254781215

254781215

putative phage terminase, large subunit

GeneID in NCBI database:8210240Locus tag:CLIBASIA_05610
Protein GI in NCBI database:254781215Protein Accession:YP_003065628.1
Gene range:-(1216261, 1217796)Protein Length:511aa
Gene description:putative phage terminase, large subunit
COG prediction:none
KEGG prediction:putative phage terminase, large subunit
SEED prediction:terminase B protein, putative
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-
MSRELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHSGLIQNLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFGRCPSYQYEGVDLLIERRFEYDSR
cccccccccHHHHHHHHHHHcccEEEEEEEEEEEEEEccccccccccccccccHHHHHHHHHHHHHHHcccccccccccEEEccccccccHHHHHHHHHHHHHHcccccEEEEcccHHHHHHHHHHHHHHHHHHccccccEEEccccEEcccccccEEEEcccccccEEEEEEcccccccHHHcEEcccccEEEEEEEccccccHHHHHHHHHHHccccccEEEEEEEccccccccHHHHHccccccEEEEEEEccccccccHHHHHHHHHHcccccEEEEEEEEccccccccccEEcHHHHHHHHHcccccccccEEEEEEEEccccccccEEEEEcccHHHHHHHHcccHHHHHHHHHHHHHHHHcccEEEEEcccccHHHHHHHHHccEEEEEEccccccccHHHHccHHHHHHHHHHHHHHHcccccccHHHHHHcccccEEcccccEEEEEcccccccccccHHHHHHHHHccccccHHHcccccccccccccEEEEEEccccccc
cccccccccccccccccccHHHHccccccEEEEEcccccccccccccccccHHHHHHHHHHHHHHccccccccccHHEEEEHHccccccHHHHHHHHHHHHHHcccccEEEEEcccHHHHHHHHHHHHHHHHHHHccccEEEEEccccccccccHHEEEEcccccEEEEEEEccccccccHHHHHcHcHcccEEEEEccccccccHHHHHHHHHcccccccEEEEEEcccccccccEHHHccccccccEEEEEEccccccccHHHHHHHHHHHcccccEEEEEEccccccccccccccHHHHHHHHHccccccccccEEEEEEEcccccccEEEEEccccEEEEEEccccccHHHHHHHHHHHHHHccccEEEEccccccHHHHHHHHHcccEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHcccHEEEccccEEEEEcccccccccccHccEEEEEEccccccccccccccccccEccccEEEEEEEEEccc
msrelptnpeteQKLFDLMWSDEIKLSFSNfvlhffpwgekgtplegfsaprswQLEFMEVVDAHclnsvnnpnpevfkgaisagrgigKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSllpnkhwfemqslslhpapwysdvlhcslgidskhYSTMCRtyseerpdtfvghhnTYGMAIindeasgtpdvinlGILGFLternanrfwimtsnprrlsgkfyeifnkplddwkrfqidtrtvegidpsfheGIIArygldsdvtrvevcgqfpqqdidsfiplniieealnrepcpdpyaplimgcdiaeeggdntvVVLRRgpviehlfdwsktdlrttnnKISGLVekyrpdaiiidanntgartcDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHSGLIQNLKSlksfivpntgelaieskrvkgakstdysdglmytfaenpprsdmdfgrcpsyqyeGVDLLIERRFEYDSR
msrelptnpeteQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMtsnprrlsgkFYEIFNKPLDDWKRFQIDTRtvegidpsfhEGIIARYGLDSDVTRVEVCGQfpqqdidsfIPLNIIEEALNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIehlfdwsktdlrttnnkisglvekyrpdaiiIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHSGLIQNLKSLKSFIVPNTGelaieskrvkgakstdysdGLMYTfaenpprsdmdFGRCPSYQYEGVDLLIERRFEYDSR
MSRELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHSGLIQNLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFGRCPSYQYEGVDLLIERRFEYDSR
***********EQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHSGLIQNLKSLKS**VPNT***************TDYSDGLMYTFAENPPRS************EGVDLLIERRFE****
*********ETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHSGLIQNLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFGRCPSYQYEGVDLLIERRFEYDSR
***********EQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHSGLIQNLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFGRCPSYQYEGVDLLIERRFEYDS*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSRELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHSGLIQNLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFGRCPSYQYEGVDLLIERRFEYDSR
MSRELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHSGLIQNLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFGRCPSYQYEGVDLLIERRFEYDSR
MSRELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHSGLIQNLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFGRCPSYQYEGVDLLIERRFEYDSR

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target511 putative phage terminase, large subunit [Candidatus Lib
254781187367 putative phage terminase, large subunit [Candidatu 1e-156
25478118645 hypothetical protein CLIBASIA_05465 [Candidatus Li 2e-05
>gi|254781187|ref|YP_003065600.1| putative phage terminase, large subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 367 Back     alignment
 Score =  545 bits (1403), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 252/359 (70%), Positives = 299/359 (83%)

Query: 1   MSRELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFME 60
           M R + T+ + EQ+L +++   E  LSF NFV+ FFPWG KG PLE FS P  WQLEFME
Sbjct: 1   MPRLISTDQKLEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFME 60

Query: 61  VVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQL 120
            VD HC ++VNN NP +FK AISAGRGIGKTTLNAW++LWL+STRPG+S+IC+ANSETQL
Sbjct: 61  AVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQL 120

Query: 121 KTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEER 180
           K TLWAEVSKWLS+LP++HWFEMQSLSLHP+ WY+++L  S+GIDSKHY+  CRTYSEER
Sbjct: 121 KNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEER 180

Query: 181 PDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEI 240
           PDTFVG HNT+GMA+ NDEASGTPD+IN  ILGF TE N NRFWIMTSN RRL+G FY+I
Sbjct: 181 PDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDI 240

Query: 241 FNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLN 300
           FN PL+DWKR+QIDTRTVEGID  FHEGII+RYGLDSDV R+E+ GQFPQQ++++FIP N
Sbjct: 241 FNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHN 300

Query: 301 IIEEALNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNK 359
            IEEA++RE   D YAPLIMGCDIA EGGD TVVV RRG +IEH+FDWS   ++ TN +
Sbjct: 301 YIEEAMSREAIDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAKLIQETNQE 359

>gi|254781186|ref|YP_003065599.1| hypothetical protein CLIBASIA_05465 [Candidatus Liberibacter asiaticus str. psy62] Length = 45 Back     alignment
 Score = 42.4 bits (98), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 19/43 (44%), Positives = 29/43 (67%), Gaps = 1/43 (2%)

