255764463

255764463

delta-aminolevulinic acid dehydratase

GeneID in NCBI database:8209337Locus tag:CLIBASIA_01185
Protein GI in NCBI database:255764463Protein Accession:YP_003064765.2
Gene range:+(247816, 248829)Protein Length:337aa
Gene description:delta-aminolevulinic acid dehydratase
COG prediction:[H] Delta-aminolevulinic acid dehydratase
KEGG prediction:delta-aminolevulinic acid dehydratase (EC:4.2.1.24); K01698 porphobilinogen synthase [EC:4.2.1.24]
SEED prediction:Porphobilinogen synthase (EC 4.2.1.24)
Pathway involved in KEGG:Porphyrin and chlorophyll metabolism [PATH:las00860]
Subsystem involved in SEED:Heme and Siroheme Biosynthesis;
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------
MCNTNAISHKICCHRRMRRNRKSNWIREMVREHRLSVSDLILPIFLTSGEKTVESINSMPDVMRMSIDVAVEKIKQVADLGIPAIAIFPNIPMDLRNNTGSHIIDPDNLINEGICAIKKNIPNIGIITDVALDPFTIHGHDGILCDGEIVNDETIELISHAAVIQADAGADIIAPSEMMDGRVQEIRKKLDSHGHINVGIMPYVAKFNSSFYGPYRDAISTRDLLKGDKKTYYLDPANVQEAIREASIDIQESADMLLVKPGLPYLDVCFRIKEKFGLPTFAYQVSGEYAMIKAASLQGWINKNDAMMESLLAFKRAGCDGIFTYFAMEAARILTHS
ccccccccccccccccccHHHccHHHHHHHHHccccHHHEEEEEEEEccccccEEcccccccEEccHHHHHHHHHHHHHccccEEEEccccccccccHHHHcccccccHHHHHHHHHHHHcccEEEEEEEEccccccccccEEEcccEEccHHHHHHHHHHHHHHHHccccEEEcccccccHHHHHHHHHHHccccccccHHHHHHHHHHccccHHHHccccccccccccccccccccHHHHHHHHHHHHHccccEEEEcccHHHHHHHHHHHHcccccEEEEEcccHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccEEEEHHHHHHHHHHHcc
ccccccccccccHccccHHHHccHHHHHHHccccccHHHEEEEEEEEcccccEEEcccccccEEEEHHHHHHHHHHHHHccccEEEEEEcccHHHcEcccHHHHccccHHHHHHHHHHHHccccEEEEEEcccccEcccccccEccccEcHHHHHHHHHHHHHHHHHHcccEEEEccccccHHHHHHHHHHHccccccEEEcccEEEcccccHHHHHHHccHHHcccccccccEccccHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHccccccEEEEccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccEEEcccHHHHHHHHHcc
MCNTNAISHKICCHRRMRRNRKSNWIREMVREHRLSVSDLILPIfltsgektvesinsMPDVMRMSIDVAVEKIKQVAdlgipaiaifpnipmdlrnntgshiidpdnlinEGICaikknipnigiitdvaldpftihghdgilcdgeivndETIELISHAAVIQAdagadiiapsemmDGRVQEIRKKLdshghinvgiMPYVAkfnssfygpyrdaistrdllkgdkktyyldpaNVQEAIREASIDIQESADMllvkpglpyldVCFRIkekfglptfayqvSGEYAMIKAASLQGWINKNDAMMESLLAFKRAGCDGIFTYFAMEAARILTHS
mcntnaishkicchrrmrrnrksnwiREMVrehrlsvsdlilPIFLTSGEKTVESINSMPDVMRMSIDVAVEKIKQVADLGIPAIAIFPNIPMDLRNNTGSHIIDPDNLINEGICAIKKNIPNIGIITDVALDPFTIHGHDGILCDGEIVNDETIELISHAAVIQADAGADIIAPSEMMDGRVQEIRKKLDSHGHINVGIMPYVAKFNSSFYGPYRDAISTRDLLKGDKKTYYLDPANVQEAIREASIDIQESADMLLVKPGLPYLDVCFRIKEKFGLPTFAYQVSGEYAMIKAASLQGWINKNDAMMESLLAFKRAGCDGIFTYFAMEAARILTHS
MCNTNAISHKICCHRRMRRNRKSNWIREMVREHRLSVSDLILPIFLTSGEKTVESINSMPDVMRMSIDVAVEKIKQVADLGIPAIAIFPNIPMDLRNNTGSHIIDPDNLINEGICAIKKNIPNIGIITDVALDPFTIHGHDGILCDGEIVNDETIELISHAAVIQADAGADIIAPSEMMDGRVQEIRKKLDSHGHINVGIMPYVAKFNSSFYGPYRDAISTRDLLKGDKKTYYLDPANVQEAIREASIDIQESADMLLVKPGLPYLDVCFRIKEKFGLPTFAYQVSGEYAMIKAASLQGWINKNDAMMESLLAFKRAGCDGIFTYFAMEAARILTHS
***********CCHRRMRRNRKSNWIREMVREHRLSVSDLILPIFLTSGEKTVESINSMPDVMRMSIDVAVEKIKQVADLGIPAIAIFPNIPMDLRNNTGSHIIDPDNLINEGICAIKKNIPNIGIITDVALDPFTIHGHDGILCDGEIVNDETIELISHAAVIQADAGADIIAPSEMMDGRVQEIRKKLDSHGHINVGIMPYVAKFNSSFYGPYRDAISTRDLLKGDKKTYYLDPANVQEAIREASIDIQESADMLLVKPGLPYLDVCFRIKEKFGLPTFAYQVSGEYAMIKAASLQGWINKNDAMMESLLAFKRAGCDGIFTYFAMEAARILTH*
MCNTNAISHKICCHRRMRRNRKSNWIREMVREHRLSVSDLILPIFLTSGEKTVESINSMPDVMRMSIDVAVEKIKQVADLGIPAIAIFPNIPMDLRNNTGSHIIDPDNLINEGICAIKKNIPNIGIITDVALDPFTIHGHDGILCDGEIVNDETIELISHAAVIQADAGADIIAPSEMMDGRVQEIRKKLDSHGHINVGIMPYVAKFNSSFYGPYRDAISTRDLLKGDKKTYYLDPANVQEAIREASIDIQESADMLLVKPGLPYLDVCFRIKEKFGLPTFAYQVSGEYAMIKAASLQGWINKNDAMMESLLAFKRAGCDGIFTYFAMEAARILTHS
******ISHKICCHRRMRRNRKSNWIREMVREHRLSVSDLILPIFLTSGEKTVESINSMPDVMRMSIDVAVEKIKQVADLGIPAIAIFPNIPMDLRNNTGSHIIDPDNLINEGICAIKKNIPNIGIITDVALDPFTIHGHDGILCDGEIVNDETIELISHAAVIQADAGADIIAPSEMMDGRVQEIRKKLDSHGHINVGIMPYVAKFNSSFYGPYRDAISTRDLLKGDKKTYYLDPANVQEAIREASIDIQESADMLLVKPGLPYLDVCFRIKEKFGLPTFAYQVSGEYAMIKAASLQGWINKNDAMMESLLAFKRAGCDGIFTYFAMEAARILTHS
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCNTNAISHKICCHRRMRRNRKSNWIREMVREHRLSVSDLILPIFLTSGEKTVESINSMPDVMRMSIDVAVEKIKQVADLGIPAIAIFPNIPMDLRNNTGSHIIDPDNLINEGICAIKKNIPNIGIITDVALDPFTIHGHDGILCDGEIVNDETIELISHAAVIQADAGADIIAPSEMMDGRVQEIRKKLDSHGHINVGIMPYVAKFNSSFYGPYRDAISTRDLLKGDKKTYYLDPANVQEAIREASIDIQESADMLLVKPGLPYLDVCFRIKEKFGLPTFAYQVSGEYAMIKAASLQGWINKNDAMMESLLAFKRAGCDGIFTYFAMEAARILTHS
MCNTNAISHKICCHRRMRRNRKSNWIREMVREHRLSVSDLILPIFLTSGEKTVESINSMPDVMRMSIDVAVEKIKQVADLGIPAIAIFPNIPMDLRNNTGSHIIDPDNLINEGICAIKKNIPNIGIITDVALDPFTIHGHDGILCDGEIVNDETIELISHAAVIQADAGADIIAPSEMMDGRVQEIRKKLDSHGHINVGIMPYVAKFNSSFYGPYRDAISTRDLLKGDKKTYYLDPANVQEAIREASIDIQESADMLLVKPGLPYLDVCFRIKEKFGLPTFAYQVSGEYAMIKAASLQGWINKNDAMMESLLAFKRAGCDGIFTYFAMEAARILTHS
MCNTNAISHKICCHRRMRRNRKSNWIREMVREHRLSVSDLILPIFLTSGEKTVESINSMPDVMRMSIDVAVEKIKQVADLGIPAIAIFPNIPMDLRNNTGSHIIDPDNLINEGICAIKKNIPNIGIITDVALDPFTIHGHDGILCDGEIVNDETIELISHAAVIQADAGADIIAPSEMMDGRVQEIRKKLDSHGHINVGIMPYVAKFNSSFYGPYRDAISTRDLLKGDKKTYYLDPANVQEAIREASIDIQESADMLLVKPGLPYLDVCFRIKEKFGLPTFAYQVSGEYAMIKAASLQGWINKNDAMMESLLAFKRAGCDGIFTYFAMEAARILTHS

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target337 delta-aminolevulinic acid dehydratase [Candidatus Liber
315122224335 delta-aminolevulinic acid dehydratase [Candidatus Liber 1 1e-166
327192110337 delta-aminolevulinic acid dehydratase protein [Rhizobiu 1 1e-131
227821526337 delta-aminolevulinic acid dehydratase [Sinorhizobium fr 1 1e-131
190891188337 delta-aminolevulinic acid dehydratase [Rhizobium etli C 1 1e-131
86357142337 delta-aminolevulinic acid dehydratase [Rhizobium etli C 1 1e-130
241203997337 delta-aminolevulinic acid dehydratase [Rhizobium legumi 1 1e-129
209548716337 delta-aminolevulinic acid dehydratase [Rhizobium legumi 1 1e-129
116251382337 delta-aminolevulinic acid dehydratase [Rhizobium legumi 1 1e-128
222148199337 delta-aminolevulinic acid dehydratase [Agrobacterium vi 1 1e-127
159184643337 delta-aminolevulinic acid dehydratase [Agrobacterium tu 1 1e-127
>gi|315122224|ref|YP_004062713.1| delta-aminolevulinic acid dehydratase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 335 Back     alignment and organism information
 Score =  587 bits (1514), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 278/333 (83%), Positives = 308/333 (92%)

