255764477

255764477

dephospho-CoA kinase

GeneID in NCBI database:8209825Locus tag:CLIBASIA_03550
Protein GI in NCBI database:255764477Protein Accession:YP_003065232.2
Gene range:+(436594, 437193)Protein Length:199aa
Gene description:dephospho-CoA kinase
COG prediction:[H] Dephospho-CoA kinase
KEGG prediction:coaE; dephospho-CoA kinase (EC:2.7.1.24); K00859 dephospho-CoA kinase [EC:2.7.1.24]
SEED prediction:Dephospho-CoA kinase (EC 2.7.1.24)
Pathway involved in KEGG:Pantothenate and CoA biosynthesis [PATH:las00770]
Subsystem involved in SEED:Coenzyme A Biosynthesis
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------20
MLIIGLTGSIGTGKTTVAEFLKKEKIPVISSDDIVDKLYHYEAVDIIKKTFPRSIQNNKVNKARLLGILQKSPAKLEILEKIVHPMVRMHEKKILHDLSCRGEKIVFFDTPLLFEKRKEYLFDAVVVVTCSFETQRERVLSRKKHTEENFLFILSKQMNEKDKISRADYVINTEGTIEAIEKETQKMLKYILKINDSKK
cEEEEEEccccccHHHHHHHHHHcccEEEEHHHHHHHHHcccHHHHHHHHcccccccccccHHHHHHHHHccHHHHHHHHHcccHHHHHHHHHHHHHHHHccccEEEEEEHHHHcccHHHHccEEEEEEccHHHHHHHHHHcccccHHHHHHHHHHcccHHHHHHHccEEEEccccHHHHHHHHHHHHHHHHHHHHccc
cEEEEEcccccccHHHHHHHHHHccccEEcHHHHHHHHHccHHHHHHHHHHccccccccccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEcHHHccccHHcccEEEEEEccHHHHHHHHHHHccccHHHHHHHHHHHccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHccc
mliigltgsigtgkTTVAEFLKkekipvissddivDKLYHYEAVDIikktfprsiqnnKVNKARLLGILQKSPAKLEILEKIVHPMVRMHEKKILHDlscrgekivffdtpllFEKRKEYLFDAVVVVTCSFETQRERVLSRKKHTEENFLFILSKQmnekdkisradyvintEGTIEAIEKETQKMLKYILKINDSKK
mliigltgsigtgktTVAEflkkekipvissddivDKLYHYEAVDiikktfprsiqnnKVNKARLLGILQKSPAKLEILEKIVHPMVRMHEKKIlhdlscrgeKIVFFDTPLLFEKRKEYLFDAVVVVTCSFEtqrervlsrkkhteeNFLFilskqmnekdkiSRADYVINTEGTIEAIEKETQKMLKYIlkindskk
MLiigltgsigtgkttVAEFLKKEKIPVISSDDIVDKLYHYEAVDIIKKTFPRSIQNNKVNKARLLGILQKSPAKLEILEKIVHPMVRMHEKKILHDLSCRGEKIVFFDTPLLFEKRKEYLFDAVVVVTCSFETQRERVLSRKKHTEENFLFILSKQMNEKDKISRADYVINTEGTIEAIEKETQKMLKYILKINDSKK
MLIIGLTGSIGTGKTTVAEFLKKEKIPVISSDDIVDKLYHYEAVDIIKKTFPRSIQNNKVNKARLLGILQKSPAKLEILEKIVHPMVRMHEKKILHDLSCRGEKIVFFDTPLLFEKRKEYLFDAVVVVTCSFETQRERVLSRKKHTEENFLFILSKQMNEKDKISRADYVINTEGTIEAIEKETQKMLKYI*KIN****
MLIIGLTGSIGTGKTTVAEFLKKEKIPVISSDDIVDKLYHYEAVDIIKKTFPRSIQNNKVNKARLLGILQKSPAKLEILEKIVHPMVRMHEKKILHDLSCRGEKIVFFDTPLLFEKRKEYLFDAVVVVTCSFETQRERVLSRKKHTEENFLFILSKQMNEKDKISRADYVINTEGTIEAIEKETQKMLKYILKINDSKK
MLIIGLTGSIGTGKTTVAEFLKKEKIPVISSDDIVDKLYHYEAVDIIKKTFPRSIQNNKVNKARLLGILQKSPAKLEILEKIVHPMVRMHEKKILHDLSCRGEKIVFFDTPLLFEKRKEYLFDAVVVVTCSFETQRERVLSRKKHTEENFLFILSKQMNEKDKISRADYVINTEGTIEAIEKETQKMLKYILKINDS**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
hhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLIIGLTGSIGTGKTTVAEFLKKEKIPVISSDDIVDKLYHYEAVDIIKKTFPRSIQNNKVNKARLLGILQKSPAKLEILEKIVHPMVRMHEKKILHDLSCRGEKIVFFDTPLLFEKRKEYLFDAVVVVTCSFETQRERVLSRKKHTEENFLFILSKQMNEKDKISRADYVINTEGTIEAIEKETQKMLKYILKINDSKK
MLIIGLTGSIGTGKTTVAEFLKKEKIPVISSDDIVDKLYHYEAVDIIKKTFPRSIQNNKVNKARLLGILQKSPAKLEILEKIVHPMVRMHEKKILHDLSCRGEKIVFFDTPLLFEKRKEYLFDAVVVVTCSFETQRERVLSRKKHTEENFLFILSKQMNEKDKISRADYVINTEGTIEAIEKETQKMLKYILKINDSKK
MLIIGLTGSIGTGKTTVAEFLKKEKIPVISSDDIVDKLYHYEAVDIIKKTFPRSIQNNKVNKARLLGILQKSPAKLEILEKIVHPMVRMHEKKILHDLSCRGEKIVFFDTPLLFEKRKEYLFDAVVVVTCSFETQRERVLSRKKHTEENFLFILSKQMNEKDKISRADYVINTEGTIEAIEKETQKMLKYILKINDSKK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target199 dephospho-CoA kinase [Candidatus Liberibacter asiaticus
254780827311 pantothenate kinase [Candidatus Liberibacter asiat 0.013
>gi|254780827|ref|YP_003065240.1| pantothenate kinase [Candidatus Liberibacter asiaticus str. psy62] Length = 311 Back     alignment
 Score = 31.2 bits (69), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 35/67 (52%), Gaps = 8/67 (11%)

Query: 2   LIIGLTGSIGTGKTTVAEFL-------KKEKIPVISSDDIVDKLYHYEAVDII-KKTFPR 53
            ++G+TGS+  GK+T A  L          K+ +I++D  +       A +++ +K FP 
Sbjct: 84  FVVGITGSVAVGKSTFARILCILLQQISNFKVSLITTDGFLFPNAVLTANNLMQRKGFPE 143

Query: 54  SIQNNKV 60
           S  +NK+
Sbjct: 144 SYDSNKL 150

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target199 dephospho-CoA kinase [Candidatus Liberibacter asiaticus
315122042202 dephospho-CoA kinase [Candidatus Liberibacter solanacea 1 2e-82
159184121193 dephospho-CoA kinase [Agrobacterium tumefaciens str. C5 1 8e-39
23813872194 RecName: Full=Dephospho-CoA kinase; AltName: Full=Depho 1 9e-39
325291457202 Dephospho-CoA kinase [Agrobacterium sp. H13-3] Length = 1 1e-37
39933377199 dephospho-CoA kinase [Rhodopseudomonas palustris CGA009 1 3e-37
222147019195 dephospho-CoA kinase [Agrobacterium vitis S4] Length = 1 3e-37
192288733199 dephospho-CoA kinase [Rhodopseudomonas palustris TIE-1] 1 3e-37
316931719199 dephospho-CoA kinase [Rhodopseudomonas palustris DX-1] 1 5e-37
163757473197 dephospho-CoA kinase [Hoeflea phototrophica DFL-43] Len 1 2e-36
150398404194 dephospho-CoA kinase [Sinorhizobium medicae WSM419] Len 1 2e-35
>gi|315122042|ref|YP_004062531.1| dephospho-CoA kinase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 202 Back     alignment and organism information
 Score =  308 bits (790), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 159/199 (79%), Positives = 182/199 (91%)

Query: 1   MLIIGLTGSIGTGKTTVAEFLKKEKIPVISSDDIVDKLYHYEAVDIIKKTFPRSIQNNKV 60
           MLIIGLTGSIGTGKTTVA+FL KEKIPVISSDDIV+KLYH+EAVDII K FP SIQN++V
Sbjct: 1   MLIIGLTGSIGTGKTTVAKFLIKEKIPVISSDDIVNKLYHHEAVDIIGKNFPGSIQNSRV 60

Query: 61  NKARLLGILQKSPAKLEILEKIVHPMVRMHEKKILHDLSCRGEKIVFFDTPLLFEKRKEY 120
           NK+ LL +LQKSP KL+ILE+IVHPMVRM+EKK+LH++SCRGEKIVFF+TPLLFE  KE 
Sbjct: 61  NKSYLLEVLQKSPEKLKILERIVHPMVRMYEKKLLHEMSCRGEKIVFFETPLLFETNKEP 120

Query: 121 LFDAVVVVTCSFETQRERVLSRKKHTEENFLFILSKQMNEKDKISRADYVINTEGTIEAI 180
           LFDAVVVVTC+FETQR+RVLSRK HTEE+FLFILSKQMNEKDK+SRADYVINTEG IE I
Sbjct: 121 LFDAVVVVTCNFETQRKRVLSRKTHTEESFLFILSKQMNEKDKVSRADYVINTEGKIEEI 180

Query: 181 EKETQKMLKYILKINDSKK 199
           EKE +KML++I K ++ KK
Sbjct: 181 EKEIKKMLQFIFKKSNVKK 199


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|159184121|ref|NP_353044.2| dephospho-CoA kinase [Agrobacterium tumefaciens str. C58] Length = 193 Back     alignment and organism information