Query: 363 LVEKYRPDAIIIDANNTGARTCDYLEMLGYH-VYRVLGQKRAV 404
           +  +Y PDAI++ AN  GA T +YLE L Y  + ++LGQ+ +V
Sbjct: 1   MAHQYNPDAIVLYANGIGAVTANYLENLNYSPIEKILGQRSSV 43

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target511 putative phage terminase, large subunit [Candidatus Lib
315121940509 putative phage terminase, large subunit [Candidatus Lib 1 0.0
315122902509 putative phage terminase, large subunit [Candidatus Lib 1 0.0
317120722516 putative phage terminase large subunit [Liberibacter ph 1 0.0
254781187367 putative phage terminase, large subunit [Candidatus Lib 1 1e-152
302120432255 putative phage terminase large subunit [Candidatus Libe 1 1e-148
303328395500 conserved hypothetical protein [Desulfovibrio sp. 3_1_s 1 6e-51
268589373493 conserved hypothetical protein [Providencia rettgeri DS 1 2e-50
167032754499 putative phage terminase large subunit [Pseudomonas put 1 1e-49
212710820493 hypothetical protein PROVALCAL_01888 [Providencia alcal 1 2e-49
290968649487 conserved hypothetical protein [Megasphaera genomosp. t 1 2e-49
>gi|315121940|ref|YP_004062429.1| putative phage terminase, large subunit [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 509 Back     alignment and organism information
 Score =  796 bits (2056), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/508 (74%), Positives = 428/508 (84%)

Query: 1   MSRELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFME 60
           M+RELPT  E EQ+L +LM+SD+IKLSF+NFVL  FPW E  T L  FS PR WQL+FME
Sbjct: 1   MTRELPTKIEHEQELMELMFSDDIKLSFTNFVLRLFPWSEANTSLANFSRPRRWQLDFME 60

Query: 61  VVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQL 120
            VD  CL +V+NP+P++FKGA+SAGRGIGKTTLNAW++LWL+STRPG+S++CLANSETQL
Sbjct: 61  AVDTDCLFNVDNPDPKIFKGAVSAGRGIGKTTLNAWMMLWLISTRPGMSILCLANSETQL 120

Query: 121 KTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEER 180
           K+TLWAEVSKWLS+LPNKHWFEMQSLSLHPA WY++ L  + GIDSKHY+  CRTYSEER
Sbjct: 121 KSTLWAEVSKWLSMLPNKHWFEMQSLSLHPAVWYAEALEKNFGIDSKHYTITCRTYSEER 180

Query: 181 PDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEI 240
           PDTFVGHHNTYGMAI NDEASGTPDVIN  ILGF TE NANRFW+MTSNPRRL G FY+I
Sbjct: 181 PDTFVGHHNTYGMAIFNDEASGTPDVINTSILGFFTENNANRFWVMTSNPRRLKGWFYDI 240

Query: 241 FNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLN 300
           FN PL+DW+RFQIDTRTVEGIDPSFHEGII+RYGLDSDVTRVEV GQFPQQDI+SFIP  
Sbjct: 241 FNVPLEDWQRFQIDTRTVEGIDPSFHEGIISRYGLDSDVTRVEVLGQFPQQDINSFIPFY 300

Query: 301 IIEEALNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKI 360
            IEEALNREP  DPYAPLIMGCDIA EGGDNTVVVLRRG  IEH+FDWS   +  ++ KI
Sbjct: 301 RIEEALNREPIKDPYAPLIMGCDIAGEGGDNTVVVLRRGTNIEHIFDWSGLAVNASSRKI 360

Query: 361 SGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKM 420
             L+ KY+PDA+++DAN  G +T  YL   GY V+   GQ RA D E  RNRRTELHVKM
Sbjct: 361 EELINKYKPDAVVVDANGIGVQTYYYLADEGYSVHAEKGQNRADDHESYRNRRTELHVKM 420

Query: 421 ADWLEFASLINHSGLIQNLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENP 480
           A+WLE AS+ NHSGLIQNLKSL+SFI PNTG+LA+ESKRVKGA STDYSD L YTFA +P
Sbjct: 421 AEWLELASIPNHSGLIQNLKSLESFIEPNTGKLALESKRVKGAVSTDYSDALAYTFAVSP 480

Query: 481 PRSDMDFGRCPSYQYEGVDLLIERRFEY 508
            RSDM+FGRC SYQYE  +LL++RRF Y
Sbjct: 481 ARSDMNFGRCRSYQYEADELLVDRRFSY 508


