IEILGS+WA++LAKTDSWMGMADWSL+AP 
Sbjct: 361 MFFSNATIGIFANHYGGWRAASIICFFMGIIEILGSVWALKLAKTDSWMGMADWSLLAPF 420

Query: 421 IMQGFKLTHFFIIPIGLLSVIYMVYARRTLDDKQS 455
           IMQGF+ + FFII I L +++YM +ARR L+ ++ 
Sbjct: 421 IMQGFQWSRFFIIFILLFAIVYMFHARRQLNHEKR 455


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|320159319|ref|YP_004191697.1| ascorbate-specific PTS system, EIIC component [Vibrio vulnificus MO6-24/O] Length = 586 Back     alignment and organism information
>gi|27367470|ref|NP_762997.1| PTS system ascorbate-specific transporter subunits IICB [Vibrio vulnificus CMCP6] Length = 586 Back     alignment and organism information
>gi|261346717|ref|ZP_05974361.1| putative PTS system, membrane component [Providencia rustigianii DSM 4541] Length = 591 Back     alignment and organism information
>gi|37677264|ref|NP_937660.1| ascorbate-specific PTS system enzyme IIC/IIB [Vibrio vulnificus YJ016] Length = 586 Back     alignment and organism information
>gi|268593236|ref|ZP_06127457.1| putative PTS system, sugar-specific IIC component [Providencia rettgeri DSM 1131] Length = 584 Back     alignment and organism information
>gi|330447474|ref|ZP_08311122.1| ulaA domain protein [Photobacterium leiognathi subsp. mandapamensis svers.1.1.] Length = 585 Back     alignment and organism information
>gi|212712637|ref|ZP_03320765.1| hypothetical protein PROVALCAL_03732 [Providencia alcalifaciens DSM 30120] Length = 587 Back     alignment and organism information
>gi|269959503|ref|ZP_06173885.1| hypothetical protein VME_02690 [Vibrio harveyi 1DA3] Length = 586 Back     alignment and organism information
>gi|149187854|ref|ZP_01866150.1| ascorbate-specific PTS system enzyme IIC/IIB [Vibrio shilonii AK1] Length = 586 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target461 ascorbate-specific PTS system enzyme IIC/IIB [Candidatu
PRK09548 602 PRK09548, PRK09548, PTS system ascorbate-specific trans 1e-147
PRK09410452 PRK09410, ulaA, PTS system ascorbate-specific transport 1e-116
PRK12997466 PRK12997, PRK12997, PTS system ascorbate-specific trans 4e-95
COG3037481 COG3037, SgaT, Uncharacterized protein conserved in bac 1e-101
pfam03611406 pfam03611, EIIC-GAT, PTS system sugar-specific permease 8e-80
PRK12996463 PRK12996, ulaA, PTS system ascorbate-specific transport 1e-31
>gnl|CDD|181943 PRK09548, PRK09548, PTS system ascorbate-specific transporter subunits IICB; Provisional Back     alignment and domain information
>gnl|CDD|181830 PRK09410, ulaA, PTS system ascorbate-specific transporter subunit IIC; Reviewed Back     alignment and domain information
>gnl|CDD|183834 PRK12997, PRK12997, PTS system ascorbate-specific transporter subunit IIC; Reviewed Back     alignment and domain information
>gnl|CDD|32851 COG3037, SgaT, Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>gnl|CDD|146314 pfam03611, EIIC-GAT, PTS system sugar-specific permease component Back     alignment and domain information
>gnl|CDD|171824 PRK12996, ulaA, PTS system ascorbate-specific transporter subunit IIC; Reviewed Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 461 ascorbate-specific PTS system enzyme IIC/IIB [Candidatu
PRK09548 602 ascorbate-specific PTS system enzyme IIC/IIB; Provision 100.0
PRK12997472 ascorbate-specific PTS system enzyme IIC; Reviewed 100.0
PRK12996463 ulaA ascorbate-specific PTS system enzyme IIC; Reviewed 100.0
PRK09410450 ulaA ascorbate-specific PTS system enzyme IIC; Reviewed 100.0
COG3037481 SgaT Uncharacterized protein conserved in bacteria [Fun 100.0
pfam04215425 consensus 100.0
pfam03611406 EIIC-GAT PTS system sugar-specific permease component. 100.0
COG3775446 GatC Phosphotransferase system, galactitol-specific IIC 99.18
>PRK09548 ascorbate-specific PTS system enzyme IIC/IIB; Provisional Back     alignment and domain information
>PRK12997 ascorbate-specific PTS system enzyme IIC; Reviewed Back     alignment and domain information
>PRK12996 ulaA ascorbate-specific PTS system enzyme IIC; Reviewed Back     alignment and domain information
>PRK09410 ulaA ascorbate-specific PTS system enzyme IIC; Reviewed Back     alignment and domain information
>COG3037 SgaT Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>pfam04215 consensus Back     alignment and domain information
>pfam03611 EIIC-GAT PTS system sugar-specific permease component Back     alignment and domain information
>COG3775 GatC Phosphotransferase system, galactitol-specific IIC component [Carbohydrate transport and metabolism] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00