>gi|23813872|sp|Q8UJC4|COAE_AGRT5 RecName: Full=Dephospho-CoA kinase; AltName: Full=Dephosphocoenzyme A kinase Length = 194 Back     alignment and organism information
>gi|325291457|ref|YP_004277321.1| Dephospho-CoA kinase [Agrobacterium sp. H13-3] Length = 202 Back     alignment and organism information
>gi|39933377|ref|NP_945653.1| dephospho-CoA kinase [Rhodopseudomonas palustris CGA009] Length = 199 Back     alignment and organism information
>gi|222147019|ref|YP_002547976.1| dephospho-CoA kinase [Agrobacterium vitis S4] Length = 195 Back     alignment and organism information
>gi|192288733|ref|YP_001989338.1| dephospho-CoA kinase [Rhodopseudomonas palustris TIE-1] Length = 199 Back     alignment and organism information
>gi|316931719|ref|YP_004106701.1| dephospho-CoA kinase [Rhodopseudomonas palustris DX-1] Length = 199 Back     alignment and organism information
>gi|163757473|ref|ZP_02164562.1| dephospho-CoA kinase [Hoeflea phototrophica DFL-43] Length = 197 Back     alignment and organism information
>gi|150398404|ref|YP_001328871.1| dephospho-CoA kinase [Sinorhizobium medicae WSM419] Length = 194 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target199 dephospho-CoA kinase [Candidatus Liberibacter asiaticus
PRK00081197 PRK00081, coaE, dephospho-CoA kinase; Reviewed 4e-48
COG0237201 COG0237, CoaE, Dephospho-CoA kinase [Coenzyme metabolis 1e-32
pfam01121179 pfam01121, CoaE, Dephospho-CoA kinase 2e-28
KOG3220225 KOG3220, KOG3220, KOG3220, Similar to bacterial dephosp 5e-28
TIGR00152188 TIGR00152, TIGR00152, dephospho-CoA kinase 1e-25
PRK14730195 PRK14730, coaE, dephospho-CoA kinase; Provisional 6e-25
PLN02422232 PLN02422, PLN02422, dephospho-CoA kinase 3e-24
PTZ00451244 PTZ00451, PTZ00451, dephospho-CoA kinase; Provisional 1e-20
PRK14731208 PRK14731, coaE, dephospho-CoA kinase; Provisional 2e-18
PRK14732196 PRK14732, coaE, dephospho-CoA kinase; Provisional 1e-17
PRK14734200 PRK14734, coaE, dephospho-CoA kinase; Provisional 8e-17
PRK03333 395 PRK03333, coaE, dephospho-CoA kinase/protein folding ac 5e-10
PRK14733204 PRK14733, coaE, dephospho-CoA kinase; Provisional 1e-08
cd02022179 cd02022, DPCK, Dephospho-coenzyme A kinase (DPCK, EC 2 2e-38
>gnl|CDD|178848 PRK00081, coaE, dephospho-CoA kinase; Reviewed Back     alignment and domain information
>gnl|CDD|30586 COG0237, CoaE, Dephospho-CoA kinase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|144640 pfam01121, CoaE, Dephospho-CoA kinase Back     alignment and domain information
>gnl|CDD|38430 KOG3220, KOG3220, KOG3220, Similar to bacterial dephospho-CoA kinase [Coenzyme transport and metabolism] Back     alignment and domain information
>gnl|CDD|129256 TIGR00152, TIGR00152, dephospho-CoA kinase Back     alignment and domain information
>gnl|CDD|184807 PRK14730, coaE, dephospho-CoA kinase; Provisional Back     alignment and domain information
>gnl|CDD|178042 PLN02422, PLN02422, dephospho-CoA kinase Back     alignment and domain information
>gnl|CDD|185630 PTZ00451, PTZ00451, dephospho-CoA kinase; Provisional Back     alignment and domain information
>gnl|CDD|173193 PRK14731, coaE, dephospho-CoA kinase; Provisional Back     alignment and domain information
>gnl|CDD|184808 PRK14732, coaE, dephospho-CoA kinase; Provisional Back     alignment and domain information
>gnl|CDD|173196 PRK14734, coaE, dephospho-CoA kinase; Provisional Back     alignment and domain information
>gnl|CDD|179560 PRK03333, coaE, dephospho-CoA kinase/protein folding accessory domain-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|173195 PRK14733, coaE, dephospho-CoA kinase; Provisional Back     alignment and domain information
>gnl|CDD|30195 cd02022, DPCK, Dephospho-coenzyme A kinase (DPCK, EC 2 Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 199 dephospho-CoA kinase [Candidatus Liberibacter asiaticus
PRK00081199 coaE dephospho-CoA kinase; Reviewed 100.0
PRK03333 394 coaE dephospho-CoA kinase/unknown domain fusion protein 100.0
pfam01121179 CoaE Dephospho-CoA kinase. This family catalyses the ph 100.0
KOG3220225 consensus 100.0
cd02022179 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2.7.1.24) ca 100.0
COG0237201 CoaE Dephospho-CoA kinase [Coenzyme metabolism] 100.0
PRK01184183 hypothetical protein; Provisional 99.98
TIGR00152197 TIGR00152 dephospho-CoA kinase; InterPro: IPR001977 Thi 99.93
PRK08356195 hypothetical protein; Provisional 99.91
PRK05480209 uridine kinase; Provisional 99.65
PTZ00301210 uridine kinase; Provisional 99.58
PRK08233182 hypothetical protein; Provisional 99.56
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1.48), 99.55
PRK04182178 cytidylate kinase; Provisional 99.49
PRK07429 331 phosphoribulokinase; Provisional 99.45
TIGR02173173 cyt_kin_arch cytidylate kinase, putative; InterPro: IPR 99.44
COG0572218 Udk Uridine kinase [Nucleotide transport and metabolism 99.42
pfam00485196 PRK Phosphoribulokinase / Uridine kinase family. In Ara 99.37
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phosphory 99.35
PRK07667190 uridine kinase; Provisional 99.35
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and metabol 99.35
TIGR00235220 udk uridine kinase; InterPro: IPR000764 Uridine kinase 99.31
PRK06696227 uridine kinase; Validated 99.29
PRK03839180 putative kinase; Provisional 99.28
cd02026273 PRK Phosphoribulokinase (PRK) is an enzyme involved in 99.27
PRK00131175 aroK shikimate kinase; Reviewed 99.25
COG1936180 Predicted nucleotide kinase (related to CMP and AMP kin 99.25
PRK13947171 shikimate kinase; Provisional 99.23
PRK13946195 shikimate kinase; Provisional 99.22
PRK03731172 aroL shikimate kinase II; Reviewed 99.19
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_like) 99.18
PRK00625173 shikimate kinase; Provisional 99.18
PRK08154304 anaerobic benzoate catabolism transcriptional regulator 99.18
PRK13949169 shikimate kinase; Provisional 99.16
PRK09270230 frcK putative fructose transport system kinase; Reviewe 99.15
PRK05057172 aroK shikimate kinase I; Reviewed 99.14
PRK13948182 shikimate kinase; Provisional 99.12
PRK02496185 adk adenylate kinase; Provisional 99.06
PRK06547184 hypothetical protein; Provisional 99.01
PRK00279215 adk adenylate kinase; Reviewed 98.95