Query: 5   NAISHKICCHRRMRRNRKSNWIREMVREHRLSVSDLILPIFLTSGEKTVESINSMPDVMR 64
           N +SH ICCH+RMRRNRK+ WIRE+VREH+LSV+DLI P+FLTSG+  +E I+SMP + R
Sbjct: 3   NTMSHNICCHKRMRRNRKAIWIRELVREHQLSVNDLIFPMFLTSGKNIIEPIDSMPGISR 62

Query: 65  MSIDVAVEKIKQVADLGIPAIAIFPNIPMDLRNNTGSHIIDPDNLINEGICAIKKNIPNI 124
           MSID+AVEKIKQ ADLGIPAIAIFPNIP+DLR+NTGSHIIDP NLINEGI AIKKNIP+I
Sbjct: 63  MSIDMAVEKIKQAADLGIPAIAIFPNIPIDLRDNTGSHIIDPHNLINEGIHAIKKNIPDI 122

Query: 125 GIITDVALDPFTIHGHDGILCDGEIVNDETIELISHAAVIQADAGADIIAPSEMMDGRVQ 184
           G+ITDVALDPFTIHGHDGIL +G+I+NDET+E+IS AAVIQADAGADIIAPSEMMDGRV+
Sbjct: 123 GVITDVALDPFTIHGHDGILRNGQIINDETVEIISQAAVIQADAGADIIAPSEMMDGRVR 182

Query: 185 EIRKKLDSHGHINVGIMPYVAKFNSSFYGPYRDAISTRDLLKGDKKTYYLDPANVQEAIR 244
           EIRK+LD  GHINV IMPY  KFNSSFYGPYRDAISTR LLK DKKTYYLDPAN QEAIR
Sbjct: 183 EIRKRLDDKGHINVCIMPYAVKFNSSFYGPYRDAISTRGLLKEDKKTYYLDPANAQEAIR 242

Query: 245 EASIDIQESADMLLVKPGLPYLDVCFRIKEKFGLPTFAYQVSGEYAMIKAASLQGWINKN 304
           EAS+DIQE ADMLL+KPGLPYLD+CFRIKEKFGLPTFAYQVSGEYAMIKAAS+QGWI++N
Sbjct: 243 EASMDIQEGADMLLIKPGLPYLDICFRIKEKFGLPTFAYQVSGEYAMIKAASIQGWIDQN 302

Query: 305 DAMMESLLAFKRAGCDGIFTYFAMEAARILTHS 337
           DAMMESLL+FKRAGCDGIFTYFAMEAA IL HS
Sbjct: 303 DAMMESLLSFKRAGCDGIFTYFAMEAAHILNHS 335


