254781171

254781171

hypothetical protein CLIBASIA_05390

GeneID in NCBI database:8210196Locus tag:CLIBASIA_05390
Protein GI in NCBI database:254781171Protein Accession:YP_003065584.1
Gene range:+(1167753, 1169015)Protein Length:420aa
Gene description:hypothetical protein
COG prediction:[C] Na+/H+-dicarboxylate symporters
KEGG prediction:hypothetical protein
SEED prediction:Proton/glutamate symport protein, Sodium/glutamate symport protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM11 TM-Helix
TOPPRED10 TM-Helix
HMMTOP11 TM-Helix
MEMSAT10 TM-Helix
MEMSAT_SVM10 TM-Helix
PHOBIUS10 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420
MSLGKMITLDKQQKAYLLYVSSILIGIFSGTTDYVIFNETAEFIVNVFVRIFKFISLPLISLSLIVSLSKCVPEQGMGKLWGKTVFYTMLTTMLAASVALCTYGLISPSNMITKPDVAVNIGKMNFWNYVANLIPNNVVAPFLESQVIGILLISGSIGIATHFITDKHIKSSTIVFFEGIHSIFLTITNWVMKIIPIALGSFIAVTILQFKKGLNISGLGEYLSVVILSNLIQGFIVLPVILYIKGFNPLTIVKGMFPALAVAFFSKSSAGTLPVTMRTAEKNLNISPEVSRSILPFCTSINMNGCAAFICITLIYVMQNNGIEATFSTLFLWILMASVISAIGTAGVPMGCFFLSASLLTNMGIPINIMSMILPFYSIVDMFETTLNVWSDSCVTVIVNKSYPKSSDHPENAIVQNSVE
ccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHccccHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHccc
cccccccccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHccHcHHHHHHHHHHHccEEEEEEHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHccccHHHHHEEcccccHHHHHHcccHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccccEEEEEEcccccEcccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHccHHHHHHHHHcccc
mslgkmitldKQQKAYLLYVSSILIGIFSGTTDYVIFNETAEFIVNVFVRIFKFISLPLISLSLIVSLskcvpeqgmgklwGKTVFYTMLTTMLAASVALCTyglispsnmitkpdvavnIGKMNFWNYVANLipnnvvapfleSQVIGILLISGsigiathfitdkhiksstiVFFEGIHSIFLTITNWVMKIIPIALGSFIAVTILQFKKGLNISGLGEYLSVVILSNLIQGFIVLPVILyikgfnpltivKGMFPALAVAFFskssagtlpvTMRTAeknlnispevsrsilpfctsinmngCAAFICITLIYVMQNNGIEATFSTLFLWILMASVISAIGTAGVPMGCFFLSASLltnmgipinimsmilPFYSIVDMFETTLNVWSDSCVTVIVnksypkssdhpenaivqnsve
mslgkmitLDKQQKAYLLYVSSILIGIFSGTTDYVIFNETAEFIVNVFVRIFKFISLPLISLSLIVSLSKCVPEQGMGKLWGKTVFYTMLTTMLAASVALCTYGLISPSNMITKPDVAVNIGKMNFWNYVANLIPNNVVAPFLESQVIGILLISGSIGIATHFITDKHIKSSTIVFFEGIHSIFLTITNWVMKIIPIALGSFIAVTILQFKKGLNISGLGEYLSVVILSNLIQGFIVLPVILYIKGFNPLTIVKGMFPALAVAFFSKSSAGTLPVTMRTAeknlnispevSRSILPFCTSINMNGCAAFICITLIYVMQNNGIEATFSTLFLWILMASVISAIGTAGVPMGCFFLSASLLTNMGIPINIMSMILPFYSIVDMFETTLNVWSDSCVTVIVNKsypkssdhpenaivqnsve
MSLGKMITLDKQQKAYLLYVSSILIGIFSGTTDYVIFNETAEFIVNVFVRIFKFislplislslivslsKCVPEQGMGKLWGKTVFYTMLTTMLAASVALCTYGLISPSNMITKPDVAVNIGKMNFWNYVANLIPNNVVAPFLESQVigillisgsigiATHFITDKHIKSSTIVFFEGIHSIFLTITNWVMKIIPIALGSFIAVTILQFKKGLNISGLGEYLSVVILSNLIQGFIVLPVILYIKGFNPLTIVKGMFPALAVAFFSKSSAGTLPVTMRTAEKNLNISPEVSRSILPFCTSINMNGCAAFICITLIYVMQNNGIEATFSTLFLWILMASVISAIGTAGVPMGCFFLSASLLTNMGIPINIMSMILPFYSIVDMFETTLNVWSDSCVTVIVNKSYPKSSDHPENAIVQNSVE
*************KAYLLYVSSILIGIFSGTTDYVIFNETAEFIVNVFVRIFKFISLPLISLSLIVSLSKCVPEQGMGKLWGKTVFYTMLTTMLAASVALCTYGLISPSNMI*************FWNYVANLIPNNVVAPFLESQVIGILLISGSIGIATHFITDKHIKSSTIVFFEGIHSIFLTITNWVMKIIPIALGSFIAVTILQFKKGLNISGLGEYLSVVILSNLIQGFIVLPVILYIKGFNPLTIVKGMFPALAVAFFSKSSAGTLPVTMRTAEKNLNISPEVSRSILPFCTSINMNGCAAFICITLIYVMQNNGIEATFSTLFLWILMASVISAIGTAGVPMGCFFLSASLLTNMGIPINIMSMILPFYSIVDMFETTLNVWSDSCVTVIVNKSYP****************
MSLGKMITLDKQQKAYLLYVSSILIGIFSGTTDYVIFNETAEFIVNVFVRIFKFISLPLISLSLIVSLSKCVPEQGMGKLWGKTVFYTMLTTMLAASVALCTYGLISPSNMITKPDVAVNIGKMNFWNYVANLIPNNVVAPFLESQVIGILLISGSIGIATHFITDKHIKSSTIVFFEGIHSIFLTITNWVMKIIPIALGSFIAVTILQFKKGLNISGLGEYLSVVILSNLIQGFIVLPVILYIKGFNPLTIVKGMFPALAVAFFSKSSAGTLPVTMRTAEKNLNISPEVSRSILPFCTSINMNGCAAFICITLIYVMQNNGIEATFSTLFLWILMASVISAIGTAGVPMGCFFLSASLLTNMGIPINIMSMILPFYSIVDMFETTLNVWSDSCVTVIVNKSYPKSSDHPENAIVQNSVE
***GKMITLDKQQKAYLLYVSSILIGIFSGTTDYVIFNETAEFIVNVFVRIFKFISLPLISLSLIVSLSKCVPEQGMGKLWGKTVFYTMLTTMLAASVALCTYGLISPSNMITKPDVAVNIGKMNFWNYVANLIPNNVVAPFLESQVIGILLISGSIGIATHFITDKHIKSSTIVFFEGIHSIFLTITNWVMKIIPIALGSFIAVTILQFKKGLNISGLGEYLSVVILSNLIQGFIVLPVILYIKGFNPLTIVKGMFPALAVAFFSKSSAGTLPVTMRTAEKNLNISPEVSRSILPFCTSINMNGCAAFICITLIYVMQNNGIEATFSTLFLWILMASVISAIGTAGVPMGCFFLSASLLTNMGIPINIMSMILPFYSIVDMFETTLNVWSDSCVTVIVNKSYPKSSDHPENAIVQ****
ooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooHHHHHHHHHHHHHHHHHHHHiiHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHiiiiiHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSLGKMITLDKQQKAYLLYVSSILIGIFSGTTDYVIFNETAEFIVNVFVRIFKFISLPLISLSLIVSLSKCVPEQGMGKLWGKTVFYTMLTTMLAASVALCTYGLISPSNMITKPDVAVNIGKMNFWNYVANLIPNNVVAPFLESQVIGILLISGSIGIATHFITDKHIKSSTIVFFEGIHSIFLTITNWVMKIIPIALGSFIAVTILQFKKGLNISGLGEYLSVVILSNLIQGFIVLPVILYIKGFNPLTIVKGMFPALAVAFFSKSSAGTLPVTMRTAEKNLNISPEVSRSILPFCTSINMNGCAAFICITLIYVMQNNGIEATFSTLFLWILMASVISAIGTAGVPMGCFFLSASLLTNMGIPINIMSMILPFYSIVDMFETTLNVWSDSCVTVIVNKSYPKSSDHPENAIVQNSVE
MSLGKMITLDKQQKAYLLYVSSILIGIFSGTTDYVIFNETAEFIVNVFVRIFKFISLPLISLSLIVSLSKCVPEQGMGKLWGKTVFYTMLTTMLAASVALCTYGLISPSNMITKPDVAVNIGKMNFWNYVANLIPNNVVAPFLESQVIGILLISGSIGIATHFITDKHIKSSTIVFFEGIHSIFLTITNWVMKIIPIALGSFIAVTILQFKKGLNISGLGEYLSVVILSNLIQGFIVLPVILYIKGFNPLTIVKGMFPALAVAFFSKSSAGTLPVTMRTAEKNLNISPEVSRSILPFCTSINMNGCAAFICITLIYVMQNNGIEATFSTLFLWILMASVISAIGTAGVPMGCFFLSASLLTNMGIPINIMSMILPFYSIVDMFETTLNVWSDSCVTVIVNKSYPKSSDHPENAIVQNSVE
MSLGKMITLDKQQKAYLLYVSSILIGIFSGTTDYVIFNETAEFIVNVFVRIFKFISLPLISLSLIVSLSKCVPEQGMGKLWGKTVFYTMLTTMLAASVALCTYGLISPSNMITKPDVAVNIGKMNFWNYVANLIPNNVVAPFLESQVIGILLISGSIGIATHFITDKHIKSSTIVFFEGIHSIFLTITNWVMKIIPIALGSFIAVTILQFKKGLNISGLGEYLSVVILSNLIQGFIVLPVILYIKGFNPLTIVKGMFPALAVAFFSKSSAGTLPVTMRTAEKNLNISPEVSRSILPFCTSINMNGCAAFICITLIYVMQNNGIEATFSTLFLWILMASVISAIGTAGVPMGCFFLSASLLTNMGIPINIMSMILPFYSIVDMFETTLNVWSDSCVTVIVNKSYPKSSDHPENAIVQNSVE