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|315122902|ref|YP_004063391.1| putative phage terminase, large subunit [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 509 Back     alignment and organism information
>gi|317120722|gb|ADV02544.1| putative phage terminase large subunit [Liberibacter phage SC2] Length = 516 Back     alignment and organism information
>gi|254781187|ref|YP_003065600.1| putative phage terminase, large subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 367 Back     alignment and organism information
>gi|302120432|gb|ADK92426.1| putative phage terminase large subunit [Candidatus Liberibacter asiaticus] Length = 255 Back     alignment and organism information
>gi|303328395|ref|ZP_07358832.1| conserved hypothetical protein [Desulfovibrio sp. 3_1_syn3] Length = 500 Back     alignment and organism information
>gi|268589373|ref|ZP_06123594.1| conserved hypothetical protein [Providencia rettgeri DSM 1131] Length = 493 Back     alignment and organism information
>gi|167032754|ref|YP_001667985.1| putative phage terminase large subunit [Pseudomonas putida GB-1] Length = 499 Back     alignment and organism information
>gi|212710820|ref|ZP_03318948.1| hypothetical protein PROVALCAL_01888 [Providencia alcalifaciens DSM 30120] Length = 493 Back     alignment and organism information
>gi|290968649|ref|ZP_06560187.1| conserved hypothetical protein [Megasphaera genomosp. type_1 str. 28L] Length = 487 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target511 putative phage terminase, large subunit [Candidatus Lib
pfam03237380 pfam03237, Terminase_6, Terminase-like family 8e-10
>gnl|CDD|146059 pfam03237, Terminase_6, Terminase-like family Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 511 putative phage terminase, large subunit [Candidatus Lib
pfam03237380 Terminase_6 Terminase-like family. This family represen 100.0
pfam04466387 Terminase_3 Phage terminase large subunit. Initiation o 99.95
COG5323410 Uncharacterized conserved protein [Function unknown] 99.67
COG4373509 Mu-like prophage FluMu protein gp28 [General function p 99.58
COG1783414 XtmB Phage terminase large subunit [General function pr 99.24
pfam03354473 Terminase_1 Phage Terminase. The majority of the member 99.96
COG4626546 Phage terminase-like protein, large subunit [General fu 99.83
pfam05876552 Terminase_GpA Phage terminase large subunit (GpA). This 99.41
TIGR01547462 phage_term_2 phage terminase, large subunit, PBSX famil 98.91
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Transcript 98.56
smart00487201 DEXDc DEAD-like helicases superfamily. 98.53
PRK10875607 recD exonuclease V subunit alpha; Provisional 98.47
pfam04851103 ResIII Type III restriction enzyme, res subunit. 98.37
PRK13766 764 Hef nuclease; Provisional 98.3
TIGR01448769 recD_rel helicase, RecD/TraA family; InterPro: IPR00634 98.29
PRK00254 717 ski2-like helicase; Provisional 98.11
PRK02362 736 ski2-like helicase; Provisional 98.1
TIGR01447753 recD exodeoxyribonuclease V, alpha subunit; InterPro: I 98.1
COG1111542 MPH1 ERCC4-like helicases [DNA replication, recombinati 98.05
PRK01172 674 ski2-like helicase; Provisional 98.01
KOG0354 746 consensus 97.98
KOG0390776 consensus 97.64
COG1203733 CRISPR-associated helicase Cas3 [Defense mechanisms] 97.31
PRK06305462 DNA polymerase III subunits gamma and tau; Validated 97.31
PRK05563 541 DNA polymerase III subunits gamma and tau; Validated 97.28
pfam00176295 SNF2_N SNF2 family N-terminal domain. This domain is fo 97.22
PRK08769319 DNA polymerase III subunit delta'; Validated 97.22
COG1205 851 Distinct helicase family with a unique C-terminal domai 97.14
COG4581 1041 Superfamily II RNA helicase [DNA replication, recombina 97.11
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA replicat 97.09
PRK07994 643 DNA polymerase III subunits gamma and tau; Validated 97.05
PRK06871324 DNA polymerase III subunit delta'; Validated 96.91
PRK06645507 DNA polymerase III subunits gamma and tau; Validated 96.9
PRK00440318 rfc replication factor C small subunit; Reviewed 96.9
PRK05896 613 DNA polymerase III subunits gamma and tau; Validated 96.86
PRK04914 955 ATP-dependent helicase HepA; Validated 96.85
PRK06647 560 DNA polymerase III subunits gamma and tau; Validated 96.82
PRK06674 563 DNA polymerase III subunits gamma and tau; Validated 96.79
PRK12323 721 DNA polymerase III subunits gamma and tau; Provisional 96.77
PRK12402337 replication factor C small subunit 2; Reviewed 96.75
PRK07133 718 DNA polymerase III subunits gamma and tau; Validated 96.74
PRK08451523 DNA polymerase III subunits gamma and tau; Validated 96.72
PRK07764 775 DNA polymerase III subunits gamma and tau; Validated 96.68
PRK08691 704 DNA polymerase III subunits gamma and tau; Validated 96.63
KOG0391 1958 consensus 96.5
PRK07270 557 DNA polymerase III subunits gamma and tau; Validated 96.49
PRK06872 696 DNA polymerase III subunits gamma and tau; Provisional 96.48
PRK07003 816 DNA polymerase III subunits gamma and tau; Validated 96.39
PRK13826 1102 Dtr system oriT relaxase; Provisional 96.36
PRK13889 992 conjugal transfer relaxase TraA; Provisional 96.3
PRK07471363 DNA polymerase III subunit delta'; Validated 96.24
PRK08853 717 DNA polymerase III subunits gamma and tau; Validated 96.0
PRK09112352 DNA polymerase III subunit delta'; Validated 95.97
PRK07993334 DNA polymerase III subunit delta'; Validated 95.82
PRK09111 600 DNA polymerase III subunits gamma and tau; Validated 95.67
COG5525 611 Bacteriophage tail assembly protein [General function p 95.25
KOG0338691 consensus 95.1
KOG1015 1567 consensus 94.79
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTERM lo 94.79
TIGR02768888 TraA_Ti Ti-type conjugative transfer relaxase TraA; Int 94.78
PRK08770 663 DNA polymerase III subunits gamma and tau; Validated 94.08
KOG2170344 consensus 93.39
PRK05648 705 DNA polymerase III subunits gamma and tau; Reviewed 93.2
PRK07132303 DNA polymerase III subunit delta'; Validated 93.05
KOG0388 1185 consensus 92.79
TIGR00635305 ruvB Holliday junction DNA helicase RuvB; InterPro: IPR 92.26
KOG0331519 consensus 92.25
COG2812515 DnaX DNA polymerase III, gamma/tau subunits [DNA replic 91.95
pfam05496234 RuvB_N Holliday junction DNA helicase ruvB N-terminus. 90.62
KOG4284 980 consensus 90.06
COG1444758 Predicted P-loop ATPase fused to an acetyltransferase [ 98.41
KOG2036 1011 consensus 98.13
COG1204 766 Superfamily II helicase [General function prediction on 97.51
KOG0952 1230 consensus 96.05
COG1201 814 Lhr Lhr-like helicases [General function prediction onl 94.32
KOG0342543 consensus 92.67
COG0470325 HolB ATPase involved in DNA replication [DNA replicatio 92.22
PRK10536262 hypothetical protein; Provisional 98.1
PRK08058329 DNA polymerase III subunit delta'; Validated 96.57
PRK05564313 DNA polymerase III subunit delta'; Validated 96.28
PRK08699325 DNA polymerase III subunit delta'; Validated 95.13
KOG0330476 consensus 94.64
PRK06090319 DNA polymerase III subunit delta'; Validated 94.44
PRK07940395 DNA polymerase III subunit delta'; Validated 94.41
PRK06964342 DNA polymerase III subunit delta'; Validated 93.14
PRK05917290 DNA polymerase III subunit delta'; Validated 90.06
pfam02562205 PhoH PhoH-like protein. PhoH is a cytoplasmic protein a 97.98
pfam00270167 DEAD DEAD/DEAH box helicase. Members of this family inc 97.95
smart00489289 DEXDc3 DEAD-like helicases superfamily. 97.82
smart00488289 DEXDc2 DEAD-like helicases superfamily. 97.82
PRK10590457 ATP-dependent RNA helicase RhlE; Provisional 97.52
PRK11192417 ATP-dependent RNA helicase SrmB; Provisional 97.52
cd00268203 DEADc DEAD-box helicases. A diverse family of proteins 97.44
PTZ00110602 helicase; Provisional 97.39
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 97.34
PRK11776459 ATP-dependent RNA helicase DbpA; Provisional 97.31
PRK11448 1126 hsdR type I restriction enzyme EcoKI subunit R; Provisi 97.29
PRK04537574 ATP-dependent RNA helicase RhlB; Provisional 97.27
COG4096 875 HsdR Type I site-specific restriction-modification syst 97.19
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 97.06
PRK01297472 ATP-dependent RNA helicase RhlB; Provisional 96.9
PRK13767 878 ATP-dependent helicase; Provisional 96.74
COG1199 654 DinG Rad3-related DNA helicases [Transcription / DNA re 96.59
PRK11747 697 dinG ATP-dependent DNA helicase DinG; Provisional 96.24
PRK08074 932 bifunctional ATP-dependent DNA helicase/DNA polymerase 96.04
TIGR02621 975 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-sub 95.83
COG1484254 DnaC DNA replication protein [DNA replication, recombin 95.7
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 95.26
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. subt 93.99
COG2607287 Predicted ATPase (AAA+ superfamily) [General function p 93.87
PRK12377248 putative replication protein; Provisional 93.86
PRK10917677 ATP-dependent DNA helicase RecG; Provisional 93.46
KOG0949 1330 consensus 93.4
PRK07246 820 bifunctional ATP-dependent DNA helicase/DNA polymerase 93.28
TIGR03029274 EpsG chain length determinant protein tyrosine kinase E 92.55
KOG0328400 consensus 91.69
COG1200677 RecG RecG-like helicase [DNA replication, recombination 91.28
KOG0335482 consensus 90.77
TIGR01054 1843 rgy reverse gyrase; InterPro: IPR005736 DNA topoisomera 97.57
COG1110 1187 Reverse gyrase [DNA replication, recombination, and rep 97.49
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse family 97.52
COG1875436 NYN ribonuclease and ATPase of PhoH family domains [Gen 96.1
PRK05703412 flhF flagellar biosynthesis regulator FlhF; Validated 96.09
TIGR00345330 arsA arsenite-activated ATPase (arsA); InterPro: IPR003 95.68
PRK06995404 flhF flagellar biosynthesis regulator FlhF; Validated 94.35
KOG18051100 consensus 93.98
TIGR03117 636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4. 93.79