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|327192110|gb|EGE59087.1| delta-aminolevulinic acid dehydratase protein [Rhizobium etli CNPAF512] Length = 337 Back     alignment and organism information
>gi|227821526|ref|YP_002825496.1| delta-aminolevulinic acid dehydratase [Sinorhizobium fredii NGR234] Length = 337 Back     alignment and organism information
>gi|190891188|ref|YP_001977730.1| delta-aminolevulinic acid dehydratase [Rhizobium etli CIAT 652] Length = 337 Back     alignment and organism information
>gi|86357142|ref|YP_469034.1| delta-aminolevulinic acid dehydratase [Rhizobium etli CFN 42] Length = 337 Back     alignment and organism information
>gi|241203997|ref|YP_002975093.1| delta-aminolevulinic acid dehydratase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 337 Back     alignment and organism information
>gi|209548716|ref|YP_002280633.1| delta-aminolevulinic acid dehydratase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 337 Back     alignment and organism information
>gi|116251382|ref|YP_767220.1| delta-aminolevulinic acid dehydratase [Rhizobium leguminosarum bv. viciae 3841] Length = 337 Back     alignment and organism information
>gi|222148199|ref|YP_002549156.1| delta-aminolevulinic acid dehydratase [Agrobacterium vitis S4] Length = 337 Back     alignment and organism information
>gi|159184643|ref|NP_354180.2| delta-aminolevulinic acid dehydratase [Agrobacterium tumefaciens str. C58] Length = 337 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target337 delta-aminolevulinic acid dehydratase [Candidatus Liber
PRK09283323 PRK09283, PRK09283, delta-aminolevulinic acid dehydrata 1e-154
cd04823320 cd04823, ALAD_PBGS_aspartate_rich, Porphobilinogen synt 1e-137
COG0113330 COG0113, HemB, Delta-aminolevulinic acid dehydratase [C 1e-131
cd00384314 cd00384, ALAD_PBGS, Porphobilinogen synthase (PBGS), wh 1e-116
PRK13384322 PRK13384, PRK13384, delta-aminolevulinic acid dehydrata 2e-84
KOG2794340 KOG2794, KOG2794, KOG2794, Delta-aminolevulinic acid de 1e-79
cd04824320 cd04824, eu_ALAD_PBGS_cysteine_rich, Porphobilinogen sy 1e-67
pfam00490322 pfam00490, ALAD, Delta-aminolevulinic acid dehydratase 1e-148
>gnl|CDD|181755 PRK09283, PRK09283, delta-aminolevulinic acid dehydratase; Validated Back     alignment and domain information
>gnl|CDD|88599 cd04823, ALAD_PBGS_aspartate_rich, Porphobilinogen synthase (PBGS), which is also called delta-aminolevulinic acid dehydratase (ALAD), catalyzes the condensation of two 5-aminolevulinic acid (ALA) molecules to form the pyrrole porphobilinogen (PBG), which is the second step in the biosynthesis of tetrapyrroles, such as heme, vitamin B12 and chlorophyll Back     alignment and domain information
>gnl|CDD|30462 COG0113, HemB, Delta-aminolevulinic acid dehydratase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|88598 cd00384, ALAD_PBGS, Porphobilinogen synthase (PBGS), which is also called delta-aminolevulinic acid dehydratase (ALAD), catalyzes the condensation of two 5-aminolevulinic acid (ALA) molecules to form the pyrrole porphobilinogen (PBG), which is the second step in the biosynthesis of tetrapyrroles, such as heme, vitamin B12 and chlorophyll Back     alignment and domain information
>gnl|CDD|172020 PRK13384, PRK13384, delta-aminolevulinic acid dehydratase; Provisional Back     alignment and domain information
>gnl|CDD|38005 KOG2794, KOG2794, KOG2794, Delta-aminolevulinic acid dehydratase [Coenzyme transport and metabolism] Back     alignment and domain information
>gnl|CDD|88600 cd04824, eu_ALAD_PBGS_cysteine_rich, Porphobilinogen synthase (PBGS), which is also called delta-aminolevulinic acid dehydratase (ALAD), catalyzes the condensation of two 5-aminolevulinic acid (ALA) molecules to form the pyrrole porphobilinogen (PBG), which is the second step in the biosynthesis of tetrapyrroles, such as heme, vitamin B12 and chlorophyll Back     alignment and domain information
>gnl|CDD|144181 pfam00490, ALAD, Delta-aminolevulinic acid dehydratase Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 337 delta-aminolevulinic acid dehydratase [Candidatus Liber
pfam00490322 ALAD Delta-aminolevulinic acid dehydratase. 100.0
cd04823320 ALAD_PBGS_aspartate_rich Porphobilinogen synthase (PBGS 100.0
PRK09283321 delta-aminolevulinic acid dehydratase; Validated 100.0
COG0113330 HemB Delta-aminolevulinic acid dehydratase [Coenzyme me 100.0
PRK13384323 delta-aminolevulinic acid dehydratase; Provisional 100.0
cd00384314 ALAD_PBGS Porphobilinogen synthase (PBGS), which is als 100.0
cd04824320 eu_ALAD_PBGS_cysteine_rich Porphobilinogen synthase (PB 100.0
KOG2794340 consensus 100.0
PRK12330 499 oxaloacetate decarboxylase; Provisional 94.28
PRK07028 429 bifunctional hexulose-6-phosphate synthase/ribonuclease 97.29
TIGR03551343 F420_cofH 7,8-didemethyl-8-hydroxy-5-deazariboflavin sy 96.17
PRK07360375 FO synthase subunit 2; Reviewed 95.55
PRK12331 463 oxaloacetate decarboxylase; Provisional 95.45
COG5016 472 Pyruvate/oxaloacetate carboxyltransferase [Energy produ 95.36
PRK08445348 hypothetical protein; Provisional 95.33
COG1060370 ThiH Thiamine biosynthesis enzyme ThiH and related unch 95.32
PRK12999 1147 pyruvate carboxylase; Reviewed 95.02
PRK09282 580 pyruvate carboxylase subunit B; Validated 94.88
PRK12581 468 oxaloacetate decarboxylase; Provisional 94.67
PRK08645 608 bifunctional homocysteine S-methyltransferase/5,10-meth 94.53
PRK08444353 hypothetical protein; Provisional 94.44
PRK05927350 hypothetical protein; Provisional 94.43
PRK08645 608 bifunctional homocysteine S-methyltransferase/5,10-meth 93.31
TIGR01108 616 oadA oxaloacetate decarboxylase alpha subunit; InterPro 91.67
COG0269217 SgbH 3-hexulose-6-phosphate synthase and related protei 91.3
cd04729219 NanE N-acetylmannosamine-6-phosphate epimerase (NanE) c 91.28
PRK09240371 thiH thiamine biosynthesis protein ThiH; Reviewed 90.99
pfam00682237 HMGL-like HMGL-like. This family contains a diverse set 90.63
PRK13305220 sgbH 3-keto-L-gulonate-6-phosphate decarboxylase; Provi 90.15
PRK08508279 biotin synthase; Provisional 95.06
PRK07094323 biotin synthase; Provisional 94.93
TIGR00423331 TIGR00423 conserved hypothetical protein TIGR00423; Int 94.19
PRK06256325 biotin synthase; Validated 93.75
PRK00311266 panB 3-methyl-2-oxobutanoate hydroxymethyltransferase; 93.34
pfam00478467 IMPDH IMP dehydrogenase / GMP reductase domain. This fa 93.12
TIGR01302476 IMP_dehydrog inosine-5'-monophosphate dehydrogenase; In 91.01
TIGR01108 616 oadA oxaloacetate decarboxylase alpha subunit; InterPro 90.38
PRK11320292 prpB 2-methylisocitrate lyase; Provisional 95.01
PRK13307392 bifunctional formaldehyde-activating enzyme/3-hexulose- 93.93
PRK09234 846 fbiC FO synthase; Reviewed 94.37
PRK09549411 mtnW 2,3-diketo-5-methylthiopentyl-1-phosphate enolase; 94.24
TIGR03332407 salvage_mtnW 2,3-diketo-5-methylthiopentyl-1-phosphate 93.81
TIGR03326412 rubisco_III ribulose bisphosphate carboxylase, type III 92.51
pfam02548261 Pantoate_transf Ketopantoate hydroxymethyltransferase. 94.22
cd00381325 IMPDH IMPDH: The catalytic domain of the inosine monoph 90.01
cd06557254 KPHMT-like Ketopantoate hydroxymethyltransferase (KPHMT 93.3
cd00377243 ICL_PEPM Members of the ICL/PEPM enzyme family catalyze 92.95
cd00377243 ICL_PEPM Members of the ICL/PEPM enzyme family catalyze 92.92
PRK05926371 hypothetical protein; Provisional 92.32
pfam05853274 DUF849 Prokaryotic protein of unknown function (DUF849) 91.34
PRK10200230 putative racemase; Provisional 91.27
KOG0369 1176 consensus 90.63
>pfam00490 ALAD Delta-aminolevulinic acid dehydratase Back     alignment and domain information
>cd04823 ALAD_PBGS_aspartate_rich Porphobilinogen synthase (PBGS), which is also called delta-aminolevulinic acid dehydratase (ALAD), catalyzes the condensation of two 5-aminolevulinic acid (ALA) molecules to form the pyrrole porphobilinogen (PBG), which is the second step in the biosynthesis of tetrapyrroles, such as heme, vitamin B12 and chlorophyll Back     alignment and domain information
>PRK09283 delta-aminolevulinic acid dehydratase; Validated Back     alignment and domain information
>COG0113 HemB Delta-aminolevulinic acid dehydratase [Coenzyme metabolism] Back     alignment and domain information
>PRK13384 delta-aminolevulinic acid dehydratase; Provisional Back     alignment and domain information
>cd00384 ALAD_PBGS Porphobilinogen synthase (PBGS), which is also called delta-aminolevulinic acid dehydratase (ALAD), catalyzes the condensation of two 5-aminolevulinic acid (ALA) molecules to form the pyrrole porphobilinogen (PBG), which is the second step in the biosynthesis of tetrapyrroles, such as heme, vitamin B12 and chlorophyll Back     alignment and domain information
>cd04824 eu_ALAD_PBGS_cysteine_rich Porphobilinogen synthase (PBGS), which is also called delta-aminolevulinic acid dehydratase (ALAD), catalyzes the condensation of two 5-aminolevulinic acid (ALA) molecules to form the pyrrole porphobilinogen (PBG), which is the second step in the biosynthesis of tetrapyrroles, such as heme, vitamin B12 and chlorophyll Back     alignment and domain information
>KOG2794 consensus Back     alignment and domain information
>PRK12330 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>PRK07028 bifunctional hexulose-6-phosphate synthase/ribonuclease regulator; Validated Back     alignment and domain information
>TIGR03551 F420_cofH 7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase, CofH subunit Back     alignment and domain information
>PRK07360 FO synthase subunit 2; Reviewed Back     alignment and domain information
>PRK12331 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>COG5016 Pyruvate/oxaloacetate carboxyltransferase [Energy production and conversion] Back     alignment and domain information
>PRK08445 hypothetical protein; Provisional Back     alignment and domain information
>COG1060 ThiH Thiamine biosynthesis enzyme ThiH and related uncharacterized enzymes [Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>PRK12999 pyruvate carboxylase; Reviewed Back     alignment and domain information
>PRK09282 pyruvate carboxylase subunit B; Validated Back     alignment and domain information
>PRK12581 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>PRK08645 bifunctional homocysteine S-methyltransferase/5,10-methylenetetrahydrofolate reductase protein; Reviewed Back     alignment and domain information
>PRK08444 hypothetical protein; Provisional Back     alignment and domain information
>PRK05927 hypothetical protein; Provisional Back     alignment and domain information
>PRK08645 bifunctional homocysteine S-methyltransferase/5,10-methylenetetrahydrofolate reductase protein; Reviewed Back     alignment and domain information
>TIGR01108 oadA oxaloacetate decarboxylase alpha subunit; InterPro: IPR005776 This family describes the bacterial oxaloacetate decarboxylase alpha subunit and its equivalents in archaea Back     alignment and domain information
>COG0269 SgbH 3-hexulose-6-phosphate synthase and related proteins [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd04729 NanE N-acetylmannosamine-6-phosphate epimerase (NanE) converts N-acetylmannosamine-6-phosphate to N-acetylglucosamine-6-phosphate Back     alignment and domain information
>PRK09240 thiH thiamine biosynthesis protein ThiH; Reviewed Back     alignment and domain information
>pfam00682 HMGL-like HMGL-like Back     alignment and domain information
>PRK13305 sgbH 3-keto-L-gulonate-6-phosphate decarboxylase; Provisional Back     alignment and domain information
>PRK08508 biotin synthase; Provisional Back     alignment and domain information
>PRK07094 biotin synthase; Provisional Back     alignment and domain information
>TIGR00423 TIGR00423 conserved hypothetical protein TIGR00423; InterPro: IPR005244 This entry describes a family of conserved hypothetical proteins with no known function Back     alignment and domain information
>PRK06256 biotin synthase; Validated Back     alignment and domain information
>PRK00311 panB 3-methyl-2-oxobutanoate hydroxymethyltransferase; Reviewed Back     alignment and domain information
>pfam00478 IMPDH IMP dehydrogenase / GMP reductase domain Back     alignment and domain information
>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase; InterPro: IPR005990 Synonyms: Inosine-5'-monophosphate dehydrogenase, Inosinic acid dehydrogenase IMP dehydrogenase (1 Back     alignment and domain information
>TIGR01108 oadA oxaloacetate decarboxylase alpha subunit; InterPro: IPR005776 This family describes the bacterial oxaloacetate decarboxylase alpha subunit and its equivalents in archaea Back     alignment and domain information
>PRK11320 prpB 2-methylisocitrate lyase; Provisional Back     alignment and domain information
>PRK13307 bifunctional formaldehyde-activating enzyme/3-hexulose-6-phosphate synthase; Provisional Back     alignment and domain information
>PRK09234 fbiC FO synthase; Reviewed Back     alignment and domain information
>PRK09549 mtnW 2,3-diketo-5-methylthiopentyl-1-phosphate enolase; Reviewed Back     alignment and domain information
>TIGR03332 salvage_mtnW 2,3-diketo-5-methylthiopentyl-1-phosphate enolase Back     alignment and domain information
>TIGR03326 rubisco_III ribulose bisphosphate carboxylase, type III Back     alignment and domain information
>pfam02548 Pantoate_transf Ketopantoate hydroxymethyltransferase Back     alignment and domain information
>cd00381 IMPDH IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase Back     alignment and domain information
>cd06557 KPHMT-like Ketopantoate hydroxymethyltransferase (KPHMT) is the first enzyme in the pantothenate biosynthesis pathway Back     alignment and domain information
>cd00377 ICL_PEPM Members of the ICL/PEPM enzyme family catalyze either P-C or C-C bond formation/cleavage Back     alignment and domain information
>cd00377 ICL_PEPM Members of the ICL/PEPM enzyme family catalyze either P-C or C-C bond formation/cleavage Back     alignment and domain information
>PRK05926 hypothetical protein; Provisional Back     alignment and domain information
>pfam05853 DUF849 Prokaryotic protein of unknown function (DUF849) Back     alignment and domain information
>PRK10200 putative racemase; Provisional Back     alignment and domain information
>KOG0369 consensus Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target337 delta-aminolevulinic acid dehydratase [Candidatus Liber
1w5o_A337 Stepwise Introduction Of Zinc Binding Site Into Por 1e-117
1w5p_A337 Stepwise Introduction Of Zinc Binding Site Into Por 1e-117
1w5n_A337 Stepwise Introduction Of Zinc Binding Site Into Por 1e-117
1w56_A337 Stepwise Introduction Of Zinc Binding Site Into Por 1e-117
1w5q_A337 Stepwise Introduction Of Zinc Binding Site Into Por 1e-117
1w5m_A337 Stepwise Introduction Of Zinc Binding Site Into Por 1e-117
1w54_A337 Stepwise Introduction Of A Zinc Binding Site Into P 1e-116
1b4k_A337 High Resolution Crystal Structure Of A Mg2-Dependen 1e-116
2c15_A337 5-(4-Carboxy-2-Oxo-Butoxy)-4-Oxo-Pentanoic Acid Aci 1e-115
1gzg_A337 Complex Of A Mg2-Dependent Porphobilinogen Synthase 1e-115
2c14_A337 5-(4-Carboxy-2-Oxo-Butylamino)-4-Oxo-Pentanoic Acid 1e-110
2c13_A337 5-Hydroxy-Levulinic Acid Bound To Porphobilinogen S 1e-110
1w1z_A328 Structure Of The Plant Like 5-Amino Laevulinic Acid 1e-108
1i8j_A323 Crystal Structure Of Porphobilinogen Synthase Compl 1e-100
1b4e_A323 X-Ray Structure Of 5-Aminolevulinic Acid Dehydratas 1e-100
1l6s_A323 Crystal Structure Of Porphobilinogen Synthase Compl 1e-100
3obk_A356 Crystal Structure Of Delta-Aminolevulinic Acid Dehy 8e-99
2z1b_A330 Crystal Structure Of 5-Aminolevulinic Acid Dehydrat 8e-93
1e51_A330 Crystal Structure Of Native Human Erythrocyte 5- Am 3e-90
1pv8_A330 Crystal Structure Of A Low Activity F12l Mutant Of 4e-90
2z0i_A330 Crystal Structure Of 5-Aminolevulinic Acid Dehydrat 7e-89
1ylv_A342 Schiff-Base Complex Of Yeast 5-Aminolaevulinic Acid 5e-85
1eb3_A340 Yeast 5-Aminolaevulinic Acid Dehydratase 4,7-Dioxos 3e-84
1qnv_A342 Yeast 5-Aminolaevulinic Acid Dehydratase Lead (Pb) 3e-84
1h7o_A341 Schiff-Base Complex Of Yeast 5-Aminolaevulinic Acid 3e-84
1aw5_A340 5-Aminolevulinate Dehydratase From Saccharomyces Ce 1e-81
>gi|60593809|pdb|1W5O|A Chain A, Stepwise Introduction Of Zinc Binding Site Into Porphobilinogen Synthase Of Pseudomonas Aeruginosa (Mutations A129c, D131c And D139c) Length = 337 Back     alignment and structure
 Score =  427 bits (1098), Expect = e-117,   Method: Composition-based stats.
 Identities = 153/331 (46%), Positives = 221/331 (66%), Gaps = 3/331 (0%)