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target420 hypothetical protein CLIBASIA_05390 [Candidatus Liberib
254780387426 C4-dicarboxylate transporter DctA [Candidatus Libe 1e-09
>gi|254780387|ref|YP_003064800.1| C4-dicarboxylate transporter DctA [Candidatus Liberibacter asiaticus str. psy62] Length = 426 Back     alignment
 Score = 56.2 bits (134), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 80/384 (20%), Positives = 173/384 (45%), Gaps = 38/384 (9%)

Query: 46  NVFVRIFKFISLPLISLSLIVSLSKCVPEQGMGKLWGKTVFYTMLTTMLAASVALCTYGL 105
           ++FV+  K +  P+I L++   +++    + +G+++ K +F   + +M A  + L     
Sbjct: 49  DIFVKTTKMLITPVIFLTVSTGIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIV--- 105

Query: 106 ISPSNMITKPDVAVNIG----------------KMNFWNYVANLIPNNVVAPFLESQVIG 149
                 I KP + +N+                   +F  ++ ++IP+  ++      ++ 
Sbjct: 106 ----GNIAKPGIGMNVDLKSLNTESIAHIKSSHAKSFIGFMQDMIPDTALSALTSGNILQ 161

Query: 150 ILLISGSIGIATHFITDKHIKSSTIV-FFEGIHSIFLTITNWVMKIIPIALGSFIAVTIL 208
            L+++   GI+   + +   KS TI    E I+     + + VM+I P  LG+F A++  
Sbjct: 162 TLIVALLFGISLSLVGE---KSDTIRKCLEEINFPVFRMVSIVMRIAP--LGAFGAMSFT 216

Query: 209 QFKKGLNISGLGEYLSVVILSNLIQGFIVLPVILYIKGFNPLTIVKGMF---PALAVAFF 265
             K GL  S +   + +V        F +L V+  +  F   +I+K +      + +   
Sbjct: 217 IGKYGL--SSISNLIFLVFCLYATSAFFILGVLGILARFCRFSIIKLIIFLKEEVLLVLS 274

Query: 266 SKSSAGTLPVTMRTAEKNLNISPEVSRSILPFCTSINMNGCAAFICITLIYVMQNNGIEA 325
           + SS   LP  M+  E+       +   ++P   S N++G   +I +  +++ Q   +  
Sbjct: 275 TSSSESALPGLMKKMEEA-GCHRSIVSMVVPTGYSFNLDGSNIYITLATLFISQATNVPL 333

Query: 326 TFSTLFLWILMASVISAIGTAGVPMGCFF-LSASLLTNMGIPINIMSMILPFYSIVDMFE 384
           + +   L +L+ +++S+ G AGV    F  L+A++     +PI  M++IL     +    
Sbjct: 334 SLTDQ-LSLLLIAMVSSKGAAGVTGSAFITLAATITLVPSLPIAGMTLILGVDRFMSECR 392

Query: 385 TTLNVWSDSCVTVIVNKSYPKSSD 408
           +  N   ++ +TV+V++ + K  D
Sbjct: 393 SVTNFIGNAVMTVVVSR-WEKKLD 415

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target420 hypothetical protein CLIBASIA_05390 [Candidatus Liberib
315122563420 hypothetical protein CKC_04075 [Candidatus Liberibacter 1 0.0
270159406425 sodium:dicarboxylate symporter family protein [Legionel 1 1e-108
52841121426 hypothetical protein lpg0886 [Legionella pneumophila su 1 1e-106
296106465426 Na /H -dicarboxylate symporter [Legionella pneumophila 1 1e-106
54293861426 hypothetical protein lpl0917 [Legionella pneumophila st 1 1e-106
148360468426 hypothetical protein LPC_2407 [Legionella pneumophila s 1 1e-106
254495606426 conserved hypothetical protein [Legionella drancourtii 1 1e-104
323143463422 transporter, dicarboxylate/amino acid:cation Na+/H+ sym 1 9e-94
260888580436 sodium:dicarboxylate symporter family protein [Selenomo 1 2e-89
303257795418 sodium:dicarboxylate symporter family protein [Burkhold 1 2e-89
>gi|315122563|ref|YP_004063052.1| hypothetical protein CKC_04075 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 420 Back     alignment and organism information
 Score =  637 bits (1644), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/420 (73%), Positives = 366/420 (87%), Gaps = 1/420 (0%)

Query: 1   MSLGKMITLDKQQKAYLLYVSSILIGIFSGTTDYVIFNETAEFIVNVFVRIFKFISLPLI 60
           M L  +ITL+KQQK Y  Y+SSILIGIF GTTDYVIFN+ AE IVN+F+R+FKFISLPLI
Sbjct: 1   MFLRNIITLNKQQKTYFFYISSILIGIFLGTTDYVIFNDIAEVIVNIFIRLFKFISLPLI 60

Query: 61  SLSLIVSLSKCVPEQGMGKLWGKTVFYTMLTTMLAASVALCTYGLISPSNMITKPDVAVN 120
           SLSLIVSLSKC+PEQGM +LW +TVFYT+LTTMLAAS+AL  Y +ISPSN+I KPD  V 
Sbjct: 61  SLSLIVSLSKCIPEQGMIRLWKRTVFYTILTTMLAASLALLIYKIISPSNIIIKPDNTVA 120

Query: 121 IGKMNFWNYVANLIPNNVVAPFLESQVIGILLISGSIGIATHFITDKHIKSSTIVFFEGI 180
           +GK+++  ++ NLIPNN ++PFLE+QV+G+LLISGSIGIA HFITDK+IK++ I+FFEG+
Sbjct: 121 MGKISYLQHLVNLIPNNFLSPFLENQVMGVLLISGSIGIAIHFITDKNIKNNVIIFFEGM 180