pfam02456370 Adeno_IVa2 Adenovirus IVa2 protein. IVa2 protein can in 93.7
TIGR02525374 plasmid_TraJ plasmid transfer ATPase TraJ; InterPro: IP 92.51
pfam00580494 UvrD-helicase UvrD/REP helicase. The Rep family helicas 92.23
cd03115173 SRP The signal recognition particle (SRP) mediates the 91.54
pfam00448196 SRP54 SRP54-type protein, GTPase domain. This family in 91.06
cd01128249 rho_factor Transcription termination factor rho is a ba 91.02
PRK06526254 transposase; Provisional 90.62
smart00382148 AAA ATPases associated with a variety of cellular activ 90.1
pfam07652146 Flavi_DEAD Flavivirus DEAD domain. 97.17
pfam05970418 DUF889 PIF1 helicase. The PIF1 helicase inhibits telome 96.37
COG3972660 Superfamily I DNA and RNA helicases [General function p 95.24
PRK08181269 transposase; Validated 93.62
KOG0389941 consensus 93.18
KOG0339731 consensus 91.69
pfam05894333 Podovirus_Gp16 Podovirus DNA encapsidation protein (Gp1 90.28
PRK09401 1176 reverse gyrase; Reviewed 97.06
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Validated 92.02
pfam05127160 DUF699 Putative ATPase (DUF699). This putative domain i 96.77
PRK05707328 DNA polymerase III subunit delta'; Validated 96.6
TIGR01969258 minD_arch cell division ATPase MinD; InterPro: IPR01022 91.64
PRK13342417 recombination factor protein RarA; Reviewed 90.27
TIGR02397363 dnaX_nterm DNA polymerase III, subunits gamma and tau; 96.33
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 95.74
PRK13833323 conjugal transfer protein TrbB; Provisional 94.05
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provisional 93.85
PRK13894320 conjugal transfer ATPase TrbB; Provisional 92.45
PRK12727557 flagellar biosynthesis regulator FlhF; Provisional 91.81
TIGR02782315 TrbB_P P-type conjugative transfer ATPase TrbB; InterPr 95.05
PRK13709 1756 conjugal transfer nickase/helicase TraI; Provisional 93.5
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 93.08
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 93.03
PRK07399314 DNA polymerase III subunit delta'; Validated 92.83
>pfam03237 Terminase_6 Terminase-like family Back     alignment and domain information
>pfam04466 Terminase_3 Phage terminase large subunit Back     alignment and domain information
>COG5323 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4373 Mu-like prophage FluMu protein gp28 [General function prediction only] Back     alignment and domain information
>COG1783 XtmB Phage terminase large subunit [General function prediction only] Back     alignment and domain information
>pfam03354 Terminase_1 Phage Terminase Back     alignment and domain information
>COG4626 Phage terminase-like protein, large subunit [General function prediction only] Back     alignment and domain information
>pfam05876 Terminase_GpA Phage terminase large subunit (GpA) Back     alignment and domain information
>TIGR01547 phage_term_2 phage terminase, large subunit, PBSX family; InterPro: IPR006437 This group of sequences represent a highly divergent family of the large subunit of phage terminase Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>pfam04851 ResIII Type III restriction enzyme, res subunit Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>TIGR01448 recD_rel helicase, RecD/TraA family; InterPro: IPR006345 These sequences represent a family similar to RecD, the exodeoxyribonuclease V alpha chain of IPR006344 from INTERPRO Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit; InterPro: IPR006344 This family describes the exodeoxyribonuclease V alpha subunit, RecD Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>KOG0354 consensus Back     alignment and domain information
>KOG0390 consensus Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>pfam00176 SNF2_N SNF2 family N-terminal domain Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06674 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0391 consensus Back     alignment and domain information
>PRK07270 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06872 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK13826 Dtr system oriT relaxase; Provisional Back     alignment and domain information
>PRK13889 conjugal transfer relaxase TraA; Provisional Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK08853 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG5525 Bacteriophage tail assembly protein [General function prediction only] Back     alignment and domain information
>KOG0338 consensus Back     alignment and domain information
>KOG1015 consensus Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA; InterPro: IPR014136 This entry represents the Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>PRK08770 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG2170 consensus Back     alignment and domain information
>PRK05648 DNA polymerase III subunits gamma and tau; Reviewed Back     alignment and domain information
>PRK07132 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0388 consensus Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase RuvB; InterPro: IPR004605 All proteins in this family for which functions are known are 5'-3' DNA helicases that, as part of a complex with RuvA homologs serve as a 5'-3' Holliday junction helicase Back     alignment and domain information
>KOG0331 consensus Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>pfam05496 RuvB_N Holliday junction DNA helicase ruvB N-terminus Back     alignment and domain information
>KOG4284 consensus Back     alignment and domain information
>COG1444 Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only] Back     alignment and domain information
>KOG2036 consensus Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>KOG0952 consensus Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>KOG0342 consensus Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0330 consensus Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK05917 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>pfam02562 PhoH PhoH-like protein Back     alignment and domain information
>pfam00270 DEAD DEAD/DEAH box helicase Back     alignment and domain information
>smart00489 DEXDc3 DEAD-like helicases superfamily Back     alignment and domain information
>smart00488 DEXDc2 DEAD-like helicases superfamily Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype; InterPro: IPR013444 This entry represents a CRISPR-associated putative DEAH-box helicase, or Cas3, subtype found in Actinomyces naeslundii MG1, Geobacter sulfurreducens PCA, Gemmata obscuriglobus UQM 2246, and Desulfotalea psychrophila Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>KOG0949 consensus Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>TIGR03029 EpsG chain length determinant protein tyrosine kinase EpsG Back     alignment and domain information
>KOG0328 consensus Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>KOG0335 consensus Back     alignment and domain information
>TIGR01054 rgy reverse gyrase; InterPro: IPR005736 DNA topoisomerases regulate the number of topological links between two DNA strands (i Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>TIGR00345 arsA arsenite-activated ATPase (arsA); InterPro: IPR003348 This ATPase is involved in the removal of arsenate, antimonite, and arsenate from the cell Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>KOG1805 consensus Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>pfam02456 Adeno_IVa2 Adenovirus IVa2 protein Back     alignment and domain information
>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ; InterPro: IPR013364 Proteins in this entry are predicted ATPases associated with plasmid transfer loci in bacteria Back     alignment and domain information
>pfam00580 UvrD-helicase UvrD/REP helicase Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>pfam00448 SRP54 SRP54-type protein, GTPase domain Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>pfam07652 Flavi_DEAD Flavivirus DEAD domain Back     alignment and domain information
>pfam05970 DUF889 PIF1 helicase Back     alignment and domain information
>COG3972 Superfamily I DNA and RNA helicases [General function prediction only] Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>KOG0389 consensus Back     alignment and domain information
>KOG0339 consensus Back     alignment and domain information
>pfam05894 Podovirus_Gp16 Podovirus DNA encapsidation protein (Gp16) Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>pfam05127 DUF699 Putative ATPase (DUF699) Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR01969 minD_arch cell division ATPase MinD; InterPro: IPR010224 Proper placement of the bacterial cell division site requires the site-specific inactivation of other potential division sites Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunits gamma and tau; InterPro: IPR012763 This entry represents the well-conserved first N-terminal domain of DnaX, approx Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB; InterPro: IPR014149 This entry represents TrbB, a protein, which is encoded in the trb locus of Agrobacterium Ti plasmids where it is involved in the type IV secretion system for plasmid conjugative transfer Back     alignment and domain information
>PRK13709 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target511 putative phage terminase, large subunit [Candidatus Lib
3ezk_A577 Bacteriophage T4 Gp17 Motor Assembly Based On Cryst 4e-14
3cpe_A592 Crystal Structure Of T4 Gp17 Length = 592 1e-13
2o0h_A385 T4 Gp17 Atpase Domain Mutant Complexed With Atp Len 1e-07
>gi|220702483|pdb|3EZK|A Chain A, Bacteriophage T4 Gp17 Motor Assembly Based On Crystal Structures And Cryo-Em Reconstructions Length = 577 Back     alignment and structure
 Score = 84.2 bits (206), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 57/461 (12%), Positives = 130/461 (28%), Gaps = 61/461 (13%)

