255764495

255764495

putative phosphoesterase protein

GeneID in NCBI database:8209608Locus tag:CLIBASIA_02480
Protein GI in NCBI database:255764495Protein Accession:YP_003065022.2
Gene range:-(666731, 667660)Protein Length:309aa
Gene description:putative phosphoesterase protein
COG prediction:[R] Predicted phosphohydrolases
KEGG prediction:putative phosphoesterase protein
SEED prediction:putative phosphohydrolases, Icc family
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------31
MTKRYTTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIFYDTLVL
cccccccccEEEEEEEEccccccccHHHccccEEEEEEEccccccccccHHHHHHHHHHHHHccccEEEEEccccccccHHHHHHHHHHHHHcccccEEEEEEcccccccccHHHHHHHHHHHHHHccccccccccccEEEEEcccEEEEEEccccccccccccccccHHHHHHHHHHHHHccccccEEEEEEEccccccccccccccccHHHHHHHHHHccccEEEEccEEccEEEEEEcccccEEEEEccccccccccccccccEEEEEEEcccccEEEEEEEEccccccEEEEHHHHHHHHHHccc
ccccHHHHHHHHHHHccccccccccHHHHHcHHHHHHHHHcHcHHHHccHHHHHHHHHHHHHccccEEEEEccHHccccHHHHHHHHHHHHHccccccEEEEcccccccHHHHHHHHHHHHHHHHccccccccccccccEEEEcccEEEEEEEcccccccHcccccccHHHHHHHHHHHHHccccccEEEEEEEcccccccccHHHHcccHHHHHHHHHHccccEEEEcccccccEEEcccccccEEEEEEcccccccccccccccEEEEEEEcccccEEEEEEEEEcccccccEEEEEEEEEEEEEcc
MTKRYTTIMFVLAHISDihlsyspsffelspkRIIGLVNWHFNRKKYFSKEVANLLINDILlhnvdhvsitgDIVNFTCNREIFTSTHWLrsignphdisivpgnhdayisgakeKSLHAWKDyitsdttcstgkklfpylrirnnialigcstaiatppfsangyfgqeQAHATSKLLRKANKKGFFRIImmhhppvldtsslyNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASAsqkvhsnkpqasynLFYIEKKNEYwtlegkrytlspdslsiqkdysdifyDTLVL
MTKRYTTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHhppvldtssLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASasqkvhsnkpqasynlFYIEKKNEYWTLEGKRytlspdslsiqkdysdifyDTLVL
MTKRYTTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIFYDTLVL
******T**FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIFYDTLVL
MTKRYTTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIA********NKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIFYDTLVL
***RYTTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIFYDTLVL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTKRYTTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIFYDTLVL
MTKRYTTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIFYDTLVL
MTKRYTTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIFYDTLVL

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target309 putative phosphoesterase protein [Candidatus Liberibact
315121809294 putative phosphoesterase protein [Candidatus Liberibact 1 1e-116
241205764302 metallophosphoesterase [Rhizobium leguminosarum bv. tri 1 6e-87
327193481306 putative phosphoesterase protein [Rhizobium etli CNPAF5 1 7e-86
190892804312 phosphoesterase [Rhizobium etli CIAT 652] Length = 312 1 2e-85
15966127300 hypothetical protein SMc02712 [Sinorhizobium meliloti 1 1 3e-84
116253249312 phosphoesterase [Rhizobium leguminosarum bv. viciae 384 1 4e-84
209550379302 metallophosphoesterase [Rhizobium leguminosarum bv. tri 1 1e-83
150397483300 metallophosphoesterase [Sinorhizobium medicae WSM419] L 1 9e-83
86358665312 putative phosphatase protein [Rhizobium etli CFN 42] Le 1 2e-82
325293623316 hypothetical protein AGROH133_07855 [Agrobacterium sp. 1 2e-82
>gi|315121809|ref|YP_004062298.1| putative phosphoesterase protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 294 Back     alignment and organism information
 Score =  422 bits (1086), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 210/301 (69%), Positives = 242/301 (80%), Gaps = 7/301 (2%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           MFVLAHISDIH+S   SF ELS KRIIGL NWHF RKKYFS  + +LL+NDIL HN++H+
Sbjct: 1   MFVLAHISDIHISCPLSFSELSLKRIIGLANWHFGRKKYFSHTMVDLLVNDILSHNINHL 60