Query: 181 HSIFLTITNWVMKIIPIALGSFIAVTILQFKKGLNISGLGEYLSVVILSNLIQGFIVLPV 240
           HSI LTIT W+M+IIPIA+  F+AVTILQFK+GLNISGLGEYLS++ILSNLIQG ++LP+
Sbjct: 181 HSISLTITRWIMRIIPIAMSGFVAVTILQFKQGLNISGLGEYLSIIILSNLIQGIVILPI 240

Query: 241 ILYIKGFNPLTIVKGMFPALAVAFFSKSSAGTLPVTMRTAEKNLNISPEVSRSILPFCTS 300
           ILYI G NPL I+KGMFPAL +AFFSKSS GTLP TMR AE+NLN+SP+VSRSILPFCTS
Sbjct: 241 ILYINGHNPLKIIKGMFPALVIAFFSKSSTGTLPATMRCAEQNLNVSPQVSRSILPFCTS 300

Query: 301 INMNGCAAFICITLIYVMQNNGIEATFSTLFLWILMASVISAIGTAGVPMGCFFLSASLL 360
           INMNGCAAFI IT++YVMQNNGIE +   +F W+L+A+ ISA+G AGVPMGCFFLSASLL
Sbjct: 301 INMNGCAAFILITVVYVMQNNGIEMSLGNMFSWVLVAT-ISALGNAGVPMGCFFLSASLL 359

Query: 361 TNMGIPINIMSMILPFYSIVDMFETTLNVWSDSCVTVIVNKSYPKSSDHPENAIVQNSVE 420
           TNMGIPINIMS+ILPFYSIVDM ET+LNVWSDSCVTVIVNK Y  SS    N+I Q+ VE
Sbjct: 360 TNMGIPINIMSIILPFYSIVDMLETSLNVWSDSCVTVIVNKDYSDSSHQNNNSIEQSGVE 419


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|270159406|ref|ZP_06188062.1| sodium:dicarboxylate symporter family protein [Legionella longbeachae D-4968] Length = 425 Back     alignment and organism information
>gi|52841121|ref|YP_094920.1| hypothetical protein lpg0886 [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] Length = 426 Back     alignment and organism information
>gi|296106465|ref|YP_003618165.1| Na /H -dicarboxylate symporter [Legionella pneumophila 2300/99 Alcoy] Length = 426 Back     alignment and organism information
>gi|54293861|ref|YP_126276.1| hypothetical protein lpl0917 [Legionella pneumophila str. Lens] Length = 426 Back     alignment and organism information
>gi|148360468|ref|YP_001251675.1| hypothetical protein LPC_2407 [Legionella pneumophila str. Corby] Length = 426 Back     alignment and organism information
>gi|254495606|ref|ZP_05108528.1| conserved hypothetical protein [Legionella drancourtii LLAP12] Length = 426 Back     alignment and organism information
>gi|323143463|ref|ZP_08078146.1| transporter, dicarboxylate/amino acid:cation Na+/H+ symporter family protein [Succinatimonas hippei YIT 12066] Length = 422 Back     alignment and organism information
>gi|260888580|ref|ZP_05899843.1| sodium:dicarboxylate symporter family protein [Selenomonas sputigena ATCC 35185] Length = 436 Back     alignment and organism information
>gi|303257795|ref|ZP_07343805.1| sodium:dicarboxylate symporter family protein [Burkholderiales bacterium 1_1_47] Length = 418 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target420 hypothetical protein CLIBASIA_05390 [Candidatus Liberib
COG1301415 COG1301, GltP, Na+/H+-dicarboxylate symporters [Energy 5e-53
KOG3787507 KOG3787, KOG3787, KOG3787, Glutamate/aspartate and neut 9e-39
COG1823458 COG1823, COG1823, Predicted Na+/dicarboxylate symporter 5e-26
PRK11283437 PRK11283, gltP, glutamate/aspartate:proton symporter; P 1e-18
COG3633407 COG3633, SstT, Na+/serine symporter [Amino acid transpo 2e-15
PRK13027421 PRK13027, PRK13027, C4-dicarboxylate transporter DctA; 3e-10
pfam00375387 pfam00375, SDF, Sodium:dicarboxylate symporter family 3e-69
PRK01663428 PRK01663, PRK01663, C4-dicarboxylate transporter DctA; 1e-11
PRK13628402 PRK13628, PRK13628, serine/threonine transporter SstT; 2e-11
PRK14695319 PRK14695, PRK14695, serine/threonine transporter SstT; 5e-09
>gnl|CDD|31492 COG1301, GltP, Na+/H+-dicarboxylate symporters [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|38991 KOG3787, KOG3787, KOG3787, Glutamate/aspartate and neutral amino acid transporters [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|32008 COG1823, COG1823, Predicted Na+/dicarboxylate symporter [General function prediction only] Back     alignment and domain information
>gnl|CDD|183075 PRK11283, gltP, glutamate/aspartate:proton symporter; Provisional Back     alignment and domain information
>gnl|CDD|33431 COG3633, SstT, Na+/serine symporter [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|183850 PRK13027, PRK13027, C4-dicarboxylate transporter DctA; Reviewed Back     alignment and domain information
>gnl|CDD|144095 pfam00375, SDF, Sodium:dicarboxylate symporter family Back     alignment and domain information
>gnl|CDD|179317 PRK01663, PRK01663, C4-dicarboxylate transporter DctA; Reviewed Back     alignment and domain information
>gnl|CDD|184190 PRK13628, PRK13628, serine/threonine transporter SstT; Provisional Back     alignment and domain information
>gnl|CDD|173158 PRK14695, PRK14695, serine/threonine transporter SstT; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 420 hypothetical protein CLIBASIA_05390 [Candidatus Liberib
PRK11283436 gltP glutamate/aspartate:proton symporter; Provisional 100.0
PRK13027442 C4-dicarboxylate transporter DctA; Reviewed 100.0
PRK01663428 C4-dicarboxylate transporter DctA; Reviewed 100.0
COG1301415 GltP Na+/H+-dicarboxylate symporters [Energy production 100.0
pfam00375387 SDF Sodium:dicarboxylate symporter family. 100.0
KOG3787507 consensus 100.0
PRK13628402 serine/threonine transporter SstT; Provisional 100.0
COG1823458 Predicted Na+/dicarboxylate symporter [General function 100.0
COG3633407 SstT Na+/serine symporter [Amino acid transport and met 100.0
PRK13027442 C4-dicarboxylate transporter DctA; Reviewed 96.69
PRK01663428 C4-dicarboxylate transporter DctA; Reviewed 96.29
>PRK11283 gltP glutamate/aspartate:proton symporter; Provisional Back     alignment and domain information
>PRK13027 C4-dicarboxylate transporter DctA; Reviewed Back     alignment and domain information
>PRK01663 C4-dicarboxylate transporter DctA; Reviewed Back     alignment and domain information
>COG1301 GltP Na+/H+-dicarboxylate symporters [Energy production and conversion] Back     alignment and domain information
>pfam00375 SDF Sodium:dicarboxylate symporter family Back     alignment and domain information
>KOG3787 consensus Back     alignment and domain information
>PRK13628 serine/threonine transporter SstT; Provisional Back     alignment and domain information
>COG1823 Predicted Na+/dicarboxylate symporter [General function prediction only] Back     alignment and domain information
>COG3633 SstT Na+/serine symporter [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13027 C4-dicarboxylate transporter DctA; Reviewed Back     alignment and domain information
>PRK01663 C4-dicarboxylate transporter DctA; Reviewed Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target420 hypothetical protein CLIBASIA_05390 [Candidatus Liberib
1xfh_A422 Structure Of Glutamate Transporter Homolog From Pyr 1e-54
3kbc_A425 Crystal Structure Of Gltph K55c-A364c Mutant Crossl 8e-54
2nwl_A422 Crystal Structure Of Gltph In Complex With L-Asp Le 1e-52
>gi|56554522|pdb|1XFH|A Chain A, Structure Of Glutamate Transporter Homolog From Pyrococcus Horikoshii Length = 422 Back     alignment and structure
 Score =  218 bits (555), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 101/408 (24%), Positives = 189/408 (46%), Gaps = 20/408 (4%)