Query: 10  ETEQKLFDLMWSD--EIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCL 67
             + +    M  +  + +     F   +                R +Q + ++++ +  +
Sbjct: 97  NIKTQWTREMVEEWKKCRDDIVYFAETYCA-ITHIDYGVIKVQLRDYQRDMLKIMSSKRM 155

Query: 68  NSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAE 127
              N              R +GKTT+ A  +   +      +V  LA+  +     L   
Sbjct: 156 TVCNL------------SRQLGKTTVVAIFLAHFVCFNKDKAVGILAHKGSMSAEVL-DR 202

Query: 128 VSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGH 187
             + + LLP+              P   +    S+ +D+                +    
Sbjct: 203 TKQAIELLPD-----------FLQPGIVEWNKGSIELDNGSSIGAY-------ASSPDAV 244

Query: 188 HNTYGMAIINDEASGTPD--VINLGILGFL-TERNANRFWIMTSNPRRLSGKFYEIFNKP 244
                  I  DE +  P+     L I   + + R +      T N        +    + 
Sbjct: 245 RGNSFAMIYIDECAFIPNFHDSWLAIQPVISSGRRSKIIITTTPNGLNHFYDIWTAAVEG 304

Query: 245 LDDWKRFQIDTRTV--------EGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDS- 295
              ++ +     +V        +  D  +   I    G      R E    F        
Sbjct: 305 KSGFEPYTAIWNSVKERLYNDEDIFDDGWQWSIQTINGSSLAQFRQEHTAAFEGTSGTLI 364

Query: 296 ---------FIPLNIIEEALNREPCPDPYAPLIMGCDI--AEEGGDNTVVVLRRGPVIEH 344
                    FI +   +   ++   P+P    I   D         + + ++     +  
Sbjct: 365 SGMKLAVMDFIEVTPDDHGFHQFKKPEPDRKYIATLDCSEGRGQDYHALHIIDVTDDVWE 424