Query: 8   SHKICCHRRMRRNRKSNWIREMVREHRLSVSDLILPIFLTSGEKTVESINSMPDVMRMSI 67
           +++   + R+RRNR+ ++ R +VRE+ L+V DLILP+F+  G    ESI SMP V R+SI
Sbjct: 6   ANRAYPYTRLRRNRRDDFSRRLVRENVLTVDDLILPVFVLDGVNQRESIPSMPGVERLSI 65

Query: 68  DVAVEKIKQVADLGIPAIAIFPNIPMDLRNNTGSHIIDPDNLINEGICAIKKNIPNIGII 127
           D  + + ++   LGIPA+A+FP  P++ ++   +   +P+ +      A+++  P +GII
Sbjct: 66  DQLLIEAEEWVALGIPALALFPVTPVEKKSLDAAEAYNPEGIAQRATRALRERFPELGII 125

Query: 128 TDVALDPFTIHGHDGILCDGEI-VNDETIELISHAAVIQADAGADIIAPSEMMDGRVQEI 186
           TDV L PFT HG  GIL D    +ND +I+++   A+  A+AGA ++APS+MMDGR+  I
Sbjct: 126 TDVCLCPFTTHGQCGILDDDGYVLNDVSIDVLVRQALSHAEAGAQVVAPSDMMDGRIGAI 185

Query: 187 RKKLDSHGHINVGIMPYVAKFNSSFYGPYRDAISTRDLLKGDKK-TYYLDPANVQEAIRE 245
           R+ L+S GH NV +M Y AK+ S++YGP+RDA+ +   L    K TY +DPAN  EA+ E
Sbjct: 186 REALESAGHTNVRVMAYSAKYASAYYGPFRDAVGSASNLGKGNKATYQMDPANSDEALHE 245

Query: 246 ASIDIQESADMLLVKPGLPYLDVCFRIKEKFGLPTFAYQVSGEYAMIKAASLQGWINKND 305
            + D+ E ADM++VKPG+PYLD+  R+K++F  PTF YQVSGEYAM   A   GW+ +  
Sbjct: 246 VAADLAEGADMVMVKPGMPYLDIVRRVKDEFRAPTFVYQVSGEYAMHMGAIQNGWLAE-S 304

Query: 306 AMMESLLAFKRAGCDGIFTYFAMEAARILTH 336
            ++ESL AFKRAG DGI TYFA +AA  L  
Sbjct: 305 VILESLTAFKRAGADGILTYFAKQAAEQLRR 335


>gi|60593811|pdb|1W5P|A Chain A, Stepwise Introduction Of Zinc Binding Site Into Porphobilinogen Synthase Of Pseudomonas Aeruginosa (Mutations A129c, D131c, D139c, P132e) Length = 337 Back     alignment and structure
>gi|60593807|pdb|1W5N|A Chain A, Stepwise Introduction Of Zinc Binding Site Into Porphobilinogen Synthase Of Pseudomonas Aeruginosa (Mutations D131c And D139c) Length = 337 Back     alignment and structure
>gi|60593803|pdb|1W56|A Chain A, Stepwise Introduction Of Zinc Binding Site Into Porphobilinogen Synthase Of Pseudomonas Aeruginosa (Mutations A129c And D131c) Length = 337 Back     alignment and structure
>gi|60593813|pdb|1W5Q|A Chain A, Stepwise Introduction Of Zinc Binding Site Into Porphobilinogen Synthase Of Pseudomonas Aeruginosa (Mutations A129c, D131c, D139c, P132e, K229r) Length = 337 Back     alignment and structure
>gi|60593805|pdb|1W5M|A Chain A, Stepwise Introduction Of Zinc Binding Site Into Porphobilinogen Synthase Of Pseudomonas Aeruginosa (Mutations A129c And D139c) Length = 337 Back     alignment and structure
>gi|60593801|pdb|1W54|A Chain A, Stepwise Introduction Of A Zinc Binding Site Into Porphobilinogen Synthase From Pseudomonas Aeruginosa (Mutation D139c) Length = 337 Back     alignment and structure
gi|5821790|pdb|1B4K|A Chain A, High Resolution Crystal Structure Of A Mg2-Dependent 5- Aminolevulinic Acid Dehydratase Length = 337 Back     alignment and structure
>gi|110590899|pdb|2C15|A Chain A, 5-(4-Carboxy-2-Oxo-Butoxy)-4-Oxo-Pentanoic Acid Acid Bound To Porphobilinogen Synthase From Pseudomonas Aeruginosa Length = 337 Back     alignment and structure
>gi|21730306|pdb|1GZG|A Chain A, Complex Of A Mg2-Dependent Porphobilinogen Synthase From Pseudomonas Aeruginosa (Mutant D139n) With 5- Fluorolevulinic Acid Length = 337 Back     alignment and structure
>gi|110590897|pdb|2C14|A Chain A, 5-(4-Carboxy-2-Oxo-Butylamino)-4-Oxo-Pentanoic Acid Acid Bound To Porphobilinogen Synthase From Pseudomonas Aeruginosa Length = 337 Back     alignment and structure
>gi|110590895|pdb|2C13|A Chain A, 5-Hydroxy-Levulinic Acid Bound To Porphobilinogen Synthase From Pseudomonas Aeruginosa Length = 337 Back     alignment and structure
gi|55670523|pdb|1W1Z|A Chain A, Structure Of The Plant Like 5-Amino Laevulinic Acid Dehydratase From Chlorobium Vibrioforme Length = 328 Back     alignment and structure
>gi|14719676|pdb|1I8J|A Chain A, Crystal Structure Of Porphobilinogen Synthase Complexed With The Inhibitor 4,7-Dioxosebacic Acid Length = 323 Back     alignment and structure
>gi|6730099|pdb|1B4E|A Chain A, X-Ray Structure Of 5-Aminolevulinic Acid Dehydratase Complexed With The Inhibitor Levulinic Acid Length = 323 Back     alignment and structure
>gi|20664299|pdb|1L6S|A Chain A, Crystal Structure Of Porphobilinogen Synthase Complexed With The Inhibitor 4,7-Dioxosebacic Acid Length = 323 Back     alignment and structure
>gi|313754596|pdb|3OBK|A Chain A, Crystal Structure Of Delta-Aminolevulinic Acid Dehydratase (Porphobilinogen Synthase) From Toxoplasma Gondii Me49 In Complex With The Reaction Product Porphobilinogen Length = 356 Back     alignment and structure
>gi|188036180|pdb|2Z1B|A Chain A, Crystal Structure Of 5-Aminolevulinic Acid Dehydratase (Alad) From Mus Musculs Length = 330 Back     alignment and structure
gi|15826298|pdb|1E51|A Chain A, Crystal Structure Of Native Human Erythrocyte 5- Aminolaevulinic Acid Dehydratase Length = 330 Back     alignment and structure
>gi|34809798|pdb|1PV8|A Chain A, Crystal Structure Of A Low Activity F12l Mutant Of Human Porphobilinogen Synthase Length = 330 Back     alignment and structure
>gi|188036156|pdb|2Z0I|A Chain A, Crystal Structure Of 5-Aminolevulinic Acid Dehydratase (Alad) From Mus Musculus Length = 330 Back     alignment and structure
>gi|7245674|pdb|1YLV|A Chain A, Schiff-Base Complex Of Yeast 5-Aminolaevulinic Acid Dehydratase With Laevulinic Acid Length = 342 Back     alignment and structure
>gi|15825885|pdb|1EB3|A Chain A, Yeast 5-Aminolaevulinic Acid Dehydratase 4,7-Dioxosebacic Acid Complex Length = 340 Back     alignment and structure
gi|11514397|pdb|1QNV|A Chain A, Yeast 5-Aminolaevulinic Acid Dehydratase Lead (Pb) Complex Length = 342 Back     alignment and structure
>gi|15826422|pdb|1H7O|A Chain A, Schiff-Base Complex Of Yeast 5-Aminolaevulinic Acid Dehydratase With 5-Aminolaevulinic Acid At 1.7 A Resolution Length = 341 Back     alignment and structure
>gi|157830112|pdb|1AW5|A Chain A, 5-Aminolevulinate Dehydratase From Saccharomyces Cerevisiae Length = 340 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target337 delta-aminolevulinic acid dehydratase [Candidatus Liber
1l6s_A323 Porphobilinogen synthase; dehydratase, lyase; HET: CME 1e-119
3obk_A360 Delta-aminolevulinic acid dehydratase; ssgcid, structur 1e-119
1pv8_A330 Delta-aminolevulinic acid dehydratase; porphobilinogen 1e-114
1h7n_A342 5-aminolaevulinic acid dehydratase; lyase, aldolase, TI 1e-113
1w5q_A337 Delta-aminolevulinic acid dehydratase; synthase, evolut 1e-100
1w1z_A328 Delta-aminolevulinic acid dehydratase; synthase, tetrap 4e-96
>1l6s_A Porphobilinogen synthase; dehydratase, lyase; HET: CME DSB; 1.70A {Escherichia coli} SCOP: c.1.10.3 PDB: 1i8j_A* 1l6y_A* 1b4e_A Length = 323 Back     alignment and structure
 Score =  423 bits (1088), Expect = e-119
 Identities = 136/318 (42%), Positives = 198/318 (62%), Gaps = 4/318 (1%)

Query: 15  RRMRRNRKSNWIREMVREHRLSVSDLILPIFLTSGEKTVESINSMPDVMRMSIDVAVEKI 74
           +R RR RKS  +R M  E  LS++DL+LPIF+       +++ +MP VMR+       +I
Sbjct: 5   QRPRRLRKSPALRAMFEETTLSLNDLVLPIFVEEEIDDYKAVEAMPGVMRIPEKHLAREI 64

Query: 75  KQVADLGIPAIAIFPNIPMDLRNNTGSHIIDPDNLINEGICAIKKNIPNIGIITDVALDP 134
           +++A+ GI ++  F        + TGS     D L+       K+ +P + +++D     
Sbjct: 65  ERIANAGIRSVMTFGISHH--TDETGSDAWREDGLVARMSRICKQTVPEMIVMSDTCFCE 122