Query: 13  QKAYLLYVSSILIGIFSGTT-DYVIFNETAEFIVNVFVRIFKFISLPLISLSLIVSLSKC 71
           QK  +  +   ++G+  G        +   +   ++FVR+ K + +P++  SL+V  +  
Sbjct: 14  QKILIGLILGAIVGLILGHYGYAHAVHTYVKPFGDLFVRLLKMLVMPIVFASLVVGAASI 73

Query: 72  VPEQGMGKLWGKTVFYTMLTTMLAASVALCTYGLISPSNMITKP---DVAVNIGKMNFWN 128
                +G++  K V Y +LT+  A ++ +    L +P   I                  +
Sbjct: 74  -SPARLGRVGVKIVVYYLLTSAFAVTLGIIMARLFNPGAGIHLAVGGQQFQPHQAPPLVH 132

Query: 129 YVANLIPNNVVAPFLESQVIGILLISGSIGIATHFITD------KHIKSSTIVFFEGIHS 182
            + +++P N        QV+  +  +  +GIA  ++ +      +    + +    G+  
Sbjct: 133 ILLDIVPTNPFGALANGQVLPTIFFAIILGIAITYLMNSENEKVRKSAETLLDAINGLAE 192

Query: 183 IFLTITNWVMKIIPIALGSFIAVTILQFKKGLNISGLGEYLSVVILSNLIQGFIVLPVIL 242
               I N VM+  PI + + IA  + +      +  L +  + V +   +Q  +V  V+L
Sbjct: 193 AMYKIVNGVMQYAPIGVFALIAYVMAEQGV-HVVGELAKVTAAVYVGLTLQILLVYFVLL 251

Query: 243 YIKGFNPLTIVKGMFPALAVAFFSKSSAGTLPVTMRTAEKNLNISPEVSRSILPFCTSIN 302
            I G +P++ +K    A+  AF ++SS+GTLPVTMR A++ + IS  +    LP   +IN
Sbjct: 252 KIYGIDPISFIKHAKDAMLTAFVTRSSSGTLPVTMRVAKE-MGISEGIYSFTLPLGATIN 310

Query: 303 MNGCAAFICITLIYVMQNNGIEATFSTLFLWILMASVISAIGTAGVPMGCFFLSASLLTN 362
           M+G A +  +   ++    G   T     L I++ +V+++IGTAGVP     + A +L +
Sbjct: 311 MDGTALYQGVCTFFIANALGSHLTVGQQ-LTIVLTAVLASIGTAGVPGAGAIMLAMVLHS 369

Query: 363 MGIPI------NIMSMILPFYSIVDMFETTLNVWSDSCVTVIVNKSYP 404
           +G+P+         +MIL   +I+DM  T +NV  D   T IV K+  
Sbjct: 370 VGLPLTDPNVAAAYAMILGIDAILDMGRTMVNVTGDLTGTAIVAKTEG 417


>gi|270047765|pdb|3KBC|A Chain A, Crystal Structure Of Gltph K55c-A364c Mutant Crosslinked With Divalent Mercury Length = 425 Back     alignment and structure
>gi|134104970|pdb|2NWL|A Chain A, Crystal Structure Of Gltph In Complex With L-Asp Length = 422 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target420 hypothetical protein CLIBASIA_05390 [Candidatus Liberib
2nwl_A422 GLTPH, glutamate symport protein; alpha helical, membra 7e-36
>2nwl_A GLTPH, glutamate symport protein; alpha helical, membrane protein, helical hairpin, unwound region, transport protein; HET: PLM; 2.96A {Pyrococcus horikoshii} PDB: 2nww_A* 1xfh_A* 2nwx_A* Length = 422 Back     alignment and structure
 Score =  146 bits (370), Expect = 7e-36
 Identities = 101/396 (25%), Positives = 186/396 (46%), Gaps = 20/396 (5%)

Query: 23  ILIGIFSGTTDYV-IFNETAEFIVNVFVRIFKFISLPLISLSLIVSLSKCVPEQGMGKLW 81
            ++G+  G   Y    +   +   ++FVR+ K + +P++  SL+V  +   P + +G++ 
Sbjct: 24  AIVGLILGHYGYAHAVHTYVKPFGDLFVRLLKMLVMPIVFASLVVGAASISPAR-LGRVG 82

Query: 82  GKTVFYTMLTTMLAASVALCTYGLISPSNMIT---KPDVAVNIGKMNFWNYVANLIPNNV 138
            K V Y +LT+  A ++ +    L +P   I                  + + +++P N 
Sbjct: 83  VKIVVYYLLTSAFAVTLGIIMARLFNPGAGIHLAVGGQQFQPHQAPPLVHILLDIVPTNP 142

Query: 139 VAPFLESQVIGILLISGSIGIATHFITDK------HIKSSTIVFFEGIHSIFLTITNWVM 192
                  QV+  +  +  +GIA  ++ +           + +    G+      I N VM
Sbjct: 143 FGALANGQVLPTIFFAIILGIAITYLMNSENEKVRKSAETLLDAINGLAEAMYKIVNGVM 202

Query: 193 KIIPIALGSFIAVTILQFKKGLNISGLGEYLSVVILSNLIQGFIVLPVILYIKGFNPLTI 252
           +  PI + + IA  + +    + +  L +  + V +   +Q  +V  V+L I G +P++ 
Sbjct: 203 QYAPIGVFALIAYVMAEQGVHV-VGELAKVTAAVYVGLTLQILLVYFVLLKIYGIDPISF 261

Query: 253 VKGMFPALAVAFFSKSSAGTLPVTMRTAEKNLNISPEVSRSILPFCTSINMNGCAAFICI 312
           +K    A+  AF ++SS+GTLPVTMR A++ + IS  +    LP   +INM+G A +  +
Sbjct: 262 IKHAKDAMLTAFVTRSSSGTLPVTMRVAKE-MGISEGIYSFTLPLGATINMDGTALYQGV 320

Query: 313 TLIYVMQNNGIEATFSTLFLWILMASVISAIGTAGVPMGCFFLSASLLTNMGIPINI--- 369
              ++    G   T       +L A V+++IGTAGVP     + A +L ++G+P+     
Sbjct: 321 CTFFIANALGSHLTVGQQLTIVLTA-VLASIGTAGVPGAGAIMLAMVLHSVGLPLTDPNV 379

Query: 370 ---MSMILPFYSIVDMFETTLNVWSDSCVTVIVNKS 402
               +MIL   +I+DM  T +NV  D   T IV K+
Sbjct: 380 AAAYAMILGIDAILDMGRTMVNVTGDLTGTAIVAKT 415


Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target420 hypothetical protein CLIBASIA_05390 [Candidatus Liberib
2nwl_A422 GLTPH, glutamate symport protein; alpha helical, membra 100.0
>2nwl_A GLTPH, glutamate symport protein; alpha helical, membrane protein, helical hairpin, unwound region, transport protein; HET: PLM; 2.96A {Pyrococcus horikoshii} PDB: 2nww_A* 1xfh_A* 2nwx_A* 3kbc_A Back     alignment and structure
Probab=100.00  E-value=0  Score=635.74  Aligned_cols=402  Identities=25%  Similarity=0.374  Sum_probs=363.5

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHH
Q ss_conf             984564015445449999999999999999996887-----578887878999999999999999999999983253113
Q gi|254781171|r    1 MSLGKMITLDKQQKAYLLYVSSILIGIFSGTTDYVI-----FNETAEFIVNVFVRIFKFISLPLISLSLIVSLSKCVPEQ   75 (420)
Q Consensus         1 m~~~~~~~~~k~~k~~i~l~~~illGi~~G~~~~~~-----~~~~~~~iG~ifi~lLkmiviPLIf~sii~~I~~l~~~~   75 (420)
                      |.++|   ..+|.++..+++.|+++|+++|...+..     ..+|.+++||+|+|++||+++|+||+|++.|++++++ +
T Consensus         1 m~~~~---k~~~~~l~~~ilia~v~Gi~~G~~~~~~~~~~~~~~~l~~~G~lFi~lLkm~vvPlI~~sii~~i~~l~~-~   76 (422)
T 2nwl_A            1 MGLYR---KYIEYPVLIKILIGLILGAIVGLILGHYGYAHAVHTYVKPFGDLFVRLLKMLVMPIVFASLVVGAASISP-A   76 (422)
T ss_dssp             ------------CCCTTHHHHHHHHHHHHHHHHHHTTTHHHHHHHTHHHHHHHHHHHHHHHHHHHHHHHHHHTTSCTT-T
T ss_pred             CCHHH---HHHCCCHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC-H
T ss_conf             92888---7522779999999999999999996542212789999999999999999999999999999999975340-1