Query: 345 LFDWSKTDLRT---TNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQK 401
                 ++  +     + +   + +Y    + I+ N+TG      L M   +   +    
Sbjct: 425 QVGVLHSNTISHLILPDIVMRYLVEYNECPVYIELNSTGVSVAKSLYMDLEYEGVICDSY 484

Query: 402 RAVDLEFCRNRRTELHVKMADWLEFASLINHSG-LIQNLKS 441
             + ++  +  +      + D +E   LI H    IQ  ++
Sbjct: 485 TDLGMKQTKRTKAVGCSTLKDLIEKDKLIIHHRATIQEFRT 525


>gi|220702377|pdb|3CPE|A Chain A, Crystal Structure Of T4 Gp17 Length = 592 Back     alignment and structure
>gi|145579924|pdb|2O0H|A Chain A, T4 Gp17 Atpase Domain Mutant Complexed With Atp Length = 385 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target511 putative phage terminase, large subunit [Candidatus Lib
3cpe_A592 Terminase, DNA packaging protein GP17; large terminase, 2e-09
>3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A* Length = 592 Back     alignment and structure
 Score = 59.4 bits (143), Expect = 2e-09
 Identities = 65/400 (16%), Positives = 118/400 (29%), Gaps = 57/400 (14%)

Query: 82  ISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWF 141
            +  R +GKTT+ A  +   +      +V  LA+  +     L     + + LLP+    
Sbjct: 183 CNLSRQLGKTTVVAIFLAHFVCFNKDKAVGILAHKGSMSAEVLD-RTKQAIELLPDF--- 238

Query: 142 EMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEAS 201
                 L P     +     L   S              PD   G+       I  ++ +
Sbjct: 239 ------LQPGIVEWNKGSIELDNGSS------IGAYASSPDAVRGNSFAM---IYIEDCA 283

Query: 202 GTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRF---------- 251
             P+  +  +       +  R  I+ +        FY+I+   ++    F          
Sbjct: 284 FIPNFHDSWLAIQPVISSGRRSKIIITTTPNGLNHFYDIWTAAVEGKSGFEPYTAIWNSV 343

Query: 252 -QIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREP 310
            +      +  D  +   I    G      R E    F +    + I    +      E 
Sbjct: 344 KERLYNDEDIFDDGWQWSIQTINGSSLAQFRQEHTAAF-EGTSGTLISGMKLAVMDFIEV 402

Query: 311 C-----------PDPYAPLIMGCDIAEEGGDNTVV-----VLRRGPVIEHLFDWSKTDLR 354
                       P+P    I   D +E  G +        V         +   +     
Sbjct: 403 TPDDHGFHQFKKPEPDRKYIATLDCSEGRGQDYHALHIIDVTDDVWEQVGVLHSNTISHL 462

Query: 355 TTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEM-LGYHVYRVLGQKRAVDLEFCRNRR 413
              + +   + +Y    + I+ N+TG      L M L Y    V+      DL   + +R
Sbjct: 463 ILPDIVMRYLVEYNECPVYIELNSTGVSVAKSLYMDLEYE--GVICDSY-TDLGMKQTKR 519

Query: 414 TELHV--KMADWLEFASL-INHSGLIQNLKSLKSFIVPNT 450
           T+      + D +E   L I+H   IQ     ++F     
Sbjct: 520 TKAVGCSTLKDLIEKDKLIIHHRATIQ---EFRTFSEKGV 556


Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target511 putative phage terminase, large subunit [Candidatus Lib
3cpe_A592 Terminase, DNA packaging protein GP17; large terminase, 100.0
2o0j_A385 Terminase, DNA packaging protein GP17; nucleotide-bindi 99.96
3c6a_A232 Terminase large subunit; terminase nuclease, viral prot 99.2
2wbn_A212 G2P, terminase large subunit; large terminase, nuclease 96.43
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF 98.82
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP-depen 98.52
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA damage 98.44
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA repli 98.43
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA bindi 98.05
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA complex, 97.94
3e1s_A574 Exodeoxyribonuclease V, subunit RECD; alpha and beta pr 97.92
1w36_D608 RECD, exodeoxyribonuclease V alpha chain; recombination 97.87
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, tran 97.86
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATPase, 97.79
3mwy_W 800 Chromo domain-containing protein 1; SWI2/SNF2 ATPase, d 97.53
1z3i_X 644 Similar to RAD54-like; recombination ATPase helicase, r 97.47
2w00_A 1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction 97.33
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processivity 97.17
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, structu 97.11
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2.20A 97.0
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, SF2 AT 96.99
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processivity 96.7
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processivity 96.55
2chg_A226 Replication factor C small subunit; DNA-binding protein 95.83
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, complex 95.75
2chq_A319 Replication factor C small subunit; DNA-binding protein 95.29
1jr3_A373 DNA polymerase III subunit gamma; processivity, process 95.25
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; hydr 92.67
3h1t_A590 Type I site-specific restriction-modification system, R 98.69
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, 98.31
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winged-hel 98.22
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, s 98.15
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fold, A 98.07
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP 98.03
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helicase, 98.03
3b6e_A216 Interferon-induced helicase C domain-containing protein 97.92
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, s 97.87
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA 97.83
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-binding 97.78
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene 97.72
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA complex, 97.69
2vl7_A540 XPD; helicase, unknown function; 2.25A {Sulfolobus toko 97.65
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase DEAD 97.65
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, atom 97.56
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomi 97.52
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, phos 97.5
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, struct 97.48
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, nucle 97.47
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, struct 97.47
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-like, 97.41
3crv_A 551 XPD/RAD3 related DNA helicase; XPD helicase DNA repair 97.31
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, structura 97.29
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fold, PR 97.2
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A {Geob 97.17
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, RNA b 97.14
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural geno 97.1
1oyw_A523 RECQ helicase, ATP-dependent DNA helicase; winged helix 96.99
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box prote 96.98
3bor_A237 Human initiation factor 4A-II; translation initiation, 96.96
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 3.24 96.86
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-binding, 96.79
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, AT 96.77
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, nucle 96.54
2kbe_A226 ATP-dependent RNA helicase DBP5; DBP5P, ATP-binding, cy 96.48
2gk6_A624 Regulator of nonsense transcripts 1; UPF1, helicase, NM 96.46
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealing, mi 96.38
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helic 96.31
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-box pr 95.95
2wjy_A800 Regulator of nonsense transcripts 1; alternative splici 95.92
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-beta fol 95.53
3cio_A299 ETK, tyrosine-protein kinase ETK; WZC, escherichia coli 92.91
2qgz_A308 Helicase loader, putative primosome component; structur 92.52
3la6_A286 Tyrosine-protein kinase WZC; P-loop protein, nucleotide 92.31
3bfv_A271 CAPA1, CAPB2, membrane protein CAPA1, protein tyrosine 91.0
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 int 90.71
2zpa_A671 Uncharacterized protein YPFI; RNA modification enzyme, 98.2
2z83_A459 Helicase/nucleoside triphosphatase; hydrolase, membrane 96.68
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, RNA r 96.59
1cu1_A645 Protein (protease/helicase NS3); bifunctional,protease- 91.72
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nucleot 96.63
1yks_A440 Genome polyprotein [contains: flavivirin protease NS3 c 96.49
2wv9_A673 Flavivirin protease NS2B regulatory subunit, flavivirin 96.39
2whx_A618 Serine protease/ntpase/helicase NS3; transcription, hyd 96.21
3kqn_A437 Serine protease/ntpase/helicase NS3; helicase-substrate 96.02
2vsf_A 602 XPD, DNA repair helicase RAD3 related protein; NER, TFI 94.62
2ph1_A262 Nucleotide-binding protein; alpha-beta protein, structu 93.88
1pjr_A 724 PCRA; DNA repair, DNA replication, SOS response, helica 92.26
1wcv_1257 SOJ, segregation protein; ATPase, bacterial, chromosome 92.24
3io3_A348 DEHA2D07832P; chaperone, membrane traffic, ATPase; HET: 92.19
1g3q_A237 MIND ATPase, cell division inhibitor; alpha-beta-alpha 92.07
1uaa_A 673 REP helicase, protein (ATP-dependent DNA helicase REP.) 91.71
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CPFTSY; 91.22
3cwq_A209 Para family chromosome partitioning protein; alpha-beta 90.56
1hyq_A263 MIND, cell division inhibitor (MIND-1); MINC, FTSZ, bac 90.38
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processivity 96.47
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, flagel 95.62
1njg_A250 DNA polymerase III subunit gamma; rossman-like fold, AA 93.94
>3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A* Back     alignment and structure
Probab=100.00  E-value=2.7e-42  Score=283.97  Aligned_cols=419  Identities=16%  Similarity=0.153  Sum_probs=290.7