COG0703172 AroK Shikimate kinase [Amino acid transport and metabol 98.94
PRK05416 292 hypothetical protein; Provisional 98.92
COG0283222 Cmk Cytidylate kinase [Nucleotide transport and metabol 98.89
PRK00023225 cmk cytidylate kinase; Provisional 98.86
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in the shi 98.85
KOG3347176 consensus 98.83
PRK00698204 tmk thymidylate kinase; Validated 98.77
PRK11860662 bifunctional 3-phosphoshikimate 1-carboxyvinyltransfera 98.76
PRK09518 714 bifunctional cytidylate kinase/GTP-binding protein; Rev 98.75
PRK13477512 bifunctional pantoate ligase/cytidylate kinase; Provisi 98.74
pfam01202158 SKI Shikimate kinase. 98.72
pfam03668 284 ATP_bind_2 P-loop ATPase protein family. This family co 98.7
PRK06217185 hypothetical protein; Validated 98.67
KOG3079195 consensus 98.57
TIGR01359189 UMP_CMP_kin_fam UMP-CMP kinase family; InterPro: IPR006 98.57
PRK04040189 adenylate kinase; Provisional 98.57
PRK09825176 idnK D-gluconate kinase; Provisional 98.56
TIGR01360191 aden_kin_iso1 adenylate kinase; InterPro: IPR006267 Mem 98.54
TIGR03263180 guanyl_kin guanylate kinase. Members of this family are 98.53
PRK00300208 gmk guanylate kinase; Provisional 98.49
PRK11545177 gntK gluconate kinase 1; Provisional 98.46
COG0125208 Tmk Thymidylate kinase [Nucleotide transport and metabo 98.43
PRK13808297 adenylate kinase; Provisional 98.41
COG1660 286 Predicted P-loop-containing kinase [General function pr 98.4
pfam00406186 ADK Adenylate kinase. 98.39
COG0194191 Gmk Guanylate kinase [Nucleotide transport and metaboli 98.36
PRK13951 488 bifunctional shikimate kinase/3-dehydroquinate synthase 98.32
PRK12269 863 bifunctional cytidylate kinase/ribosomal protein S1; Pr 98.31
PRK10078184 ribose 1,5-bisphosphokinase; Provisional 98.3
PRK13973216 thymidylate kinase; Provisional 98.26
KOG3308225 consensus 98.24
COG0563178 Adk Adenylate kinase and related kinases [Nucleotide tr 98.19
PRK04220306 2-phosphoglycerate kinase; Provisional 98.07
COG1072283 CoaA Panthothenate kinase [Coenzyme metabolism] 98.06
PRK13974212 thymidylate kinase; Provisional 98.05
COG2019189 AdkA Archaeal adenylate kinase [Nucleotide transport an 98.03
PRK12339197 2-phosphoglycerate kinase; Provisional 97.97
COG4088261 Predicted nucleotide kinase [Nucleotide transport and m 97.94
TIGR00455187 apsK adenylylsulfate kinase; InterPro: IPR002891 Enzyme 97.9
KOG3354191 consensus 97.81
COG3265161 GntK Gluconate kinase [Carbohydrate transport and metab 97.78
PRK13975198 thymidylate kinase; Provisional 97.72
TIGR01313175 therm_gnt_kin carbohydrate kinase, thermoresistant gluc 97.54
PRK13976202 thymidylate kinase; Provisional 97.5
PRK06762166 hypothetical protein; Provisional 97.45
pfam07931174 CPT Chloramphenicol phosphotransferase-like protein. Th 97.29
PRK12338 320 hypothetical protein; Provisional 97.18
COG4185187 Uncharacterized protein conserved in bacteria [Function 97.06
TIGR00041211 DTMP_kinase thymidylate kinase; InterPro: IPR000062 Thy 96.81
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). Cm-i 96.56
COG2074299 2-phosphoglycerate kinase [Carbohydrate transport and m 96.3
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, contai 96.29
COG3640255 CooC CO dehydrogenase maturation factor [Cell division 96.1
PRK12337492 2-phosphoglycerate kinase; Provisional 94.5
TIGR00101199 ureG urease accessory protein UreG; InterPro: IPR004400 91.31
cd02024187 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme in 99.18
COG1428216 Deoxynucleoside kinases [Nucleotide transport and metab 98.67
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the 98.64
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversible pho 98.43
TIGR00017223 cmk cytidylate kinase; InterPro: IPR003136 This family 98.32
PRK05439312 pantothenate kinase; Provisional 98.31
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phosphoryl t 98.11
TIGR01351232 adk adenylate kinases; InterPro: IPR006259 Most members 97.93
PRK07261171 topology modulation protein; Provisional 97.84
TIGR03167311 tRNA_sel_U_synt tRNA 2-selenouridine synthase. The Esch 97.46
pfam08433266 KTI12 Chromatin associated protein KTI12. This is a fam 97.16
KOG4235244 consensus 96.74
COG4639168 Predicted kinase [General function prediction only] 96.69
pfam01745232 IPT Isopentenyl transferase. Isopentenyl transferase / 96.08
TIGR03018207 pepcterm_TyrKin exopolysaccharide/PEPCTERM locus tyrosi 95.08
KOG0733 802 consensus 94.98
cd02037169 MRP-like MRP (Multiple Resistance and pH adaptation) is 94.74
COG0489265 Mrp ATPases involved in chromosome partitioning [Cell d 93.05
COG0488530 Uup ATPase components of ABC transporters with duplicat 91.17
pfam00625182 Guanylate_kin Guanylate kinase. 98.7
cd02030219 NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO42) i 98.57
cd01672200 TMPK Thymidine monophosphate kinase (TMPK), also known 98.57
smart00072184 GuKc Guanylate kinase homologues. Active enzymes cataly 98.47
pfam02223186 Thymidylate_kin Thymidylate kinase. 98.18
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Members 98.14
PRK07933213 thymidylate kinase; Validated 97.57
COG3709192 Uncharacterized component of phosphonate metabolism [In 97.26
TIGR03575 340 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryotic. Me 97.04
KOG0707231 consensus 96.95
TIGR02322183 phosphon_PhnN phosphonate metabolism protein/1,5-bispho 96.38
KOG4203 473 consensus 95.6
PRK05541176 adenylylsulfate kinase; Provisional 98.27
PTZ00088225 adenylate kinase 1; Provisional 98.2
pfam06414191 Zeta_toxin Zeta toxin. This family consists of several 98.16
cd01673193 dNK Deoxyribonucleoside kinase (dNK) catalyzes the phos 98.15
PRK00889175 adenylylsulfate kinase; Provisional 98.12
PRK03846198 adenylylsulfate kinase; Provisional 98.09
PRK08118167 topology modulation protein; Reviewed 98.08
pfam01583157 APS_kinase Adenylylsulphate kinase. Enzyme that catalys 97.61
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyze 97.61
PRK13695174 putative NTPase; Provisional 97.21
COG0645170 Predicted kinase [General function prediction only] 97.2
TIGR00750333 lao LAO/AO transport system ATPase; InterPro: IPR005129 97.08