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCC---CCCCCCCHHHHHHHHCCCCHHHHHHHHCCCHHHH
Q ss_conf             4665899999999999999999987501234864101100001---2224476898999853664045765511320535
Q gi|254781171|r   76 GMGKLWGKTVFYTMLTTMLAASVALCTYGLISPSNMITKPDVA---VNIGKMNFWNYVANLIPNNVVAPFLESQVIGILL  152 (420)
Q Consensus        76 ~~gki~~~ti~~~~~tt~iA~~igl~~~~l~~Pg~~~~~~~~~---~~~~~~~~~~~l~~liP~Ni~~ala~gniL~iiv  152 (420)
                      +.||++.|++.||+.++++|+.+|+.++.+++||.+.......   ...+..++.|++.+++|+|++++++++|++|+++
T Consensus        77 ~~gri~~k~i~~~~~tt~~a~~lgl~~~~~~~pg~~~~~~~~~~~~~~~~~~~~~~~~~~~ip~Ni~~a~~~~~~l~vi~  156 (422)
T 2nwl_A           77 RLGRVGVKIVVYYLLTSAFAVTLGIIMARLFNPGAGIHLAVGGQQFQPHQAPPLVHILLDIVPTNPFGALANGQVLPTIF  156 (422)
T ss_dssp             THHHHHHHHHHHHHHHHHHHHHHHHHHHHHSCCCCSCCCCCCCCCC-----CCTHHHHGGGSCSCHHHHHHTCCHHHHHH
T ss_pred             HCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHCCCCCCCCHHHHHHHHCCCCHHHHHHCCCCCHHHH
T ss_conf             00107999999999999999999999998438775400121044305534774999999838897799964588630368


Q ss_pred             HHHHHHHHHHHHCCCCC------CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHH
Q ss_conf             56664213774046453------017999999999999999898798977787899999998501121110124689999
Q gi|254781171|r  153 ISGSIGIATHFITDKHI------KSSTIVFFEGIHSIFLTITNWVMKIIPIALGSFIAVTILQFKKGLNISGLGEYLSVV  226 (420)
Q Consensus       153 fai~~Gia~~~~~~k~~------~~~~~~~~~~~~~i~~~ii~~im~l~Pigvf~lia~~~~~~~~~~~l~~l~~~l~~~  226 (420)
                      ||+++|+|+.+.++++.      .+++++++|+++++++|+++|+|+++|+|+|+++++..++++.+ .+..+++|+.++
T Consensus       157 fai~~Gia~~~~~~~~~~~~~~~~~~l~~~~~~~~~v~~~iv~~i~~l~Pigvf~l~a~~~~~~g~~-~l~~l~~~~~~~  235 (422)
T 2nwl_A          157 FAIILGIAITYLMNSENEKVRKSAETLLDAINGLAEAMYKIVNGVMQYAPIGVFALIAYVMAEQGVH-VVGELAKVTAAV  235 (422)
T ss_dssp             HHHHHHHHHHHHHTCSCHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTSHHHHHHHHHHHHHTTTGGG-CCTHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHH-HHHHHHHHHHHH
T ss_conf             9888899999840100366678889999999999999999999999886999999999987302346-788899999999


Q ss_pred             HHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHCCCCC
Q ss_conf             99999999999876644125041100110024788988851765507799999973178998899899999987378850
Q gi|254781171|r  227 ILSNLIQGFIVLPVILYIKGFNPLTIVKGMFPALAVAFFSKSSAGTLPVTMRTAEKNLNISPEVSRSILPFCTSINMNGC  306 (420)
Q Consensus       227 ~~~~~i~~~v~~~~i~~~~~~np~~~~k~~~~~~~~Af~T~SS~atlP~~l~~~~~~lgv~~~i~~fviPlG~tinm~G~  306 (420)
                      ++++++|.+++++++.+++|+||++|+|+.+|++++||+|+||+||+|+++||+| |+|+||++++|++|+|+|+|||||
T Consensus       236 ~~~~~l~~~~~~~l~~~~~~~~p~~~~~~~~~~~~~Af~T~SS~atlP~~l~~~~-~~gv~~~i~~fvlPlg~t~n~~G~  314 (422)
T 2nwl_A          236 YVGLTLQILLVYFVLLKIYGIDPISFIKHAKDAMLTAFVTRSSSGTLPVTMRVAK-EMGISEGIYSFTLPLGATINMDGT  314 (422)
T ss_dssp             HHHHHHHHHHTHHHHHHHTTCCHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHH-TTTCCHHHHHHHHHHHTTSCCHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHH-HCCCCHHHCCEECCCHHHCCCCCH
T ss_conf             9999999999999999995888898898999999999971563214579999999-859783334531563110268845


Q ss_pred             HHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCH------HHHHHHHHHHHHH
Q ss_conf             5677999999742369788956799999999999842138864159999999997549999------9999999657764
Q gi|254781171|r  307 AAFICITLIYVMQNNGIEATFSTLFLWILMASVISAIGTAGVPMGCFFLSASLLTNMGIPI------NIMSMILPFYSIV  380 (420)
Q Consensus       307 ai~~~~~~~f~a~~~gi~l~~~~~~~~i~~~~v~as~g~~gvPg~~~v~~~~vl~~~glP~------~~~~lli~id~i~  380 (420)
                      |+|++++++|++|.||++++.+++. .+++.++++|+|++|+|||+++.+..+++.+|+|.      +++++++++||++
T Consensus       315 al~~~~~~if~a~~~g~~lt~~~~~-~~~~~~~l~s~g~~gvPg~~~v~~~~vl~~~glP~~~~~~~~~i~liiaid~l~  393 (422)
T 2nwl_A          315 ALYQGVCTFFIANALGSHLTVGQQL-TIVLTAVLASIGTAGVPGAGAIMLAMVLHSVGLPLTDPNVAAAYAMILGIDAIL  393 (422)
T ss_dssp             HHHHHHHHHHHHHHHTCCCCSSCCH-HHHHHHHHHHHHSCSSSSHHHHHHHHHHHHHTCCTTSTTHHHHHHHHHTTHHHH
T ss_pred             HHHHHHHHHHHHHHHCCCCCHHHHH-HHHHHHHHHHHHCCCCCHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHC
T ss_conf             8999999999999948999989999-999999999984478616799999999998499876411566899999798660


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             15678999877899999999873000134
Q gi|254781171|r  381 DMFETTLNVWSDSCVTVIVNKSYPKSSDH  409 (420)
Q Consensus       381 D~~rT~~NV~gd~~~a~iv~~~~~~~~~~  409 (420)
                      ||+||++||+||++++.+++|+|++.|++
T Consensus       394 D~~rT~~NV~gd~~~a~iv~k~~g~ld~~  422 (422)
T 2nwl_A          394 DMGRTMVNVTGDLTGTAIVAKTEGTLVPR  422 (422)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHC------
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHCCCCCC
T ss_conf             66189994987899999999973888899




Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 420 hypothetical protein CLIBASIA_05390 [Candidatus Liberib
d2nwwa1405 f.49.1.1 (A:12-416) Proton glutamate symport protein {P 2e-34
>d2nwwa1 f.49.1.1 (A:12-416) Proton glutamate symport protein {Pyrococcus horikoshii [TaxId: 53953]} Length = 405 Back     information, alignment and structure

class: Membrane and cell surface proteins and peptides
fold: Proton glutamate symport protein
superfamily: Proton glutamate symport protein
family: Proton glutamate symport protein
domain: Proton glutamate symport protein
species: Pyrococcus horikoshii [TaxId: 53953]
 Score =  140 bits (354), Expect = 2e-34
 Identities = 100/396 (25%), Positives = 184/396 (46%), Gaps = 20/396 (5%)