Query: 135 FTIHGHDGILCDGEIVNDETIELISHAAVIQADAGADIIAPSEMMDGRVQEIRKKLDSHG 194
           +T HGH G+LC+  + ND T+E +   AV+ A AGAD IAPS  MDG+VQ IR+ LD+ G
Sbjct: 123 YTSHGHCGVLCEHGVDNDATLENLGKQAVVAAAAGADFIAPSAAMDGQVQAIRQALDAAG 182

Query: 195 HINVGIMPYVAKFNSSFYGPYRDAISTRDLLKGDKKTYYLDPANVQEAIREASIDIQESA 254
             +  IM Y  KF SSFYGP+R+A  +   LKGD+K+Y ++P N +EAIRE+ +D  + A
Sbjct: 183 FKDTAIMSYSTKFASSFYGPFREAAGSA--LKGDRKSYQMNPMNRREAIRESLLDEAQGA 240

Query: 255 DMLLVKPGLPYLDVCFRIKEKFGLPTFAYQVSGEYAMIKAASLQGWINKNDAMMESLLAF 314
           D L+VKP   YLD+   ++E+  LP  AYQVSGEYAMIK A+L G I++   ++ESL + 
Sbjct: 241 DCLMVKPAGAYLDIVRELRERTELPIGAYQVSGEYAMIKFAALAGAIDEEKVVLESLGSI 300

Query: 315 KRAGCDGIFTYFAMEAAR 332
           KRAG D IF+YFA++ A 
Sbjct: 301 KRAGADLIFSYFALDLAE 318


>1pv8_A Delta-aminolevulinic acid dehydratase; porphobilinogen synthase, tetrapyrrole biosynthesis, reaction intermediate, lyase; HET: PB1; 2.20A {Homo sapiens} SCOP: c.1.10.3 PDB: 1e51_A* 2z0i_A 2z1b_A Length = 330 Back     alignment and structure
>1h7n_A 5-aminolaevulinic acid dehydratase; lyase, aldolase, TIM barrel, tetrapyrrole synthesis; HET: SHF; 1.6A {Saccharomyces cerevisiae} SCOP: c.1.10.3 PDB: 1h7p_A* 1h7r_A* 1ohl_A* 1qml_A 1qnv_A 1w31_A* 1h7o_A* 1eb3_A* 1gjp_A* 1ylv_A* 1aw5_A Length = 342 Back     alignment and structure
>1w5q_A Delta-aminolevulinic acid dehydratase; synthase, evolution, metalloenzyme, porphobilinogen synthase, protein engineering,; 1.4A {Pseudomonas aeruginosa} PDB: 1w5p_A* 1w5o_A 1w5n_A 1w56_A 1w5m_A 1w54_A 1gzg_A* 1b4k_A 2woq_A* 2c14_A* 2c16_A* 2c19_A* 2c15_A* 2c18_A* 2c13_A* Length = 337 Back     alignment and structure
>1w1z_A Delta-aminolevulinic acid dehydratase; synthase, tetrapyrrole biosynthesis, ALAD, porphyrin biosynthesis, heme biosynthesis, lyase; 2.6A {Prosthecochloris vibrioformis} SCOP: c.1.10.3 PDB: 2c1h_A* Length = 328 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target337 delta-aminolevulinic acid dehydratase [Candidatus Liber
1w5q_A337 Delta-aminolevulinic acid dehydratase; synthase, evolut 100.0
3obk_A360 Delta-aminolevulinic acid dehydratase; ssgcid, structur 100.0
1w1z_A328 Delta-aminolevulinic acid dehydratase; synthase, tetrap 100.0
1l6s_A323 Porphobilinogen synthase; dehydratase, lyase; HET: CME 100.0
1h7n_A342 5-aminolaevulinic acid dehydratase; lyase, aldolase, TI 100.0
1pv8_A330 Delta-aminolevulinic acid dehydratase; porphobilinogen 100.0
1ykw_A 435 Rubisco-like protein; beta-alpha-barrel, unknown functi 96.65
2qyg_A452 Ribulose bisphosphate carboxylase-like protein 2; beta- 96.25
3kdn_A 444 Rubisco, ribulose bisphosphate carboxylase; ribulose-1, 95.72
1wdd_A 477 Ribulose bisphosphate carboxylase large chain; rubisco, 94.89
2d69_A 430 Ribulose bisphosphate carboxylase; alpha/beta barrel, s 94.7
3l5l_A363 Xenobiotic reductase A; TIM barrel, oxidoreductase; HET 95.92
2ze3_A275 DFA0005; organic waste LEFT-OVER decomposition, alkalip 95.89
3nwr_A 432 A rubisco-like protein; lyase; HET: KCX; 1.50A {Burkhol 94.51
2oem_A 413 2,3-diketo-5-methylthiopentyl-1-phosphate enolase; rubi 94.23
3eoo_A298 Methylisocitrate lyase; seattle structural genomics cen 94.1
2zvi_A425 2,3-diketo-5-methylthiopentyl-1-phosphate enolase; meth 94.09
3fk4_A 414 Rubisco-like protein; structural genomics, target 9463A 94.06
1o66_A275 3-methyl-2-oxobutanoate hydroxymethyltransferase; struc 94.83
3bg3_A 718 Pyruvate carboxylase, mitochondrial; TIM barrel, ATP-bi 93.48
3c6c_A316 3-keto-5-aminohexanoate cleavage enzyme; YP_293392.1, p 93.58
3no5_A275 Uncharacterized protein; PFAM DUF849 domain containing 92.79
3chv_A284 Prokaryotic domain of unknown function (DUF849) W barre 92.38
1xg4_A295 Probable methylisocitrate lyase; 2-methylisocitrate lya 93.08
1lt8_A406 Betaine-homocysteine methyltransferase; homocysteine me 92.43
3b8i_A287 PA4872 oxaloacetate decarboxylase; alpha/beta barrel, h 90.49
1zlp_A318 PSR132, petal death protein; TIM-barrel, helix swapping 91.35
2xed_A273 Putative maleate isomerase; nicotinic acid catabolism, 90.92
>1w5q_A Delta-aminolevulinic acid dehydratase; synthase, evolution, metalloenzyme, porphobilinogen synthase, protein engineering,; 1.4A {Pseudomonas aeruginosa} PDB: 1w5p_A* 1w5o_A 1w5n_A 1w56_A 1w5m_A 1w54_A 1gzg_A* 1b4k_A 2woq_A* 2c14_A* 2c16_A* 2c19_A* 2c15_A* 2c18_A* 2c13_A* Back     alignment and structure
Probab=100.00  E-value=0  Score=1117.13  Aligned_cols=328  Identities=47%  Similarity=0.830  Sum_probs=322.3

Q ss_pred             CCCCCCCCCCCCCCCHHHHHHHHCCCCCHHHCCCCEEEECCCCCEEECCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEE
Q ss_conf             55788858563128988999863477888773311666758988110488878632889999999999998889367633
Q gi|255764463|r    9 HKICCHRRMRRNRKSNWIREMVREHRLSVSDLILPIFLTSGEKTVESINSMPDVMRMSIDVAVEKIKQVADLGIPAIAIF   88 (337)
Q Consensus         9 ~~~~p~~R~RRlR~~~~iR~Lv~Et~Ls~~dLI~PiFV~eg~~~k~~I~SMPGv~R~Sid~L~~eie~~~~lGI~av~LF   88 (337)
                      ++.||++||||||+|+|+|+||+||+|+++|||||+||+||.+.++||+||||+||||+|.|++++++++++||++|+||
T Consensus         7 ~~~fP~~R~RRlR~~~~iR~Lv~Et~Ls~~dLI~PiFV~Eg~~~kepI~SMPGv~R~Sid~L~~eie~~~~lGI~aV~LF   86 (337)
T 1w5q_A            7 NRAYPYTRLRRNRRDDFSRRLVRENVLTVDDLILPVFVLDGVNQRESIPSMPGVERLSIDQLLIEAEEWVALGIPALALF   86 (337)
T ss_dssp             CCCTTTCCTTTTTSSHHHHHHHCCCCCCGGGEEEEEEEESSSSCEEECTTSTTCEEEEHHHHHHHHHHHHHTTCCEEEEE
T ss_pred             CCCCCCCCCCCCCCCHHHHHHHHCCCCCHHHCEEEEEEEECCCCCEECCCCCCCEEECHHHHHHHHHHHHHCCCCEEEEE
T ss_conf             78899877665689878999984378888996620599408998335689998436689999999999998799789980


Q ss_pred             ECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEECCCCCHHHCCCCCCCCC-CCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             025633455445421576537999999999730144798613327100114310013-6544628999999999999996
Q gi|255764463|r   89 PNIPMDLRNNTGSHIIDPDNLINEGICAIKKNIPNIGIITDVALDPFTIHGHDGILC-DGEIVNDETIELISHAAVIQAD  167 (337)
Q Consensus        89 p~I~~~~Kd~~GseA~n~dglv~rAIr~IK~~fpdl~vi~DVcLc~YT~hGHcGi~~-~g~IdND~Tl~~L~k~Al~~A~  167 (337)
                      |++++++||+.|++|||+||++|||||.||+.||||+|||||||||||+||||||++ +|.||||+|+++|+|||++||+
T Consensus        87 gvi~~~~Kd~~gs~A~n~~~lv~raIr~iK~~fp~l~vi~DVcLc~YT~hGHcGil~~~g~idND~Tl~~L~~~Al~~A~  166 (337)
T 1w5q_A           87 PVTPVEKKSLDAAEAYNPEGIAQRATRALRERFPELGIITDVCLCEFTTHGQCGILDDDGYVLNDVSIDVLVRQALSHAE  166 (337)
T ss_dssp             ECCCGGGCBSSCGGGGCTTSHHHHHHHHHHHHCTTSEEEEEECSTTTBTTCCSSCBCTTSCBCHHHHHHHHHHHHHHHHH
T ss_pred             CCCCCCCCCCCCHHCCCCCCHHHHHHHHHHHHHCCEEEEEEECCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             41146667888501069632899999999986064699975203567786776622688866568999999999999998