Q ss_pred             CCCHHHHHHHHHHHHCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCEEEEEECC
Q ss_conf             46746788899987070666528866776421455777565557845899999999999874056555421012465025
Q gi|254781215|r    6 PTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAG   85 (511)
Q Consensus         6 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~w~~~~~~~~~~~~P~~WQ~e~l~~i~~~~~~~~~~~~~~~~r~aV~sg   85 (511)
                      ++.+++.+|+      ..|++||+-|+.-++---...+.+-.|+ |.+||+++++.+.++++            ..|..|
T Consensus       126 ~~t~~~~~e~------~kc~~d~~yF~~~y~~i~~~~~g~vpf~-l~~~Q~~~l~~~~~~Rf------------~Iilk~  186 (592)
T 3cpe_A          126 QWTREMVEEW------KKCRDDIVYFAETYCAITHIDYGVIKVQ-LRDYQRDMLKIMSSKRM------------TVCNLS  186 (592)
T ss_dssp             CCCHHHHHHH------HHHHTCHHHHHHHTCBCCBTTTBSBBCC-CCHHHHHHHHHHHHCSE------------EEEEEC
T ss_pred             CCCHHHHHHH------HHHHCCHHHHHHHEEEEECCCCCEEECC-CCHHHHHHHHHHHHCCE------------EEEEEC
T ss_conf             7789999999------9874088999862189987889844276-76999999999874376------------899946


Q ss_pred             CCCCHHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHHHHHCHHCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             76597899999999999808996699980858999999999999999855000134443222222333444321112357
Q gi|254781215|r   86 RGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGID  165 (511)
Q Consensus        86 rG~GKS~l~a~l~lw~l~~~p~~kv~vtApt~~Q~~~ilw~Ei~k~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  165 (511)
                      ||+|||++++++++|+++++|+.+++++||+++|++.+ +..++.++..+|.........           .....+...
T Consensus       187 RQ~GKSt~~a~~~l~~al~~~~~~i~ivA~~~~~A~~i-~~~ik~~~~~lP~~l~~~~~~-----------~n~~~i~~~  254 (592)
T 3cpe_A          187 RQLGKTTVVAIFLAHFVCFNKDKAVGILAHKGSMSAEV-LDRTKQAIELLPDFLQPGIVE-----------WNKGSIELD  254 (592)
T ss_dssp             SSSCHHHHHHHHHHHHHHTSSSCEEEEEESSHHHHHHH-HHHHHHHHTTSCTTTSCCEEE-----------ECSSEEEET
T ss_pred             CCCCHHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHHH-HHHHHHHHHHCCHHHCCCCCC-----------CCCCEEEEC
T ss_conf             98869999999999999829997599991989999999-999999999681330466434-----------664126745


Q ss_pred             CCEEEEEECCCCCCCCCHHHHCCCCCCEEEEECCHHCCCH--HHHHHHHHHHCCCCCCEEEEEECCCCCCCCHHHHHHHC
Q ss_conf             8616985303575561002120267614999711102997--88988888850799813899823899876556765303
Q gi|254781215|r  166 SKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPD--VINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNK  243 (511)
Q Consensus       166 ~~~~~~~~~~~s~~~~ea~~G~h~~~~~lvI~DEAsgI~d--~i~e~i~~~Lt~~g~~~~~i~~~nP~~~~g~fy~~~~~  243 (511)
                      +++....    +..++++.+|.   +..++++||++++++  ++|.++.++++..+.. +++.+|+|++.. .||+.+..
T Consensus       255 Ngs~i~~----~a~~~da~RG~---s~~~l~lDE~Afi~~~~e~~~~~~~~l~~g~~~-kiii~STpnG~n-~fy~~~~~  325 (592)
T 3cpe_A          255 NGSSIGA----YASSPDAVRGN---SFAMIYIEDCAFIPNFHDSWLAIQPVISSGRRS-KIIITTTPNGLN-HFYDIWTA  325 (592)
T ss_dssp             TSCEEEE----EECCHHHHHHS---CCSEEEEETGGGCTTHHHHHHHHHHHHSSSSCC-EEEEEECCCTTS-HHHHHHHH
T ss_pred             CCCEEEE----ECCCCCCCCCC---CCCCEEEEHHHHCCHHHHHHHHHCCCCCCCCCC-EEEEECCCCCCC-CCHHHHHH
T ss_conf             8725875----04788666677---666327531320406888875302334368873-699977998876-32789988