Query: 23  ILIGIFSGTTDYV-IFNETAEFIVNVFVRIFKFISLPLISLSLIVSLSKCVPEQGMGKLW 81
            ++G+  G   Y    +   +   ++FVR+ K + +P++  SL+V  +   P + +G++ 
Sbjct: 13  AIVGLILGHYGYAHAVHTYVKPFGDLFVRLLKMLVMPIVFASLVVGAASISPAR-LGRVG 71

Query: 82  GKTVFYTMLTTMLAASVALCTYGLISPSNMIT---KPDVAVNIGKMNFWNYVANLIPNNV 138
            K V Y +LT+  A ++ +    L +P   I                  + + +++P N 
Sbjct: 72  VKIVVYYLLTSAFAVTLGIIMARLFNPGAGIHLAVGGQQFQPHQAPPLVHILLDIVPTNP 131

Query: 139 VAPFLESQVIGILLISGSIGIATHFITDK------HIKSSTIVFFEGIHSIFLTITNWVM 192
                  QV+  +  +  +GIA  ++ +           + +    G+      I N VM
Sbjct: 132 FGALANGQVLPTIFFAIILGIAITYLMNSENEKVRKSAETLLDAINGLAEAMYKIVNGVM 191

Query: 193 KIIPIALGSFIAVTILQFKKGLNISGLGEYLSVVILSNLIQGFIVLPVILYIKGFNPLTI 252
           +  PI + + IA  + +    +      +  + V +   +Q  +V  V+L I G +P++ 
Sbjct: 192 QYAPIGVFALIAYVMAEQGVHVVGEL-AKVTAAVYVGLTLQILLVYFVLLKIYGIDPISF 250

Query: 253 VKGMFPALAVAFFSKSSAGTLPVTMRTAEKNLNISPEVSRSILPFCTSINMNGCAAFICI 312
           +K    A+  AF ++SS+GTLPVTMR A++ + IS  +    LP   +INM+G A +  +
Sbjct: 251 IKHAKDAMLTAFVTRSSSGTLPVTMRVAKE-MGISEGIYSFTLPLGATINMDGTALYQGV 309

Query: 313 TLIYVMQNNGIEATFSTLFLWILMASVISAIGTAGVPMGCFFLSASLLTNMGIPINI--- 369
              ++    G   T       +L A V+++IGTAGVP     + A +L ++G+P+     
Sbjct: 310 CTFFIANALGSHLTVGQQLTIVLTA-VLASIGTAGVPGAGAIMLAMVLHSVGLPLTDPNV 368

Query: 370 ---MSMILPFYSIVDMFETTLNVWSDSCVTVIVNKS 402
               +MIL   +I+DM  T +NV  D   T IV K+
Sbjct: 369 AAAYAMILGIDAILDMGRTMVNVTGDLTGTAIVAKT 404


Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target420 hypothetical protein CLIBASIA_05390 [Candidatus Liberib
d2nwwa1405 Proton glutamate symport protein {Pyrococcus horikoshii 100.0
>d2nwwa1 f.49.1.1 (A:12-416) Proton glutamate symport protein {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: Proton glutamate symport protein
superfamily: Proton glutamate symport protein
family: Proton glutamate symport protein
domain: Proton glutamate symport protein
species: Pyrococcus horikoshii [TaxId: 53953]
Probab=100.00  E-value=0  Score=623.45  Aligned_cols=387  Identities=26%  Similarity=0.403  Sum_probs=347.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             449999999999999999996-8875788878789999999999999999999999832531134665899999999999
Q gi|254781171|r   13 QKAYLLYVSSILIGIFSGTTD-YVIFNETAEFIVNVFVRIFKFISLPLISLSLIVSLSKCVPEQGMGKLWGKTVFYTMLT   91 (420)
Q Consensus        13 ~k~~i~l~~~illGi~~G~~~-~~~~~~~~~~iG~ifi~lLkmiviPLIf~sii~~I~~l~~~~~~gki~~~ti~~~~~t   91 (420)
                      +|+.++++.|+++|+.+|... .....+|.+++||+|+|+|||+++|+||+|++.|++++++ ++.||++.|++.||+.|
T Consensus         3 ~rili~lv~Gi~~G~~~~~~~~~~~~~~~l~~~g~lFi~lL~m~v~PLIf~sii~gi~~L~~-~~~gkl~~~ti~~~l~t   81 (405)
T d2nwwa1           3 QKILIGLILGAIVGLILGHYGYAHAVHTYVKPFGDLFVRLLKMLVMPIVFASLVVGAASISP-ARLGRVGVKIVVYYLLT   81 (405)
T ss_dssp             SHHHHHHHHHHHHHHHHHTTTTHHHHTTTTHHHHHHHHHHHHHHHHHHHHHHHHTTTCSCTT-TTHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC-HHCCHHHHHHHHHHHHH
T ss_conf             89999999999999997222212789999998999999999999999999999999974550-10020899999999999


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCCCC---CCCCCCCHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHHHHHHHHCCCC
Q ss_conf             999999987501234864101100001---22244768989998536640457655113205355666421377404645
Q gi|254781171|r   92 TMLAASVALCTYGLISPSNMITKPDVA---VNIGKMNFWNYVANLIPNNVVAPFLESQVIGILLISGSIGIATHFITDKH  168 (420)
Q Consensus        92 t~iA~~igl~~~~l~~Pg~~~~~~~~~---~~~~~~~~~~~l~~liP~Ni~~ala~gniL~iivfai~~Gia~~~~~~k~  168 (420)
                      |++|+.+|+.++..++||.+.......   ...+..+..|++.+++|+|++++++++|++|+++||+++|+|+....+++
T Consensus        82 t~iA~~igl~~~~~~~pg~~~~~~~~~~~~~~~~~~~~~~~l~~~iP~Ni~~al~~~~~l~vi~fail~Gial~~~~~~~  161 (405)
T d2nwwa1          82 SAFAVTLGIIMARLFNPGAGIHLAVGGQQFQPHQAPPLVHILLDIVPTNPFGALANGQVLPTIFFAIILGIAITYLMNSE  161 (405)
T ss_dssp             HHHHHHHHHHHHHHSCSCCCCCCCCCCCCCCCCCCCCHHHHHGGGSCSCHHHHHHSCCHHHHHHHHHHHHHHHHHHTTCS
T ss_pred             HHHHHHHHHHHHHHHCCCCCCCCHHHHCCCCCCCCCHHHHHHHHHCCCCHHHHHHCCCCCCHHHHHHHHHHHHHHHCCCC
T ss_conf             99999999999998601333220000000143110018999997055878999646786303567888899999850220


Q ss_pred             C------CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             3------0179999999999999998987989777878999999985011211101246899999999999999987664
Q gi|254781171|r  169 I------KSSTIVFFEGIHSIFLTITNWVMKIIPIALGSFIAVTILQFKKGLNISGLGEYLSVVILSNLIQGFIVLPVIL  242 (420)
Q Consensus       169 ~------~~~~~~~~~~~~~i~~~ii~~im~l~Pigvf~lia~~~~~~~~~~~l~~l~~~l~~~~~~~~i~~~v~~~~i~  242 (420)
                      .      .+++.+++|+++++++|+++|+|+++|+|+|++++..++++|.+. +.++++|+.+++.++++|.+++++++.
T Consensus       162 ~~~~~~~~~~l~~~~~~l~~v~~kii~~im~laPigvf~l~a~~~~~~g~~~-l~~l~~~~~~~~~~~~l~~~~~~~i~~  240 (405)
T d2nwwa1         162 NEKVRKSAETLLDAINGLAEAMYKIVNGVMQYAPIGVFALIAYVMAEQGVHV-VGELAKVTAAVYVGLTLQILLVYFVLL  240 (405)
T ss_dssp             CTTHHHHHHHHHHHHHHHHHHHHHHHHHHTTSHHHHHHHHHHHHHHHTGGGC-CTHHHHHHHHHHHHHHHHHHHTHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             0345667889999999999999999898887778889999998753334555-567899999999999999888889999