PRK11784333 tRNA 2-selenouridine synthase; Provisional 96.97
PRK00091 304 miaA tRNA delta(2)-isopentenylpyrophosphate transferase 96.89
COG3911183 Predicted ATPase [General function prediction only] 96.84
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein super 96.83
PRK13768253 GTPase; Provisional 96.81
COG0529197 CysC Adenylylsulfate kinase and related kinases [Inorga 96.68
pfam03266168 DUF265 Protein of unknown function, DUF265. 96.55
TIGR00972248 3a0107s01c2 phosphate ABC transporter, ATP-binding prot 96.32
COG1341 398 Predicted GTPase or GTP-binding protein [General functi 96.28
TIGR01448 769 recD_rel helicase, RecD/TraA family; InterPro: IPR00634 96.27
cd03116159 MobB Molybdenum is an essential trace element in the fo 96.27
pfam01591223 6PF2K 6-phosphofructo-2-kinase. This enzyme occurs as a 96.22
TIGR01663526 PNK-3'Pase polynucleotide kinase 3'-phosphatase; InterP 96.2
pfam02492174 cobW CobW/HypB/UreG, nucleotide-binding domain. This do 96.19
PRK05506613 bifunctional sulfate adenylyltransferase subunit 1/aden 96.18
COG0324 308 MiaA tRNA delta(2)-isopentenylpyrophosphate transferase 96.13
PRK05537568 bifunctional sulfate adenylyltransferase subunit 1/aden 96.09
pfam03215 490 Rad17 Rad17 cell cycle checkpoint protein. 96.09
TIGR02881261 spore_V_K stage V sporulation protein K; InterPro: IPR0 96.01
TIGR02782315 TrbB_P P-type conjugative transfer ATPase TrbB; InterPr 95.98
TIGR00602 670 rad24 checkpoint protein rad24; InterPro: IPR004582 To 95.97
pfam03029234 ATP_bind_1 Conserved hypothetical ATP binding protein. 95.96
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-binding 95.91
PRK08099411 nicotinamide-nucleotide adenylyltransferase; Provisiona 95.88
PRK09435325 arginine/ornithine transport system ATPase; Provisional 95.79
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a 95.66
TIGR01193710 bacteriocin_ABC ABC-type bacteriocin transporter; Inter 95.65
TIGR02788328 VirB11 P-type DNA transfer ATPase VirB11; InterPro: IPR 95.63
TIGR02203603 MsbA_lipidA lipid A export permease/ATP-binding protein 95.56
TIGR02769267 nickel_nikE nickel import ATP-binding protein NikE; Int 95.56
PRK10522547 multidrug transporter membrane component/ATP-binding co 95.45
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter that i 95.43
KOG0635207 consensus 95.42
KOG1384 348 consensus 95.41
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is a cen 95.4
cd03248226 ABCC_TAP TAP, the Transporter Associated with Antigen P 95.36
COG1763161 MobB Molybdopterin-guanine dinucleotide biosynthesis pr 95.34
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-binding p 95.34
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, closely 95.31
cd03246173 ABCC_Protease_Secretion This family represents the ABC 95.31
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTERM lo 95.24
PRK10789569 putative multidrug transporter membrane\ATP-binding com 95.21
PRK04195 403 replication factor C large subunit; Provisional 95.2
PRK13657585 cyclic beta-1,2-glucan ABC transporter; Provisional 95.2
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic fibr 95.19
PRK11160575 cysteine/glutathione ABC transporter membrane/ATP-bindi 95.18
KOG1970 634 consensus 95.14
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin exporte 95.13
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP-bindi 95.12
PRK10790593 putative multidrug transporter membrane\ATP-binding com 95.12
cd03291282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic fibr 95.09
pfam07693301 KAP_NTPase KAP family P-loop domain. The KAP (after Kid 95.06
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea receptor 95.0
pfam05049 375 IIGP Interferon-inducible GTPase (IIGP). Interferon-ind 95.0
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type tr 94.98
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-lik 94.98
cd03288257 ABCC_SUR2 The SUR domain 2. The sulfonylurea receptor S 94.97
PRK13632273 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.94
PRK06761281 hypothetical protein; Provisional 94.91
TIGR00958770 3a01208 antigen peptide transporter 2; InterPro: IPR005 94.89
PRK11176581 lipid transporter ATP-binding/permease protein; Provisi 94.84
PRK10751170 molybdopterin-guanine dinucleotide biosynthesis protein 94.83
PRK13634276 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.82
TIGR02475 349 CobW cobalamin biosynthesis protein CobW; InterPro: IPR 94.8
CHL00195491 ycf46 Ycf46; Provisional 94.8
KOG1969 877 consensus 94.8
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.8
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.79
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, LssB fa 94.76
PRK10584228 putative ABC transporter ATP-binding protein YbbA; Prov 94.76
PRK13640283 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.76
PRK13633281 cobalt transporter ATP-binding subunit; Provisional 94.76
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. This 94.76
PRK06620214 hypothetical protein; Validated 94.75
KOG3877 393 consensus 94.74
COG1149284 MinD superfamily P-loop ATPase containing an inserted f 94.72
COG1123539 ATPase components of various ABC-type transport systems 94.72
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in cyto 94.71
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.71
cd03257228 ABC_NikE_OppD_transporters The ABC transporter subfamil 94.69
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.69
PRK10247225 putative ABC transporter ATP-binding protein YbbL; Prov 94.65
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 94.65
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. This 94.64
PRK08939306 primosomal protein DnaI; Reviewed 94.63
PRK13650276 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.63
COG4598256 HisP ABC-type histidine transport system, ATPase compon 94.62
cd04104197 p47_IIGP_like p47 (47-kDa) family. The p47 GTPase famil 94.59
pfam02367123 UPF0079 Uncharacterized P-loop hydrolase UPF0079. This 94.57
PRK11264248 putative amino-acid ABC transporter ATP-binding protein 94.55
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; Provi 94.55