Q ss_pred             ---CCCCCEEEEECCCCCCCC--------CHHHHHHHHHHCCCCHHHHHHHHCCCCCCCCCCEEECHHHHHHHHHCC---
Q ss_conf             ---524741798404336778--------977899999751898013544431756666787375599998864076---
Q gi|254781215|r  244 ---PLDDWKRFQIDTRTVEGI--------DPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNRE---  309 (511)
Q Consensus       244 ---~~~~w~~~~i~~~~~p~~--------~~~~ie~~~~~~geds~~~r~evlgeFp~~~~~~~i~~~~ie~a~~r~---  309 (511)
                         ....|..+.+.|...|..        +..|.....+..+.....|++|++|+|..++.. +|+.+.+..+....   
T Consensus       326 a~~g~~~~~~~~~~w~~~per~~~d~~~~~~~~~w~~e~i~~~s~~~F~QEy~~eF~~s~~~-vf~~~~l~~~~~~~~~~  404 (592)
T 3cpe_A          326 AVEGKSGFEPYTAIWNSVKERLYNDEDIFDDGWQWSIQTINGSSLAQFRQEHTAAFEGTSGT-LISGMKLAVMDFIEVTP  404 (592)
T ss_dssp             HHTTCSSCEEEEECGGGSGGGGBCTTSBBCTTHHHHHHHHTTSCHHHHHHHHSCCCTTSCSB-SSCHHHHTTCCCCCCCC
T ss_pred             HHHCCCCCCCEECCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCHHHHCCCCCCCCCCCCCH-HHHHHHHHHHCCCCCCC
T ss_conf             74077766741234345776335542100043799999874577555301434332345430-56778987620222203


Q ss_pred             --------CCCCCCCEEEEEEECCCC-CCCCEEEEEEC--CC--EEEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEEE
Q ss_conf             --------531899708999623334-78417999822--75--589987327789889999999999861888299800
Q gi|254781215|r  310 --------PCPDPYAPLIMGCDIAEE-GGDNTVVVLRR--GP--VIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDA  376 (511)
Q Consensus       310 --------~~~~~~~~~viGvDVAr~-G~D~svi~~r~--G~--~v~~~~~~~~~d~~~~a~~i~~~~~~~~~~~i~iD~  376 (511)
                              ..+.++..+++|+|||++ |+|.+++.+-.  +.  .+......++.++..++..|..++..|+++.|+||.
T Consensus       405 ~~~~~~iye~p~~~~~YvigvDvA~G~~~DySai~Vidv~~~~~eqVa~~~~n~i~~~~~a~~I~~l~~~YN~a~V~VE~  484 (592)
T 3cpe_A          405 DDHGFHQFKKPEPDRKYIATLDCSEGRGQDYHALHIIDVTDDVWEQVGVLHSNTISHLILPDIVMRYLVEYNECPVYIEL  484 (592)
T ss_dssp             CSSSEEESSCCCTTCCEEEEEECCSSBTTBCEEEEEEECSSSSEEEEEEEEESSSCTTTHHHHHHHHHHHTTSCCEEEEE
T ss_pred             CCCCEEEEECCCCCCCEEEEEECCCCCCCCCEEEEEECCCCCCEEEEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEEE
T ss_conf             47781332446766602688512445777732799941478761899998358889899999999999972884899997


Q ss_pred             CCCCHHHHHHHH-HCCCE-EEEECCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCC-CCHHHHHHHHHCCCEEEECCCCEE
Q ss_conf             687636889898-64982-798427777664025522799999999999970899-981899999857967998799849
Q gi|254781215|r  377 NNTGARTCDYLE-MLGYH-VYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASL-INHSGLIQNLKSLKSFIVPNTGEL  453 (511)
Q Consensus       377 ~GvG~gV~d~L~-~~g~~-v~~v~~~~~~~~~~~y~N~rae~~~~~re~l~~g~l-~~d~~l~~el~~~~~~~~~~~gki  453 (511)
                      +|+|.+|++.|. ++++. +..-.......  ..-...|..++-+|+++|+.+.+ +++..|++||.+-.   . .+|+.
T Consensus       485 N~~G~~Vi~~L~~dl~y~nl~~~~~~~~Gf--~tT~ksK~~~is~Lk~liE~~~i~i~~~~li~EL~tFv---~-~~~~~  558 (592)
T 3cpe_A          485 NSTGVSVAKSLYMDLEYEGVICDSYTDLGM--KQTKRTKAVGCSTLKDLIEKDKLIIHHRATIQEFRTFS---E-KGVSW  558 (592)
T ss_dssp             SHHHHHHHHHHHTTSCCSCEECSSSSCSSE--ECCHHHHHHHHHHHHHHHHTTSEECCCHHHHHHHTSEE---E-ETTEE
T ss_pred             CCCHHHHHHHHHHHHCCCCCCCCCCCCCCC--CCCCCCHHHHHHHHHHHHHCCCEEECCHHHHHHHHHHH---H-CCCEE
T ss_conf             984999999998874557514677677787--57845599999999999974986989888999999986---4-49751


Q ss_pred             EEEECHHHCCCCCCHHHHHHHHH
Q ss_conf             99841254899989899999997
Q gi|254781215|r  454 AIESKRVKGAKSTDYSDGLMYTF  476 (511)
Q Consensus       454 ~ie~Kkkrg~~SPD~ADAl~l~f  476 (511)
                      .-.     -|.+=|+..||+|+.
T Consensus       559 ~A~-----~G~HDDlVmalala~  576 (592)
T 3cpe_A          559 AAE-----EGYHDDLVMSLVIFG  576 (592)
T ss_dssp             EEC-----TTCCCHHHHHHHHHH
T ss_pred             CCC-----CCCCHHHHHHHHHHH
T ss_conf             478-----999779999999999



>2o0j_A Terminase, DNA packaging protein GP17; nucleotide-binding fold, hydrolase; HET: DNA ADP; 1.80A {Enterobacteria phage T4} PDB: 2o0h_A* 2o0k_A* Back     alignment and structure
>3c6a_A Terminase large subunit; terminase nuclease, viral protein; 1.16A {Enterobacteria phage RB49} PDB: 3c6h_A Back     alignment and structure