Q ss_pred             HHCCCCCCCHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHCCC
Q ss_conf             41250411001100247889888517655077999999731789988998999999873788505677999999742369
Q gi|254781171|r  243 YIKGFNPLTIVKGMFPALAVAFFSKSSAGTLPVTMRTAEKNLNISPEVSRSILPFCTSINMNGCAAFICITLIYVMQNNG  322 (420)
Q Consensus       243 ~~~~~np~~~~k~~~~~~~~Af~T~SS~atlP~~l~~~~~~lgv~~~i~~fviPlG~tinm~G~ai~~~~~~~f~a~~~g  322 (420)
                      +++|+||++|+|+++|++++||+|+||+||+|+++||+| |+|+||++++|++|+|+|+||||+|+|++++++|++|.||
T Consensus       241 ~~~~~~p~~~~~~~~~~~~~Af~T~SS~atlP~~~~~~~-~~gv~~~i~~fvlPlgatin~~G~a~~~~~~~~f~a~~~g  319 (405)
T d2nwwa1         241 KIYGIDPISFIKHAKDAMLTAFVTRSSSGTLPVTMRVAK-EMGISEGIYSFTLPLGATINMDGTALYQGVCTFFIANALG  319 (405)
T ss_dssp             HTTTCCHHHHHHHHHHHHHHHHHHCCTGGGHHHHHHHHH-TTTCCTTTHHHHTTTTSSSCCHHHHHHHHHHHHHHHHHHT
T ss_pred             HHCCCCHHHHHHHCCCHHHEEEECCCCCCCCHHHHHHHH-HCCCCCCCCCEECCCCHHEECCCCHHHHHHHHHHHHHHCC
T ss_conf             982898488843223104212001665566178999999-7599935201023630210036412489999999998719


Q ss_pred             CCCCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCH------HHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             788956799999999999842138864159999999997549999------99999996577641567899987789999
Q gi|254781171|r  323 IEATFSTLFLWILMASVISAIGTAGVPMGCFFLSASLLTNMGIPI------NIMSMILPFYSIVDMFETTLNVWSDSCVT  396 (420)
Q Consensus       323 i~l~~~~~~~~i~~~~v~as~g~~gvPg~~~v~~~~vl~~~glP~------~~~~lli~id~i~D~~rT~~NV~gd~~~a  396 (420)
                      ++++.+++. .+++.++++|+|++|+||++++++..+++++|+|.      |++++++++||++||+||++||+||++++
T Consensus       320 ~~l~~~~~~-~~~~~~~l~s~g~~gvPg~~~v~~~~vl~~~glP~~~~~~~~~i~li~~id~l~D~~rT~~Nv~gd~~~a  398 (405)
T d2nwwa1         320 SHLTVGQQL-TIVLTAVLASIGTAGVPGAGAIMLAMVLHSVGLPLTDPNVAAAYAMILGIDAILDMGRTMVNVTGDLTGT  398 (405)
T ss_dssp             CCCCSSTTH-HHHHHHHHHHHTTSSCTTHHHHHHHHHHHHHTCCTTSHHHHHHHHHHGGGHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCCCHHHHH-HHHHHHHHHHHHCCCCCHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHH
T ss_conf             799989999-9999999999861786167999999999986998864105658888874985505508988287765888


Q ss_pred             HHHHHHH
Q ss_conf             9999873
Q gi|254781171|r  397 VIVNKSY  403 (420)
Q Consensus       397 ~iv~~~~  403 (420)
                      .+++|+|
T Consensus       399 ~iv~k~e  405 (405)
T d2nwwa1         399 AIVAKTE  405 (405)
T ss_dssp             HHHHHHC
T ss_pred             HEEECCC
T ss_conf             4133579



Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 420 hypothetical protein CLIBASIA_05390 [Candidatus Li
2nwl_A_422 (A:) GLTPH, glutamate symport protein; alpha helic 2e-32
>2nwl_A (A:) GLTPH, glutamate symport protein; alpha helical, membrane protein, helical hairpin, unwound region, transport protein; HET: PLM; 2.96A {Pyrococcus horikoshii} PDB: 2nww_A* 1xfh_A* 2nwx_A*Length = 422 Back     alignment and structure
 Score =  134 bits (337), Expect = 2e-32
 Identities = 99/418 (23%), Positives = 186/418 (44%), Gaps = 24/418 (5%)

Query: 5   KMITLDKQQKAYLLYVSSILIGIFSG-----TTDYVIFNETAEFIVNVFVRIFKFISLPL 59
            +     +    +  +  +++G   G            +   +   ++FVR+ K + +P+
Sbjct: 2   GLYRKYIEYPVLIKILIGLILGAIVGLILGHYGYAHAVHTYVKPFGDLFVRLLKMLVMPI 61

Query: 60  ISLSLIVSLSKCVPEQGMGKLWGKTVFYTMLTTMLAASVALCTYGLISPSNMITKPDVAV 119
           +  SL+V  +  +    +G++  K V Y +LT+  A ++ +    L +P   I       
Sbjct: 62  VFASLVVGAAS-ISPARLGRVGVKIVVYYLLTSAFAVTLGIIMARLFNPGAGIHLAVGGQ 120

Query: 120 NIGKMN---FWNYVANLIPNNVVAPFLESQVIGILLISGSIGIATHFI------TDKHIK 170
                      + + +++P N        QV+  +  +  +GIA  ++        +   
Sbjct: 121 QFQPHQAPPLVHILLDIVPTNPFGALANGQVLPTIFFAIILGIAITYLMNSENEKVRKSA 180

Query: 171 SSTIVFFEGIHSIFLTITNWVMKIIPIALGSFIAVTILQFKKGLNISGLGEYLSVVILSN 230
            + +    G+      I N VM+  PI + + IA  + +    +    L +  + V +  
Sbjct: 181 ETLLDAINGLAEAMYKIVNGVMQYAPIGVFALIAYVMAEQGVHVVGE-LAKVTAAVYVGL 239

Query: 231 LIQGFIVLPVILYIKGFNPLTIVKGMFPALAVAFFSKSSAGTLPVTMRTAEKNLNISPEV 290
            +Q  +V  V+L I G +P++ +K    A+  AF ++SS+GTLPVTMR A++   IS  +
Sbjct: 240 TLQILLVYFVLLKIYGIDPISFIKHAKDAMLTAFVTRSSSGTLPVTMRVAKEM-GISEGI 298

Query: 291 SRSILPFCTSINMNGCAAFICITLIYVMQNNGIEATFSTLFLWILMASVISAIGTAGVPM 350
               LP   +INM+G A +  +   ++    G   T       +L A V+++IGTAGVP 
Sbjct: 299 YSFTLPLGATINMDGTALYQGVCTFFIANALGSHLTVGQQLTIVLTA-VLASIGTAGVPG 357

Query: 351 GCFFLSASLLTNMGIPIN------IMSMILPFYSIVDMFETTLNVWSDSCVTVIVNKS 402
               + A +L ++G+P+         +MIL   +I+DM  T +NV  D   T IV K+
Sbjct: 358 AGAIMLAMVLHSVGLPLTDPNVAAAYAMILGIDAILDMGRTMVNVTGDLTGTAIVAKT 415


Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target420 hypothetical protein CLIBASIA_05390 [Candidatus Liberib
2nwl_A_422 GLTPH, glutamate symport protein; alpha helical, m 100.0
2nwl_A_422 GLTPH, glutamate symport protein; alpha helical, m 97.72
>2nwl_A (A:) GLTPH, glutamate symport protein; alpha helical, membrane protein, helical hairpin, unwound region, transport protein; HET: PLM; 2.96A {Pyrococcus horikoshii} PDB: 2nww_A* 1xfh_A* 2nwx_A* Back     alignment and structure
Probab=100.00  E-value=0  Score=612.02  Aligned_cols=401  Identities=24%  Similarity=0.369  Sum_probs=370.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHH
Q ss_conf             64015445449999999999999999996887-----5788878789999999999999999999999832531134665
Q gi|254781171|r    5 KMITLDKQQKAYLLYVSSILIGIFSGTTDYVI-----FNETAEFIVNVFVRIFKFISLPLISLSLIVSLSKCVPEQGMGK   79 (420)
Q Consensus         5 ~~~~~~k~~k~~i~l~~~illGi~~G~~~~~~-----~~~~~~~iG~ifi~lLkmiviPLIf~sii~~I~~l~~~~~~gk   79 (420)
                      ||++..||+++..+++.++++|+++|...+..     ..+|.+++||+|+|++||+++|+||+|++.|+++++ .++.||
T Consensus         2 ~~~~~~~k~sl~~~ilialilGi~lG~~~~~~~~~~~~~~~l~~~G~lfi~lLkm~V~PlVf~sii~~I~~L~-~~~~g~   80 (422)
T 2nwl_A            2 GLYRKYIEYPVLIKILIGLILGAIVGLILGHYGYAHAVHTYVKPFGDLFVRLLKMLVMPIVFASLVVGAASIS-PARLGR   80 (422)
T ss_dssp             --------CCCTTHHHHHHHHHHHHHHHHHHTTTHHHHHHHTHHHHHHHHHHHHHHHHHHHHHHHHHHTTSCT-TTTHHH
T ss_pred             CHHHHHHCCCHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC-CCCCCC
T ss_conf             2888862266999999999999999999543220278999999999999999999999999999999997455-110122