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
           +ITGDIVN T N+EI  + HWL++I NPHDISIV GNHDAY + +K+KSL AW DYI  D
Sbjct: 61  AITGDIVNMTTNQEISEAIHWLKNIVNPHDISIVLGNHDAYTNSSKKKSLRAWSDYIAGD 120

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
           T     KK FPYLR+RNNIALIGCSTAIATPPFSANGYFGQEQ H TSKLLRKA K+G F
Sbjct: 121 TP-PIEKKQFPYLRVRNNIALIGCSTAIATPPFSANGYFGQEQDHDTSKLLRKAKKEGLF 179

Query: 189 RIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPV 248
           R++MMHHPP LDTS++YNRMFGI+RF+ MI  EGA+L+LHGHTH NSLHWI   KKLIPV
Sbjct: 180 RVVMMHHPPFLDTSTIYNRMFGIKRFKDMILREGAELMLHGHTHRNSLHWIDGAKKLIPV 239

Query: 249 VGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIFYDTLV 308
           VGIA+A       K  ASYNLFYIEKK++ WTL GKRYTLS DS  +QK+ S+IF +TL 
Sbjct: 240 VGIAAACH-----KKNASYNLFYIEKKHDCWTLRGKRYTLS-DSNGVQKNCSNIFNETLS 293