PRK11147 632 ABC transporter ATPase component; Reviewed 94.55
PRK13637287 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.51
PRK11819 556 putative ABC transporter ATP-binding protein; Reviewed 94.5
TIGR01420350 pilT_fam twitching motility protein; InterPro: IPR00632 94.5
PRK10419266 nikE nickel transporter ATP-binding protein; Provisiona 94.48
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette 94.47
PRK13631320 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.46
pfam05729165 NACHT NACHT domain. This NTPase domain is found in apop 94.41
TIGR00631 667 uvrb excinuclease ABC, B subunit; InterPro: IPR004807 A 94.41
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.39
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transport s 94.35
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC transpor 94.33
PRK13642277 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.32
PRK13643288 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.3
COG1132567 MdlB ABC-type multidrug transport system, ATPase and pe 94.28
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein PhnL; 94.27
pfam00004131 AAA ATPase family associated with various cellular acti 94.25
TIGR02770239 nickel_nikD nickel import ATP-binding protein NikD; Int 94.24
PRK10636 638 putative ABC transporter ATP-binding protein; Provision 94.18
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNa 94.17
PRK13647273 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.17
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC component 94.16
TIGR02982220 heterocyst_DevA ABC exporter ATP-binding subunit, DevA 94.16
cd03278197 ABC_SMC_barmotin Barmotin is a tight junction-associate 94.15
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding subunit 94.15
PRK13549 513 xylose transporter ATP-binding subunit; Provisional 94.14
COG1136226 SalX ABC-type antimicrobial peptide transport system, A 94.13
pfam00931285 NB-ARC NB-ARC domain. 94.12
PRK13651304 cobalt transporter ATP-binding subunit; Provisional 94.12
PRK10938 490 putative molybdenum transport ATP-binding protein ModF; 94.09
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transporter c 94.09
KOG0057591 consensus 94.09
CHL00181287 cbbX CbbX; Provisional 94.08
TIGR01842556 type_I_sec_PrtD type I secretion system ATPase; InterPr 94.08
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 94.07
PRK05800170 cobU adenosylcobinamide kinase/adenosylcobinamide-phosp 94.07
PRK10636 638 putative ABC transporter ATP-binding protein; Provision 94.06
PRK11147632 ABC transporter ATPase component; Reviewed 94.04
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is of f 94.02
cd03258233 ABC_MetN_methionine_transporter MetN (also known as Yus 94.01
PRK11819556 putative ABC transporter ATP-binding protein; Reviewed 93.99
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provisiona 93.99
COG3172187 NadR Predicted ATPase/kinase involved in NAD metabolism 93.98
PRK11308327 dppF dipeptide transporter ATP-binding subunit; Provisi 93.98
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ07 93.96
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding component 93.94
PRK13641286 cbiO cobalt transporter ATP-binding subunit; Provisiona 93.94
PRK13851343 type IV secretion system protein VirB11; Provisional 93.93
pfam10662143 PduV-EutP Ethanolamine utilisation - propanediol utilis 93.91
PRK09580248 sufC cysteine desulfurase ATPase component; Reviewed 93.9
TIGR03269 520 met_CoM_red_A2 methyl coenzyme M reductase system, comp 93.9
TIGR02868566 CydC ABC transporter, CydDC cysteine exporter (CydDC-E) 93.89
TIGR02857570 CydD ABC transporter, CydDC cysteine exporter (CydDC-E) 93.89
PRK10744257 phosphate transporter subunit; Provisional 93.88
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein; Rev 93.86
PRK11831269 putative ABC transporter ATP-binding protein YrbF; Prov 93.84
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-b 93.83
TIGR01447 753 recD exodeoxyribonuclease V, alpha subunit; InterPro: I 93.81
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-bi 93.81
PRK13342 417 recombination factor protein RarA; Reviewed 93.81
COG1134249 TagH ABC-type polysaccharide/polyol phosphate transport 93.8
cd03236255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNa 93.79
TIGR03269520 met_CoM_red_A2 methyl coenzyme M reductase system, comp 93.79
PRK10771233 thiQ thiamine transporter ATP-binding subunit; Provisio 93.78
COG0378202 HypB Ni2+-binding GTPase involved in regulation of expr 93.77
) of Arabidopsis thaliana (Mouse-ear cress), mammalian Gephryin (e.g. Q9NQX3 from SWISSPROT) and Drosophila melanogaster (Fruit fly) Cinnamon (P39205 from SWISSPROT) . The MobB domain is similar to that of the urease accessory protein UreG and the hydrogenase accessory protein HypB, both GTP hydrolases involved in loading nickel into the metallocentres of their respective target enzymes. It is involved in the final step of molybdenum-cofactor biosynthesis. While its precise function has not been identified it is thought to be involved in the transfer of a guanine dinucleotide moiety to molybdopterin, as it shows GTP-binding and weak GTPase activity . The MobB protein (P32125 from SWISSPROT) from Escherichia coli, which is comprised of this domain, is a homodimer . Each molecule is composed of two distinct regions - an outer region comprised of 6 beta-strands and three alpha helices, and an inner region comprised of a two-strand beta hairpin followed by an alpha helix. These regions require interaction with the second monomer to allow proper folding to occur. The two monomers are intertwined and form an extensive 16-stranded beta-sheet. While the active site could not be positively identified, the presence of highly conserved residues suggests the substrate binding site occurs in the central solvent channel.; GO: 0005525 GTP binding, 0006777 Mo-molybdopterin cofactor biosynthetic process." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR00176">TIGR00176165 mobB molybdopterin-guanine dinucleotide biosynthesis pr 93.77
cd02040270 NifH NifH gene encodes component II (iron protein) of n 93.77