Q ss_pred             CCCCEEECCCCCCCHHHHHHHHHHHCCCCCCCEECHHHHHHHHHHCCHHHHHHCCCCC-CCCCCCCCCCCCHHHHHHHHH
Q ss_conf             2897352466767799999999987788577300336664354301016753102446-777744315721147889888
Q gi|255764463|r  168 AGADIIAPSEMMDGRVQEIRKKLDSHGHINVGIMPYVAKFNSSFYGPYRDAISTRDLL-KGDKKTYYLDPANVQEAIREA  246 (337)
Q Consensus       168 AGaDivAPSdMMDGrV~aIR~~Ld~~g~~~~~ImsYsaKfaS~fYgPFRdA~~S~p~~-~gdr~sYQmd~~n~~eA~~e~  246 (337)
                      ||||+|||||||||||++||++||++||++|+|||||+||||+||||||||++|+|+| +|||+||||||+|++||++|+
T Consensus       167 AGaDivAPSdMMDGrV~aIR~~Ld~~g~~~~~ImSYsaKfaS~fYGPFRdA~~S~p~~~~gdr~~YQmd~~n~~eAl~e~  246 (337)
T 1w5q_A          167 AGAQVVAPSDMMDGRIGAIREALESAGHTNVRVMAYSAKYASAYYGPFRDAVGSASNLGKGNRATYQMDPANSDEALHEV  246 (337)
T ss_dssp             TTCSEEEECSCCTTHHHHHHHHHHHTTCTTCEEEEEEEEBCCGGGHHHHHC----------CGGGTSBCTTCSHHHHHHH
T ss_pred             HCCCEECCHHCCCCHHHHHHHHHHHCCCCCCCCHHHHHHHHHHCCCHHHHHHCCCCCCCCCCEEEEECCCCCHHHHHHHH
T ss_conf             17980441311466899999999976997762012356664631135788742765557888226636998989999999


Q ss_pred             HHHHHCCCCEEEECCCHHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCCEEEECH
Q ss_conf             87664089879955311458999999962499899993461899999999888978899999999999772699998201
Q gi|255764463|r  247 SIDIQESADMLLVKPGLPYLDVCFRIKEKFGLPTFAYQVSGEYAMIKAASLQGWINKNDAMMESLLAFKRAGCDGIFTYF  326 (337)
Q Consensus       247 ~~D~~EGAD~lMVKPa~~yLDii~~~k~~~~~P~~aYqVSGEYami~~a~~~g~~d~~~~~~E~l~~~kRAGAd~IitY~  326 (337)
                      .+|++||||||||||||||||||+++|++|++|++||||||||||||+|+++||+|+ ++++|+|++|||||||+|||||
T Consensus       247 ~~D~~EGAD~lMVKPa~~yLDii~~~k~~~~~Pv~aYqVSGEYamik~a~~~g~~~~-~~~~E~l~~~kRAGAd~IitY~  325 (337)
T 1w5q_A          247 AADLAEGADMVMVKPGMPYLDIVRRVKDEFRAPTFVYQVSGEYAMHMGAIQNGWLAE-SVILESLTAFKRAGADGILTYF  325 (337)
T ss_dssp             HHHHHTTCSEEEEESCGGGHHHHHHHHHHHCSCEEEEECHHHHHHHHHHHHTTSSCT-THHHHHHHHHHHHTCSEEEETT
T ss_pred             HHHHHCCCCEEEECCCCHHHHHHHHHHHCCCCCEEEEECHHHHHHHHHHHHCCCCCH-HHHHHHHHHHHHCCCCEEEECC
T ss_conf             851753987799626515899999999726998799976199999999998699507-5999999999865998998700


Q ss_pred             HHHHHHHHHCC
Q ss_conf             89999998509
Q gi|255764463|r  327 AMEAARILTHS  337 (337)
Q Consensus       327 A~~~a~~L~~~  337 (337)
                      |+++|+||++.
T Consensus       326 A~~~a~~L~~~  336 (337)
T 1w5q_A          326 AKQAAEQLRRG  336 (337)
T ss_dssp             HHHHHHHHHC-
T ss_pred             HHHHHHHHHCC
T ss_conf             99999998567



>1w1z_A Delta-aminolevulinic acid dehydratase; synthase, tetrapyrrole biosynthesis, ALAD, porphyrin biosynthesis, heme biosynthesis, lyase; 2.6A {Prosthecochloris vibrioformis} SCOP: c.1.10.3 PDB: 2c1h_A* Back     alignment and structure
>1l6s_A Porphobilinogen synthase; dehydratase, lyase; HET: CME DSB; 1.70A {Escherichia coli} SCOP: c.1.10.3 PDB: 1i8j_A* 1l6y_A* 1b4e_A Back     alignment and structure
>1pv8_A Delta-aminolevulinic acid dehydratase; porphobilinogen synthase, tetrapyrrole biosynthesis, reactio intermediate, lyase; HET: PB1; 2.20A {Homo sapiens} SCOP: c.1.10.3 PDB: 1e51_A* 2z0i_A 2z1b_A Back     alignment and structure
>1ykw_A Rubisco-like protein; beta-alpha-barrel, unknown function; 2.00A {Chlorobaculum tepidum} SCOP: c.1.14.1 d.58.9.1 PDB: 1tel_A Back     alignment and structure
>2qyg_A Ribulose bisphosphate carboxylase-like protein 2; beta-alpha-barrel, unknown function; 3.30A {Rhodopseudomonas palustris CGA009} Back     alignment and structure
>3kdn_A Rubisco, ribulose bisphosphate carboxylase; ribulose-1,5-bisphosphate carboxylase/oxygenase, Ca dioxide fixation, lyase, magnesium; HET: KCX CAP; 2.09A {Thermococcus kodakaraensis} PDB: 3a13_A* 3kdo_A* 3a12_A* 1geh_A* Back     alignment and structure
>1wdd_A Ribulose bisphosphate carboxylase large chain; rubisco, photosynthesis, alpha/beta barrel, N- methylmethionine, post-translational modification; HET: KCX CAP; 1.35A {Oryza sativa} SCOP: c.1.14.1 d.58.9.1 PDB: 1rlc_L* 4rub_A* 3rub_L 1ej7_L 1aa1_L* 1aus_L 1rbo_L* 1rco_L* 1rcx_L* 1rxo_L* 1gk8_A* 1ir2_A* 1uzd_A* 1uzh_A* 2v69_A* 1uwa_A* 2v63_A* 2v67_A* 8ruc_A* 1upm_B* ... Back     alignment and structure
>2d69_A Ribulose bisphosphate carboxylase; alpha/beta barrel, structural genomics, NPPSFA; 1.90A {Pyrococcus horikoshii OT3} SCOP: c.1.14.1 d.58.9.1 PDB: 2cxe_A 2cwx_A Back     alignment and structure
>3l5l_A Xenobiotic reductase A; TIM barrel, oxidoreductase; HET: BU3 FMN; 1.03A {Pseudomonas putida} PDB: 3l5m_A* 3n19_B* 3n16_A* 3l68_A* 3l67_A* 3l65_A* 3l66_A* 3n14_A* 2h8z_A* 2h90_A* 2h8x_A* Back     alignment and structure
>2ze3_A DFA0005; organic waste LEFT-OVER decomposition, alkaliphilic, ICL/PEPM superfamily, alpha-ketoglutarate ligand, isomerase; HET: AKG; 1.65A {Deinococcus ficus} Back     alignment and structure
>3nwr_A A rubisco-like protein; lyase; HET: KCX; 1.50A {Burkholderia fungorum} Back     alignment and structure
>2oem_A 2,3-diketo-5-methylthiopentyl-1-phosphate enolase; rubisco-like protein, isomerase; HET: KCX 1AE; 1.70A {Geobacillus kaustophilus} PDB: 2oel_A* 2oek_A* 2oej_A Back     alignment and structure
>3eoo_A Methylisocitrate lyase; seattle structural genomics center for infectious disease, ssgcid; 2.90A {Burkholderia pseudomallei 1655} Back     alignment and structure
>2zvi_A 2,3-diketo-5-methylthiopentyl-1-phosphate enolase; methionine salvage pathway, amino-acid biosynthesis, isomerase, magnesium, metal- binding; 2.30A {Bacillus subtilis} Back     alignment and structure
>3fk4_A Rubisco-like protein; structural genomics, target 9463A, PSI-2, protein structure initiative; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>1o66_A 3-methyl-2-oxobutanoate hydroxymethyltransferase; structural genomics; HET: MSE; 1.75A {Neisseria meningitidis serogroup B} SCOP: c.1.12.8 PDB: 1o68_A* Back     alignment and structure
>3bg3_A Pyruvate carboxylase, mitochondrial; TIM barrel, ATP-binding, biotin, disease mutation, gluconeogenesis, ligase, lipid synthesis, manganese; HET: KCX BTI; 2.80A {Homo sapiens} PDB: 3bg9_A Back     alignment and structure
>3c6c_A 3-keto-5-aminohexanoate cleavage enzyme; YP_293392.1, prokaryotic protein of unknown function (DUF849), structural genomics; HET: MSE; 1.72A {Ralstonia eutropha JMP134} Back     alignment and structure
>3no5_A Uncharacterized protein; PFAM DUF849 domain containing protein, structural genomics, center for structural genomics, JCSG; HET: MSE; 1.90A {Ralstonia eutropha JMP134} Back     alignment and structure
>3chv_A Prokaryotic domain of unknown function (DUF849) W barrel fold; TIM barrel fold, structural genomics, joint center for struc genomics; HET: MSE; 1.45A {Silicibacter pomeroyi dss-3} PDB: 3fa5_A Back     alignment and structure
>1xg4_A Probable methylisocitrate lyase; 2-methylisocitrate lyase/inhibitor complex, isocitrate lyase superfamily; HET: ICT; 1.60A {Escherichia coli} PDB: 1xg3_A* 1mum_A 1oqf_A 1ujq_A 1o5q_A Back     alignment and structure
>1lt8_A Betaine-homocysteine methyltransferase; homocysteine metabolism, homocysteinemia, zinc, thiol alkyl transfer; HET: CBH CIT; 2.05A {Homo sapiens} SCOP: c.1.26.1 PDB: 1lt7_A* 1umy_A Back     alignment and structure
>3b8i_A PA4872 oxaloacetate decarboxylase; alpha/beta barrel, helix swapping, lyase; 1.90A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>1zlp_A PSR132, petal death protein; TIM-barrel, helix swapping,2-ethyl-3-methylmalate lyase, 2- propyl-3-methylmalate lyase; 2.70A {Dianthus caryophyllus} Back     alignment and structure
>2xed_A Putative maleate isomerase; nicotinic acid catabolism, cofactor-independent CIS-trans isomerase; 1.95A {Nocardia farcinica} PDB: 2xec_A Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 337 delta-aminolevulinic acid dehydratase [Candidatus Liber
d1gzga_329 c.1.10.3 (A:) 5-aminolaevulinate dehydratase, ALAD (por 1e-102
d1l6sa_323 c.1.10.3 (A:) 5-aminolaevulinate dehydratase, ALAD (por 4e-98
d2c1ha1319 c.1.10.3 (A:10-328) 5-aminolaevulinate dehydratase, ALA 7e-97
d1h7na_340 c.1.10.3 (A:) 5-aminolaevulinate dehydratase, ALAD (por 8e-89
d1pv8a_320 c.1.10.3 (A:) 5-aminolaevulinate dehydratase, ALAD (por 3e-88
>d1gzga_ c.1.10.3 (A:) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Pseudomonas aeruginosa [TaxId: 287]} Length = 329 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Aldolase
family: 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase)
domain: 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase)
species: Pseudomonas aeruginosa [TaxId: 287]
 Score =  364 bits (936), Expect = e-102
 Identities = 159/323 (49%), Positives = 227/323 (70%), Gaps = 3/323 (0%)