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCC---CCCCCCCCHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHH
Q ss_conf             89999999999999999998750123486410110000---122244768989998536640457655113205355666
Q gi|254781171|r   80 LWGKTVFYTMLTTMLAASVALCTYGLISPSNMITKPDV---AVNIGKMNFWNYVANLIPNNVVAPFLESQVIGILLISGS  156 (420)
Q Consensus        80 i~~~ti~~~~~tt~iA~~igl~~~~l~~Pg~~~~~~~~---~~~~~~~~~~~~l~~liP~Ni~~ala~gniL~iivfai~  156 (420)
                      ++.|++.||+.++.+|+.+|+.++.+++||........   .......+..|.+.+++|+|+++++.++|.+++++++++
T Consensus        81 l~~~~~~~f~~~t~~A~~ig~~~~~~~~pg~~~~~~~~~~~~~~~~~~~~~~~~~~~ip~ni~~~~~~~~~~~~~~~ail  160 (422)
T 2nwl_A           81 VGVKIVVYYLLTSAFAVTLGIIMARLFNPGAGIHLAVGGQQFQPHQAPPLVHILLDIVPTNPFGALANGQVLPTIFFAII  160 (422)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHSCCCCSCCCCCCCCCC-----CCTHHHHGGGSCSCHHHHHHTCCHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHCCCCCCHHHHHHHHHHCCCCHHHHHHCCCCCCHHHHHHH
T ss_conf             79999999999999999999999987601333220010332043210269999998255217988745774303678888


Q ss_pred             HHHHHHHHCC------CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             4213774046------4530179999999999999998987989777878999999985011211101246899999999
Q gi|254781171|r  157 IGIATHFITD------KHIKSSTIVFFEGIHSIFLTITNWVMKIIPIALGSFIAVTILQFKKGLNISGLGEYLSVVILSN  230 (420)
Q Consensus       157 ~Gia~~~~~~------k~~~~~~~~~~~~~~~i~~~ii~~im~l~Pigvf~lia~~~~~~~~~~~l~~l~~~l~~~~~~~  230 (420)
                      +|+++....+      ++.++++.+++|+++++++|+++|+|+++|+|+||++++.++++|.+. +.++++++.+++.++
T Consensus       161 ~gi~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~ii~~ii~l~P~gvf~lia~~~~~~g~~~-l~~l~~~~~~~~~~~  239 (422)
T 2nwl_A          161 LGIAITYLMNSENEKVRKSAETLLDAINGLAEAMYKIVNGVMQYAPIGVFALIAYVMAEQGVHV-VGELAKVTAAVYVGL  239 (422)
T ss_dssp             HHHHHHHHHTCSCHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTSHHHHHHHHHHHHHTTTGGGC-CTHHHHHHHHHHHHH
T ss_pred             HHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHH-HHHHHHHHHHHHHHH
T ss_conf             8999998402210345667889999999999999756887776789999999999874135577-888899999999999


Q ss_pred             HHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHCCCCCHHHH
Q ss_conf             99999998766441250411001100247889888517655077999999731789988998999999873788505677
Q gi|254781171|r  231 LIQGFIVLPVILYIKGFNPLTIVKGMFPALAVAFFSKSSAGTLPVTMRTAEKNLNISPEVSRSILPFCTSINMNGCAAFI  310 (420)
Q Consensus       231 ~i~~~v~~~~i~~~~~~np~~~~k~~~~~~~~Af~T~SS~atlP~~l~~~~~~lgv~~~i~~fviPlG~tinm~G~ai~~  310 (420)
                      .++.+++++++.+++|+||++|+|+.+|++++||+|+||+||+|+++||+|| +|+||++++|++|+|+++||||||+|+
T Consensus       240 ~i~~~v~~~~~~~~~~~np~~~~~~~~~~~~~af~T~SS~atlP~~~~~~~k-~gv~~~v~~~v~Plg~~~n~~G~a~~~  318 (422)
T 2nwl_A          240 TLQILLVYFVLLKIYGIDPISFIKHAKDAMLTAFVTRSSSGTLPVTMRVAKE-MGISEGIYSFTLPLGATINMDGTALYQ  318 (422)
T ss_dssp             HHHHHHTHHHHHHHTTCCHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHT-TTCCHHHHHHHHHHHTTSCCHHHHHHH
T ss_pred             HHHHHHHHHHHHHHCCCCHHHHHHHCCCHHHEEEECCCCCCCHHHHHHHHHH-CCCCCCCCCEECCCCCEECCCCHHHHH
T ss_conf             9999999999999848983888643110143011116665552789999998-499924002024520012057604789


Q ss_pred             HHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCHH------HHHHHHHHHHHHHHHH
Q ss_conf             9999997423697889567999999999998421388641599999999975499999------9999996577641567
Q gi|254781171|r  311 CITLIYVMQNNGIEATFSTLFLWILMASVISAIGTAGVPMGCFFLSASLLTNMGIPIN------IMSMILPFYSIVDMFE  384 (420)
Q Consensus       311 ~~~~~f~a~~~gi~l~~~~~~~~i~~~~v~as~g~~gvPg~~~v~~~~vl~~~glP~~------~~~lli~id~i~D~~r  384 (420)
                      +++++|+||.||++++..|++. +++.+.++|+|++|+||++++....+++.+|+|.|      ++++++++||++||+|
T Consensus       319 ~~~~ifia~~~g~~l~~~~~~~-~~~~~~l~s~g~~gvPg~~~v~~~~v~~~~glp~~~~~~~~~i~li~~id~l~D~~r  397 (422)
T 2nwl_A          319 GVCTFFIANALGSHLTVGQQLT-IVLTAVLASIGTAGVPGAGAIMLAMVLHSVGLPLTDPNVAAAYAMILGIDAILDMGR  397 (422)
T ss_dssp             HHHHHHHHHHHTCCCCSSCCHH-HHHHHHHHHHHSCSSSSHHHHHHHHHHHHHTCCTTSTTHHHHHHHHHTTHHHHHHHH
T ss_pred             HHHHHHHHHHHCCCCCHHHHHH-HHHHHHHHHHHCCCCCHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHCCHHH
T ss_conf             9999999987088999899999-999999999861785067999999999984998764115658888874985516608


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             8999877899999999873000134
Q gi|254781171|r  385 TTLNVWSDSCVTVIVNKSYPKSSDH  409 (420)
Q Consensus       385 T~~NV~gd~~~a~iv~~~~~~~~~~  409 (420)
                      |++||+||++++.+++|+++|+|+|
T Consensus       398 T~~Nv~g~~~~~~iv~~~~~~~~~e  422 (422)
T 2nwl_A          398 TMVNVTGDLTGTAIVAKTEGTLVPR  422 (422)
T ss_dssp             HHHHHHHHHHHHHHHHHHC------
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCCCC
T ss_conf             9994887899999999973887899



>2nwl_A (A:) GLTPH, glutamate symport protein; alpha helical, membrane protein, helical hairpin, unwound region, transport protein; HET: PLM; 2.96A {Pyrococcus horikoshii} PDB: 2nww_A* 1xfh_A* 2nwx_A* Back     alignment and structure