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding com 93.77
TIGR00630 956 uvra excinuclease ABC, A subunit; InterPro: IPR004602 A 93.76
pfam08303169 tRNA_lig_kinase tRNA ligase kinase domain. This domain 93.73
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-bindi 93.71
PRK11701258 phnK phosphonates transport ATP-binding protein; Provis 93.69
PRK10938490 putative molybdenum transport ATP-binding protein ModF; 93.69
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provisiona 93.69
PRK13900332 type IV secretion system ATPase VirB11; Provisional 93.69
PRK13549513 xylose transporter ATP-binding subunit; Provisional 93.69
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the glycine 93.68
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; Provi 93.67
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cyt 93.66
cd03234226 ABCG_White The White subfamily represents ABC transport 93.65
TIGR00150147 TIGR00150 conserved hypothetical protein TIGR00150; Int 93.65
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-type tra 93.64
pfam03205122 MobB Molybdopterin guanine dinucleotide synthesis prote 93.64
PRK09473330 oppD oligopeptide transporter ATP-binding component; Pr 93.62
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonate tra 93.57
PRK13341 726 recombination factor protein RarA/unknown domain fusion 93.57
PRK13636285 cbiO cobalt transporter ATP-binding subunit; Provisiona 93.55
PRK09087226 hypothetical protein; Validated 93.54
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) tr 93.53
PRK09700 510 D-allose transporter ATP-binding protein; Provisional 93.5
KOG3062281 consensus 93.49
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC component o 93.49
PRK11248255 tauB taurine transporter ATP-binding subunit; Provision 93.48
cd03229178 ABC_Class3 This class is comprised of all BPD (Binding 93.47
PRK10762 501 D-ribose transporter ATP binding protein; Provisional 93.46
PRK11124242 artP arginine transporter ATP-binding subunit; Provisio 93.45
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 93.42
pfam00437283 GSPII_E Type II/IV secretion system protein. This famil 93.41
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor ( 93.4
cd02035217 ArsA ArsA ATPase functionas as an efflux pump located o 93.4
PTZ00265 1467 multidrug resistance protein (mdr1); Provisional 93.4
PRK13639275 cbiO cobalt transporter ATP-binding subunit; Provisiona 93.39
PRK10982 491 galactose/methyl galaxtoside transporter ATP-binding pr 93.38
smart00382148 AAA ATPases associated with a variety of cellular activ 93.37
cd02034116 CooC The accessory protein CooC, which contains a nucle 93.36
PRK10619257 histidine/lysine/arginine/ornithine transporter subunit 93.35
TIGR02533495 type_II_gspE general secretory pathway protein E; Inter 93.33
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 93.32
PRK11288 501 araG L-arabinose transporter ATP-binding protein; Provi 93.31
PRK10908222 cell division protein FtsE; Provisional 93.28
KOG4181 491 consensus 93.27
PRK13833323 conjugal transfer protein TrbB; Provisional 93.26
PRK10418254 nikD nickel transporter ATP-binding protein; Provisiona 93.26
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the ATPa 93.23
pfam00142269 Fer4_NifH 4Fe-4S iron sulfur cluster binding proteins, 93.2
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter nucle 93.18
PRK10646153 putative ATPase; Provisional 93.16
PRK10261 623 glutathione transporter ATP-binding protein; Provisiona 93.15
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter 93.15
cd03299235 ABC_ModC_like Archeal protein closely related to ModC. 93.14
PRK11288501 araG L-arabinose transporter ATP-binding protein; Provi 93.14
COG1117253 PstB ABC-type phosphate transport system, ATPase compon 93.11
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) f 93.09
KOG1532 366 consensus 93.08
TIGR01186 372 proV glycine betaine/L-proline transport ATP binding su 93.07
KOG0054 1381 consensus 93.07
cd00009151 AAA The AAA+ (ATPases Associated with a wide variety of 93.05
PRK11022327 dppD dipeptide transporter ATP-binding subunit; Provisi 93.04
PRK10070 400 glycine betaine transporter ATP-binding subunit; Provis 93.03
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 93.0
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranpor 93.0
TIGR00174 307 miaA tRNA delta(2)-isopentenylpyrophosphate transferase 92.99
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pigment 92.98
KOG1534273 consensus 92.97
PRK13544208 consensus 92.97
TIGR03415 382 ABC_choXWV_ATP choline ABC transporter, ATP-binding pro 92.96
COG5324 758 Uncharacterized conserved protein [Function unknown] 92.96
PRK09452 378 potA putrescine/spermidine ABC transporter ATPase prote 92.95
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-like (P 92.93
cd03217200 ABC_FeS_Assembly ABC-type transport system involved in 92.93
COG4615546 PvdE ABC-type siderophore export system, fused ATPase a 92.92
pfam04665241 Pox_A32 Poxvirus A32 protein. The A32 protein is though 92.91
PRK10851 352 sulfate/thiosulfate transporter subunit; Provisional 92.91
PRK11153 343 metN DL-methionine transporter ATP-binding subunit; Pro 92.9
PRK13547273 hmuV hemin importer ATP-binding subunit; Provisional 92.9
PRK11614237 livF leucine/isoleucine/valine transporter ATP-binding 92.88
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provisiona 92.87
KOG0058716 consensus 92.86
cd01130186 VirB11-like_ATPase Type IV secretory pathway component 92.79
cd03215182 ABC_Carb_Monos_II This family represents domain II of t 92.79
PRK13539206 cytochrome c biogenesis protein CcmA; Provisional 92.78
PRK13409 590 putative ATPase RIL; Provisional 92.76
cd03216163 ABC_Carb_Monos_I This family represents the domain I of 92.74
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleotide e 92.73
PTZ002651467 multidrug resistance protein (mdr1); Provisional 92.72
PRK09984262 phosphonate/organophosphate ester transporter subunit; 92.7
KOG1533290 consensus 92.7
PRK09544251 znuC high-affinity zinc transporter ATPase; Reviewed 92.67
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the maltose 92.65