Query: 14  HRRMRRNRKSNWIREMVREHRLSVSDLILPIFLTSGEKTVESINSMPDVMRMSIDVAVEK 73
           + R+RRNR+ ++ R +VRE+ L+V DLILP+F+  G    ESI SMP V R+SID  + +
Sbjct: 6   YTRLRRNRRDDFSRRLVRENVLTVDDLILPVFVLDGVNQRESIPSMPGVERLSIDQLLIE 65

Query: 74  IKQVADLGIPAIAIFPNIPMDLRNNTGSHIIDPDNLINEGICAIKKNIPNIGIITDVALD 133
            ++   LGIPA+A+FP  P++ ++   +   +P+ +      A+++  P +GIITDVALD
Sbjct: 66  AEEWVALGIPALALFPVTPVEKKSLDAAEAYNPEGIAQRATRALRERFPELGIITDVALD 125

Query: 134 PFTIHGHDGILC-DGEIVNDETIELISHAAVIQADAGADIIAPSEMMDGRVQEIRKKLDS 192
           PFT HG +GIL  DG ++ND +I+++   A+  A+AGA ++APS+MMDGR+  IR+ L+S
Sbjct: 126 PFTTHGQNGILDDDGYVLNDVSIDVLVRQALSHAEAGAQVVAPSDMMDGRIGAIREALES 185

Query: 193 HGHINVGIMPYVAKFNSSFYGPYRDAI-STRDLLKGDKKTYYLDPANVQEAIREASIDIQ 251
            GH NV +M Y AK+ S++YGP+RDA+ S  +L KG+K TY +DPAN  EA+ E + D+ 
Sbjct: 186 AGHTNVRVMAYSAKYASAYYGPFRDAVGSASNLGKGNKATYQMDPANSDEALHEVAADLA 245

Query: 252 ESADMLLVKPGLPYLDVCFRIKEKFGLPTFAYQVSGEYAMIKAASLQGWINKNDAMMESL 311
           E ADM++VKPG+PYLD+  R+K++F  PTF YQVSGEYAM   A   GW+ +   ++ESL
Sbjct: 246 EGADMVMVKPGMPYLDIVRRVKDEFRAPTFVYQVSGEYAMHMGAIQNGWLAE-SVILESL 304

Query: 312 LAFKRAGCDGIFTYFAMEAARIL 334
            AFKRAG DGI TYFA +AA  L
Sbjct: 305 TAFKRAGADGILTYFAKQAAEQL 327


>d1l6sa_ c.1.10.3 (A:) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Escherichia coli [TaxId: 562]} Length = 323 Back     information, alignment and structure
>d2c1ha1 c.1.10.3 (A:10-328) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Prosthecochloris vibrioformis [TaxId: 1098]} Length = 319 Back     information, alignment and structure
>d1h7na_ c.1.10.3 (A:) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 340 Back     information, alignment and structure
>d1pv8a_ c.1.10.3 (A:) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Human (Homo sapiens) [TaxId: 9606]} Length = 320 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target337 delta-aminolevulinic acid dehydratase [Candidatus Liber
d1gzga_329 5-aminolaevulinate dehydratase, ALAD (porphobilinogen s 100.0
d2c1ha1319 5-aminolaevulinate dehydratase, ALAD (porphobilinogen s 100.0
d1l6sa_323 5-aminolaevulinate dehydratase, ALAD (porphobilinogen s 100.0
d1h7na_340 5-aminolaevulinate dehydratase, ALAD (porphobilinogen s 100.0
d1pv8a_320 5-aminolaevulinate dehydratase, ALAD (porphobilinogen s 100.0
d1wdda1 325 Ribulose 1,5-bisphosphate carboxylase-oxygenase {Rice ( 95.73
d1ykwa1283 Ribulose 1,5-bisphosphate carboxylase-oxygenase {Chloro 95.27
d1geha1 307 Ribulose 1,5-bisphosphate carboxylase-oxygenase {Archae 94.84
d2d69a1291 Ribulose 1,5-bisphosphate carboxylase-oxygenase {Archae 92.8
d1ps9a1330 2,4-dienoyl-CoA reductase, N-terminal domain {Escherich 94.16
d1muma_289 2-methylisocitrate lyase {Escherichia coli [TaxId: 562] 91.72
>d1gzga_ c.1.10.3 (A:) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Aldolase
family: 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase)
domain: 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase)
species: Pseudomonas aeruginosa [TaxId: 287]
Probab=100.00  E-value=0  Score=1119.34  Aligned_cols=327  Identities=48%  Similarity=0.856  Sum_probs=321.4

Q ss_pred             CCCCCCCCCCCCCCCHHHHHHHHCCCCCHHHCCCCEEEECCCCCEEECCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEE
Q ss_conf             55788858563128988999863477888773311666758988110488878632889999999999998889367633
Q gi|255764463|r    9 HKICCHRRMRRNRKSNWIREMVREHRLSVSDLILPIFLTSGEKTVESINSMPDVMRMSIDVAVEKIKQVADLGIPAIAIF   88 (337)
Q Consensus         9 ~~~~p~~R~RRlR~~~~iR~Lv~Et~Ls~~dLI~PiFV~eg~~~k~~I~SMPGv~R~Sid~L~~eie~~~~lGI~av~LF   88 (337)
                      ++.||+.||||||+++|+|+||+||+|+++|||||+||+||++.++||+||||++|||+|.|++++++++++||++|+||
T Consensus         1 n~~fP~~R~RRlR~~~~iR~Lv~Et~Ls~~dLI~PiFV~eg~~~~~~I~SMPGi~R~Sid~l~~~ie~~~~lGI~av~LF   80 (329)
T d1gzga_           1 NRAYPYTRLRRNRRDDFSRRLVRENVLTVDDLILPVFVLDGVNQRESIPSMPGVERLSIDQLLIEAEEWVALGIPALALF   80 (329)
T ss_dssp             CCCTTTCCTHHHHSSHHHHHHHCCCCCCGGGEEEEEEEESSSSCEEECTTSTTCEEEEHHHHHHHHHHHHHHTCCEEEEE
T ss_pred             CCCCCCCCCCCCCCCHHHHHHHHCCCCCHHHCEEEEEEEECCCCCEECCCCCCCEEECHHHHHHHHHHHHHCCCCEEEEE
T ss_conf             99999988665689878999984078778992653599538998423689998426689999999988875386469998


Q ss_pred             ECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEECCCCCHHHCCCCCCCCC-CCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             025633455445421576537999999999730144798613327100114310013-6544628999999999999996
Q gi|255764463|r   89 PNIPMDLRNNTGSHIIDPDNLINEGICAIKKNIPNIGIITDVALDPFTIHGHDGILC-DGEIVNDETIELISHAAVIQAD  167 (337)
Q Consensus        89 p~I~~~~Kd~~GseA~n~dglv~rAIr~IK~~fpdl~vi~DVcLc~YT~hGHcGi~~-~g~IdND~Tl~~L~k~Al~~A~  167 (337)
                      |++++++||+.|++|||+||++|||||+||+.||||+|||||||||||+||||||++ +|.||||+||++|+|||++||+
T Consensus        81 pvi~~~~Kd~~gseA~n~d~lv~rAIr~IK~~~p~l~vi~DVcLc~YT~hGHcGil~~~g~idND~Tl~~L~k~Al~~A~  160 (329)
T d1gzga_          81 PVTPVEKKSLDAAEAYNPEGIAQRATRALRERFPELGIITDVALDPFTTHGQNGILDDDGYVLNDVSIDVLVRQALSHAE  160 (329)
T ss_dssp             ECCCGGGCBSSCGGGGCTTSHHHHHHHHHHHHCTTSEEEEEECSTTTBTTCCSSCBCTTSCBCHHHHHHHHHHHHHHHHH
T ss_pred             EEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEEEHHCCCHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             66413225677644468613899999999986271799851002331453268753478871728999999999999997


Q ss_pred             CCCCEEECCCCCCCHHHHHHHHHHHCCCCCCCEECHHHHHHHHHHCCHHHHHHCCCCC-CCCCCCCCCCCCHHHHHHHHH
Q ss_conf             2897352466767799999999987788577300336664354301016753102446-777744315721147889888
Q gi|255764463|r  168 AGADIIAPSEMMDGRVQEIRKKLDSHGHINVGIMPYVAKFNSSFYGPYRDAISTRDLL-KGDKKTYYLDPANVQEAIREA  246 (337)
Q Consensus       168 AGaDivAPSdMMDGrV~aIR~~Ld~~g~~~~~ImsYsaKfaS~fYgPFRdA~~S~p~~-~gdr~sYQmd~~n~~eA~~e~  246 (337)
                      ||||+|||||||||||++||++||++||++|+|||||+||+|+||||||||++|+|+| +|||+||||||+|++||+||+
T Consensus       161 AGaDivAPSdMMDGrV~aIR~~Ld~~g~~~v~ImsYsaKfaS~fYGPFRda~~S~p~~~~gdr~sYQmd~~n~~eA~~e~  240 (329)
T d1gzga_         161 AGAQVVAPSDMMDGRIGAIREALESAGHTNVRVMAYSAKYASAYYGPFRDAVGSASNLGKGNKATYQMDPANSDEALHEV  240 (329)
T ss_dssp             HTCSEEEECSCCTTHHHHHHHHHHHTTCTTCEEEEEEEEBCCGGGHHHHHHHTCHHHHTTCCCTTTSBCTTCSHHHHHHH
T ss_pred             CCCCEEECCCCCHHHHHHHHHHHHHCCCCCCCEEEHHHHHCHHHHHHHHHHHHCHHCCCCCCCCCCCCCCCCHHHHHHHH
T ss_conf             46885631455234899999999976986763101566623343145899862412048997231002788889999999