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transport s 92.63
cd03235213 ABC_Metallic_Cations ABC component of the metal-type tr 92.62
PRK10982491 galactose/methyl galaxtoside transporter ATP-binding pr 92.62
TIGR02528144 EutP ethanolamine utilization protein, EutP; InterPro: 92.61
cd03230173 ABC_DR_subfamily_A This family of ATP-binding proteins 92.6
COG1122235 CbiO ABC-type cobalt transport system, ATPase component 92.58
PRK13548257 hmuV hemin importer ATP-binding subunit; Provisional 92.57
KOG0055 1228 consensus 92.56
PRK10895241 putative ABC transporter ATP-binding protein YhbG; Prov 92.54
pfam05496234 RuvB_N Holliday junction DNA helicase ruvB N-terminus. 92.54
PRK10261623 glutathione transporter ATP-binding protein; Provisiona 92.5
TIGR00968241 3a0106s01 sulfate ABC transporter, ATP-binding protein; 92.49
PRK10535 648 macrolide transporter ATP-binding /permease protein; Pr 92.48
COG1123 539 ATPase components of various ABC-type transport systems 92.47
pfam09848 348 DUF2075 Uncharacterized conserved protein (DUF2075). Th 92.46
PRK11650 358 ugpC glycerol-3-phosphate transporter ATP-binding subun 92.46
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of the L 92.43
PRK10762501 D-ribose transporter ATP binding protein; Provisional 92.4
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the transpo 92.36
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, invol 92.35
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Trans 92.33
PRK06851 368 hypothetical protein; Provisional 92.32
COG1118 345 CysA ABC-type sulfate/molybdate transport systems, ATPa 92.31
PRK09700510 D-allose transporter ATP-binding protein; Provisional 92.3
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporte 92.29
PRK13764 605 ATPase; Provisional 92.29
pfam05707183 Zot Zonular occludens toxin (Zot). This family consists 92.22
cd03271261 ABC_UvrA_II The excision repair protein UvrA domain II; 92.2
PRK11000 369 maltose/maltodextrin transporter ATP-binding protein; P 92.18
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is the 92.17
PRK10246 1047 exonuclease subunit SbcC; Provisional 92.16
TIGR02315253 ABC_phnC phosphonate ABC transporter, ATP-binding prote 92.14
cd03240204 ABC_Rad50 The catalytic domains of Rad50 are similar to 92.12
PRK06851368 hypothetical protein; Provisional 92.04
COG4240300 Predicted kinase [General function prediction only] 92.02
COG4167267 SapF ABC-type antimicrobial peptide transport system, A 92.01
TIGR01526346 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltransfe 92.0
PRK13894320 conjugal transfer ATPase TrbB; Provisional 91.99
PRK11300255 livG leucine/isoleucine/valine transporter ATP-binding 91.96
COG0541 451 Ffh Signal recognition particle GTPase [Intracellular t 91.94
PTZ00243 1560 ABC transporter; Provisional 91.92
PRK13542224 consensus 91.88
COG1126240 GlnQ ABC-type polar amino acid transport system, ATPase 91.87
COG0444316 DppD ABC-type dipeptide/oligopeptide/nickel transport s 91.87
PRK13409590 putative ATPase RIL; Provisional 91.83
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase component o 91.8
cd01124187 KaiC KaiC is a circadian clock protein primarily found 91.8
PRK06526254 transposase; Provisional 91.79
PRK11607 377 potG putrescine transporter ATP-binding subunit; Provis 91.78
TIGR03258 362 PhnT 2-aminoethylphosphonate ABC transport system, ATP- 91.77
PRK04328250 hypothetical protein; Provisional 91.72
TIGR02746 900 TraC-F-type type-IV secretion system protein TraC; Inte 91.72
PRK13545 549 tagH teichoic acids export protein ATP-binding subunit; 91.72
PRK11231255 fecE iron-dicitrate transporter ATP-binding subunit; Pr 91.71
COG4913 1104 Uncharacterized protein conserved in bacteria [Function 91.69
cd01918149 HprK_C HprK/P, the bifunctional histidine-containing pr 91.68
COG0467260 RAD55 RecA-superfamily ATPases implicated in signal tra 91.63
PRK10253265 iron-enterobactin transporter ATP-binding protein; Prov 91.62
PRK03695245 vitamin B12-transporter ATPase; Provisional 91.58
cd03115173 SRP The signal recognition particle (SRP) mediates the 91.56
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucleotide 91.46
TIGR00955 671 3a01204 Pigment precourser permease; InterPro: IPR00528 91.45
TIGR02673215 FtsE cell division ATP-binding protein FtsE; InterPro: 91.41
PRK11432 351 fbpC ferric transporter ATP-binding subunit; Provisiona 91.41
COG4987573 CydC ABC-type transport system involved in cytochrome b 91.39
PRK06921265 hypothetical protein; Provisional 91.37
COG0488 530 Uup ATPase components of ABC transporters with duplicat 91.29
KOG0736 953 consensus 91.29
COG3839 338 MalK ABC-type sugar transport systems, ATPase component 91.28
TIGR01194555 cyc_pep_trnsptr cyclic peptide transporter; InterPro: I 91.28
TIGR01978248 sufC FeS assembly ATPase SufC; InterPro: IPR010230 Iron 91.26
COG1100219 GTPase SAR1 and related small G proteins [General funct 91.24
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily represent 91.24
cd03270226 ABC_UvrA_I The excision repair protein UvrA domain I; N 91.22
PRK00440318 rfc replication factor C small subunit; Reviewed 91.17
COG1127263 Ttg2A ABC-type transport system involved in resistance 91.13
COG5635 824 Predicted NTPase (NACHT family) [Signal transduction me 91.11
cd00544169 CobU Adenosylcobinamide kinase / adenosylcobinamide pho 91.11
PRK01156 895 chromosome segregation protein; Provisional 91.0
PRK08181269 transposase; Validated 90.99
PRK09183258 transposase/IS protein; Provisional 90.99
PRK11144 352 modC molybdate transporter ATP-binding protein; Provisi 90.99
pfam02283166 CobU Cobinamide kinase / cobinamide phosphate guanyltra 90.95
COG4962355 CpaF Flp pilus assembly protein, ATPase CpaF [Intracell 90.91
cd03269210 ABC_putative_ATPase This subfamily is involved in drug 90.9
pfam01695178 IstB IstB-like ATP binding protein. This protein contai 90.88
PRK03992390 proteasome-activating nucleotidase; Provisional 90.87
PRK08116262 hypothetical protein; Validated 90.78
TIGR01187 331 potA polyamine ABC transporter, ATP-binding protein; In 90.76
KOG00551228 consensus 90.74
TIGR03371246 cellulose_yhjQ cellulose synthase operon protein YhjQ. 90.71
COG1855 604 ATPase (PilT family) [General function prediction only] 90.69
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding prote 90.65
TIGR00382 452 clpX ATP-dependent Clp protease, ATP-binding subunit Cl 90.63
TIGR02640265 gas_vesic_GvpN gas vesicle protein GvpN; InterPro: IPR0 90.61
PRK00349 944 uvrA excinuclease ABC subunit A; Reviewed 90.58
TIGR00956 1466 3a01205 Pleiotropic Drug Resistance (PDR) Family protei 90.55
PRK09601 364 translation-associated GTPase; Reviewed 90.55
TIGR01846703 type_I_sec_HlyB type I secretion system ATPase; InterPr 97.38
COG1618179 Predicted nucleotide kinase [Nucleotide transport and m 97.35
COG4608268 AppF ABC-type oligopeptide transport system, ATPase com 95.33
PRK11519720 tyrosine kinase; Provisional 93.94
KOG4238 627 consensus 91.33
cd02029277 PRK_like Phosphoribulokinase-like (PRK-like) is a famil 97.17
KOG2702323 consensus 96.09
cd03114148 ArgK-like The function of this protein family is unkown 96.2
COG1703323 ArgK Putative periplasmic protein kinase ArgK and relat 96.05
pfam03308267 ArgK ArgK protein. The ArgK protein acts as an ATPase e 95.93
cd03110179 Fer4_NifH_child This protein family's function is unkow 95.39
CHL00175279 minD septum-site determining protein; Validated 92.84
PRK13546264 teichoic acids export protein ATP-binding subunit; Prov 93.98
COG4619223 ABC-type uncharacterized transport system, ATPase compo 93.97
>PRK00081 coaE dephospho-CoA kinase; Reviewed Back     alignment and domain information
>PRK03333 coaE dephospho-CoA kinase/unknown domain fusion protein; Provisional Back     alignment and domain information
>pfam01121 CoaE Dephospho-CoA kinase Back     alignment and domain information
>KOG3220 consensus Back     alignment and domain information
>cd02022 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2 Back     alignment and domain information
>COG0237 CoaE Dephospho-CoA kinase [Coenzyme metabolism] Back     alignment and domain information
>PRK01184 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00152 TIGR00152 dephospho-CoA kinase; InterPro: IPR001977 This family contains dephospho-CoA kinases (2 Back     alignment and domain information
>PRK08356 hypothetical protein; Provisional Back     alignment and domain information
>PRK05480 uridine kinase; Provisional Back     alignment and domain information
>PTZ00301 uridine kinase; Provisional Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PRK04182 cytidylate kinase; Provisional Back     alignment and domain information
>PRK07429 phosphoribulokinase; Provisional Back     alignment and domain information
>TIGR02173 cyt_kin_arch cytidylate kinase, putative; InterPro: IPR011892 Proteins in this family are believed to be cytidylate kinase Back     alignment and domain information
>COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>pfam00485 PRK Phosphoribulokinase / Uridine kinase family Back     alignment and domain information
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway Back     alignment and domain information
>PRK07667 uridine kinase; Provisional Back     alignment and domain information
>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR00235 udk uridine kinase; InterPro: IPR000764 Uridine kinase (pyrimidine ribonucleoside kinase) is the rate-limiting enzyme in the pyrimidine salvage pathway Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>cd02026 PRK Phosphoribulokinase (PRK) is an enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK13947 shikimate kinase; Provisional Back     alignment and domain information
>PRK13946 shikimate kinase; Provisional Back     alignment and domain information
>PRK03731 aroL shikimate kinase II; Reviewed Back     alignment and domain information
>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PRK00625 shikimate kinase; Provisional Back     alignment and domain information
>PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed Back     alignment and domain information
>PRK13949 shikimate kinase; Provisional Back     alignment and domain information
>PRK09270 frcK putative fructose transport system kinase; Reviewed Back     alignment and domain information
>PRK05057 aroK shikimate kinase I; Reviewed Back     alignment and domain information
>PRK13948 shikimate kinase; Provisional Back     alignment and domain information
>PRK02496 adk adenylate kinase; Provisional Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>PRK00279 adk adenylate kinase; Reviewed Back     alignment and domain information
>COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05416 hypothetical protein; Provisional Back     alignment and domain information
>COG0283 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK00023 cmk cytidylate kinase; Provisional Back     alignment and domain information
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants Back     alignment and domain information
>KOG3347 consensus Back     alignment and domain information
>PRK00698 tmk thymidylate kinase; Validated Back     alignment and domain information
>PRK11860 bifunctional 3-phosphoshikimate 1-carboxyvinyltransferase/cytidine monophosphate kinase; Provisional Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTP-binding protein; Reviewed Back     alignment and domain information
>PRK13477 bifunctional pantoate ligase/cytidylate kinase; Provisional Back     alignment and domain information
>pfam01202 SKI Shikimate kinase Back     alignment and domain information
>pfam03668 ATP_bind_2 P-loop ATPase protein family Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>KOG3079 consensus Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family; InterPro: IPR006266 This subfamily of the adenylate kinase superfamily contains examples of UMP-CMP kinase, as well as others proteins with unknown specificity, some currently designated adenylate kinase Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information
>PRK09825 idnK D-gluconate kinase; Provisional Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase; InterPro: IPR006267 Members of this family are adenylate kinase, 2 Back