Q ss_pred             HHHHHCCCCEEEECCCHHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCCEEEECH
Q ss_conf             87664089879955311458999999962499899993461899999999888978899999999999772699998201
Q gi|255764463|r  247 SIDIQESADMLLVKPGLPYLDVCFRIKEKFGLPTFAYQVSGEYAMIKAASLQGWINKNDAMMESLLAFKRAGCDGIFTYF  326 (337)
Q Consensus       247 ~~D~~EGAD~lMVKPa~~yLDii~~~k~~~~~P~~aYqVSGEYami~~a~~~g~~d~~~~~~E~l~~~kRAGAd~IitY~  326 (337)
                      .+|++||||||||||||||||||+++|++|++|++||||||||||||+|+++||+|+ ++++|+|++|||||||+|||||
T Consensus       241 ~~D~~EGAD~lMVKPa~~yLDii~~~~~~~~~Pv~aYqVSGEYami~~a~~~g~~~~-~~~~E~l~~~kRAGAd~IitY~  319 (329)
T d1gzga_         241 AADLAEGADMVMVKPGMPYLDIVRRVKDEFRAPTFVYQVSGEYAMHMGAIQNGWLAE-SVILESLTAFKRAGADGILTYF  319 (329)
T ss_dssp             HHHHHTTCSEEEEESSGGGHHHHHHHHHHHCSCEEEEECHHHHHHHHHHHHTTSSCT-THHHHHHHHHHHHTCSEEEETT
T ss_pred             HHHHHCCCCEEEECCCHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHCCCCCH-HHHHHHHHHHHHCCCCEEEECC
T ss_conf             998861887477504115658899998736998899968239999999998699635-1899999999864999998703


Q ss_pred             HHHHHHHHHC
Q ss_conf             8999999850
Q gi|255764463|r  327 AMEAARILTH  336 (337)
Q Consensus       327 A~~~a~~L~~  336 (337)
                      |+++|+||+.
T Consensus       320 a~~~a~~L~~  329 (329)
T d1gzga_         320 AKQAAEQLRR  329 (329)
T ss_dssp             HHHHHHHHTC
T ss_pred             HHHHHHHHCC
T ss_conf             9999998659



>d2c1ha1 c.1.10.3 (A:10-328) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Prosthecochloris vibrioformis [TaxId: 1098]} Back     information, alignment and structure
>d1l6sa_ c.1.10.3 (A:) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h7na_ c.1.10.3 (A:) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pv8a_ c.1.10.3 (A:) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdda1 c.1.14.1 (A:151-475) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1ykwa1 c.1.14.1 (A:146-428) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1geha1 c.1.14.1 (A:137-443) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Archaeon Thermococcus kodakaraensis [TaxId: 311400]} Back     information, alignment and structure
>d2d69a1 c.1.14.1 (A:134-424) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ps9a1 c.1.4.1 (A:1-330) 2,4-dienoyl-CoA reductase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1muma_ c.1.12.7 (A:) 2-methylisocitrate lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 337 delta-aminolevulinic acid dehydratase [Candidatus
1w5q_A_34-337304 (A:34-337) Delta-aminolevulinic acid dehydratase; 1e-116
1w1z_A_32-328297 (A:32-328) Delta-aminolevulinic acid dehydratase; 1e-115
1l6s_A_26-323298 (A:26-323) Porphobilinogen synthase; dehydratase, 1e-114
1pv8_A_26-330305 (A:26-330) Delta-aminolevulinic acid dehydratase; 1e-111
1h7n_A_36-342307 (A:36-342) 5-aminolaevulinic acid dehydratase; lya 1e-110
>1w5q_A (A:34-337) Delta-aminolevulinic acid dehydratase; synthase, evolution, metalloenzyme, porphobilinogen synthase, protein engineering,; 1.4A {Pseudomonas aeruginosa} PDB: 1w5p_A* 1w5o_A 1w5n_A 1w56_A 1w5m_A 1w54_A 1gzg_A* 1b4k_A 2woq_A* 2c14_A* 2c16_A* 2c19_A* 2c15_A* 2c18_A* 2c13_A*Length = 304 Back     alignment and structure
 Score =  412 bits (1061), Expect = e-116
 Identities = 145/301 (48%), Positives = 206/301 (68%), Gaps = 3/301 (0%)

Query: 36  SVSDLILPIFLTSGEKTVESINSMPDVMRMSIDVAVEKIKQVADLGIPAIAIFPNIPMDL 95
           +V DLILP+F+  G    ESI SMP V R+SID  + + ++   LGIPA+A+FP  P++ 
Sbjct: 1   TVDDLILPVFVLDGVNQRESIPSMPGVERLSIDQLLIEAEEWVALGIPALALFPVTPVEK 60

Query: 96  RNNTGSHIIDPDNLINEGICAIKKNIPNIGIITDVALDPFTIHGHDGILC-DGEIVNDET 154
           ++   +   +P+ +      A+++  P +GIITDV L  FT HG  GIL  DG ++ND +
Sbjct: 61  KSLDAAEAYNPEGIAQRATRALRERFPELGIITDVCLCEFTTHGQCGILDDDGYVLNDVS 120

Query: 155 IELISHAAVIQADAGADIIAPSEMMDGRVQEIRKKLDSHGHINVGIMPYVAKFNSSFYGP 214
           I+++   A+  A+AGA ++APS+MMDGR+  IR+ L+S GH NV +M Y AK+ S++YGP
Sbjct: 121 IDVLVRQALSHAEAGAQVVAPSDMMDGRIGAIREALESAGHTNVRVMAYSAKYASAYYGP 180

Query: 215 YRDAI-STRDLLKGDKKTYYLDPANVQEAIREASIDIQESADMLLVKPGLPYLDVCFRIK 273
           +RDA+ S  +L KG++ TY +DPAN  EA+ E + D+ E ADM++VKPG+PYLD+  R+K
Sbjct: 181 FRDAVGSASNLGKGNRATYQMDPANSDEALHEVAADLAEGADMVMVKPGMPYLDIVRRVK 240

Query: 274 EKFGLPTFAYQVSGEYAMIKAASLQGWINKNDAMMESLLAFKRAGCDGIFTYFAMEAARI 333
           ++F  PTF YQVSGEYAM   A   GW+ +   ++ESL AFKRAG DGI TYFA +AA  
Sbjct: 241 DEFRAPTFVYQVSGEYAMHMGAIQNGWLAE-SVILESLTAFKRAGADGILTYFAKQAAEQ 299

Query: 334 L 334
           L
Sbjct: 300 L 300


>1w1z_A (A:32-328) Delta-aminolevulinic acid dehydratase; synthase, tetrapyrrole biosynthesis, ALAD, porphyrin biosynthesis, heme biosynthesis, lyase; 2.6A {Prosthecochloris vibrioformis}Length = 297 Back     alignment and structure
>1l6s_A (A:26-323) Porphobilinogen synthase; dehydratase, lyase; HET: CME DSB; 1.70A {Escherichia coli}Length = 298 Back     alignment and structure
>1pv8_A (A:26-330) Delta-aminolevulinic acid dehydratase; porphobilinogen synthase, tetrapyrrole biosynthesis, reaction intermediate, lyase; HET: PB1; 2.20A {Homo sapiens}Length = 305 Back     alignment and structure
>1h7n_A (A:36-342) 5-aminolaevulinic acid dehydratase; lyase, aldolase, TIM barrel, tetrapyrrole synthesis; HET: SHF; 1.6A {Saccharomyces cerevisiae}Length = 307 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target337 delta-aminolevulinic acid dehydratase [Candidatus Liber
1h7n_A_36-342307 5-aminolaevulinic acid dehydratase; lyase, aldolas 100.0
1w5q_A_34-337304 Delta-aminolevulinic acid dehydratase; synthase, e 100.0
1pv8_A_26-330305 Delta-aminolevulinic acid dehydratase; porphobilin 100.0
1w1z_A_32-328297 Delta-aminolevulinic acid dehydratase; synthase, t 100.0
1l6s_A_26-323298 Porphobilinogen synthase; dehydratase, lyase; HET: 100.0
2qyg_A_165-452288 Ribulose bisphosphate carboxylase-like protein 2; 96.23
1ykw_A_145-435 291 Rubisco-like protein; beta-alpha-barrel, unknown f 96.01
2zvi_A_127-425299 2,3-diketo-5-methylthiopentyl-1-phosphate enolase; 95.97
3fk4_A_122-414 293 Rubisco-like protein; structural genomics, target 95.73
2oem_A_120-413 294 2,3-diketo-5-methylthiopentyl-1-phosphate enolase; 95.1
2d69_A_134-430 297 Ribulose bisphosphate carboxylase; alpha/beta barr 94.45
1o94_A_1-343343 Tmadh, trimethylamine dehydrogenase; electron tran 95.62
1geh_A_137-288_360-444237 Ribulose-1,5-bisphosphate carboxylase/oxygenase; p 93.85
2gou_A_1-110_153-365323 Oxidoreductase, FMN-binding; OLD yeallow enzyme, f 94.48
2h8z_A_1-104_149-359315 Xenobiotic reductase A; beta-alpha barrel, oxidore 92.98
3hgj_A_349 Chromate reductase; TIM barrel, oxidoreductase; HE 90.44
3c6c_A_316 3-keto-5-aminohexanoate cleavage enzyme; YP_293392 93.06
3chv_A_284 Prokaryotic domain of unknown function (DUF849) wi 92.56
3bg3_A_66-396_510-576398 Pyruvate carboxylase, mitochondrial; TIM barrel, A 92.54
>1w5q_A (A:34-337) Delta-aminolevulinic acid dehydratase; synthase, evolution, metalloenzyme, porphobilinogen synthase, protein engineering,; 1.4A {Pseudomonas aeruginosa} PDB: 1w5p_A* 1w5o_A 1w5n_A 1w56_A 1w5m_A 1w54_A 1gzg_A* 1b4k_A 2woq_A* 2c14_A* 2c16_A* 2c19_A* 2c15_A* 2c18_A* 2c13_A* Back     alignment and structure