Query: 309 L 309
           L
Sbjct: 294 L 294


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|241205764|ref|YP_002976860.1| metallophosphoesterase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 302 Back     alignment and organism information
>gi|327193481|gb|EGE60376.1| putative phosphoesterase protein [Rhizobium etli CNPAF512] Length = 306 Back     alignment and organism information
>gi|190892804|ref|YP_001979346.1| phosphoesterase [Rhizobium etli CIAT 652] Length = 312 Back     alignment and organism information
>gi|15966127|ref|NP_386480.1| hypothetical protein SMc02712 [Sinorhizobium meliloti 1021] Length = 300 Back     alignment and organism information
>gi|116253249|ref|YP_769087.1| phosphoesterase [Rhizobium leguminosarum bv. viciae 3841] Length = 312 Back     alignment and organism information
>gi|209550379|ref|YP_002282296.1| metallophosphoesterase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 302 Back     alignment and organism information
>gi|150397483|ref|YP_001327950.1| metallophosphoesterase [Sinorhizobium medicae WSM419] Length = 300 Back     alignment and organism information
>gi|86358665|ref|YP_470557.1| putative phosphatase protein [Rhizobium etli CFN 42] Length = 312 Back     alignment and organism information
>gi|325293623|ref|YP_004279487.1| hypothetical protein AGROH133_07855 [Agrobacterium sp. H13-3] Length = 316 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target309 putative phosphoesterase protein [Candidatus Liberibact
pfam00149186 pfam00149, Metallophos, Calcineurin-like phosphoesteras 5e-08
cd07402240 cd07402, MPP_GpdQ, Enterobacter aerogenes GpdQ and rela 2e-06
cd07385223 cd07385, MPP_YkuE_C, Bacillus subtilis YkuE and related 6e-04
cd07400144 cd07400, MPP_YydB, Bacillus subtilis YydB and related p 2e-07
cd07400144 cd07400, MPP_YydB, Bacillus subtilis YydB and related p 2e-05
cd00838131 cd00838, MPP_superfamily, metallophosphatase superfamil 3e-05
COG1409301 COG1409, Icc, Predicted phosphohydrolases [General func 4e-20
>gnl|CDD|143917 pfam00149, Metallophos, Calcineurin-like phosphoesterase Back     alignment and domain information
>gnl|CDD|163645 cd07402, MPP_GpdQ, Enterobacter aerogenes GpdQ and related proteins, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|163628 cd07385, MPP_YkuE_C, Bacillus subtilis YkuE and related proteins, C-terminal metallophosphatase domain Back     alignment and domain information
>gnl|CDD|163643 cd07400, MPP_YydB, Bacillus subtilis YydB and related proteins, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|163643 cd07400, MPP_YydB, Bacillus subtilis YydB and related proteins, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|163614 cd00838, MPP_superfamily, metallophosphatase superfamily, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|31599 COG1409, Icc, Predicted phosphohydrolases [General function prediction only] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 309 putative phosphoesterase protein [Candidatus Liberibact
PRK11148275 cyclic 3',5'-adenosine monophosphate phosphodiesterase; 100.0
COG1409301 Icc Predicted phosphohydrolases [General function predi 99.96
PRK10966402 exonuclease subunit SbcD; Provisional 99.89
KOG3770577 consensus 99.85
COG0420 390 SbcD DNA repair exonuclease [DNA replication, recombina 99.84
KOG1432379 consensus 99.76
COG2129226 Predicted phosphoesterases, related to the Icc protein 99.75
PRK09453183 phosphodiesterase; Provisional 99.59
TIGR00040170 yfcE phosphodiesterase, MJ0936 family; InterPro: IPR000 99.41
COG0622172 Predicted phosphoesterase [General function prediction 99.4
PRK09418 780 bifunctional 2',3'-cyclic nucleotide 2'-phosphodiestera 99.31
KOG2310 646 consensus 99.23
TIGR00583424 mre11 DNA repair protein (mre11); InterPro: IPR003701 M 99.21
PRK09419 1260 bifunctional 2',3'-cyclic nucleotide 2'-phosphodiestera 99.17
PRK11907 810 bifunctional 2',3'-cyclic nucleotide 2'-phosphodiestera 99.05
TIGR01390 634 CycNucDiestase 2',3'-cyclic-nucleotide 2'-phosphodieste 98.46
PRK11340270 phosphodiesterase YaeI; Provisional 99.9
pfam00149186 Metallophos Calcineurin-like phosphoesterase. This fami 99.82
COG1768230 Predicted phosphohydrolase [General function prediction 99.62
TIGR01854241 lipid_A_lpxH UDP-2,3-diacylglucosamine hydrolase; Inter 99.41
COG2908237 Uncharacterized protein conserved in bacteria [Function 99.37
PRK04036497 DNA polymerase II small subunit; Validated 99.3
PRK09558 551 ushA bifunctional UDP-sugar hydrolase/5'-nucleotidase p 99.2
COG0737 517 UshA 5'-nucleotidase/2',3'-cyclic phosphodiesterase and 99.12
PRK09419 1260 bifunctional 2',3'-cyclic nucleotide 2'-phosphodiestera 98.89
COG1311481 HYS2 Archaeal DNA polymerase II, small subunit/DNA poly 98.88
COG4186186 Predicted phosphoesterase or phosphohydrolase [General 98.88
TIGR01530 550 nadN NAD nucleotidase; InterPro: IPR006420 This family 97.84
KOG4419 602 consensus 97.48
pfam09587237 PGA_cap Bacterial capsule synthesis protein PGA_cap. Th 92.9
KOG1378452 consensus 99.76
KOG2679336 consensus 99.38
pfam09423450 PhoD PhoD-like phosphatase. 98.92
KOG3947305 consensus 98.3
KOG2863 456 consensus 97.44
COG3540522 PhoD Phosphodiesterase/alkaline phosphatase D [Inorgani 97.43
COG5555392 Cytolysin, a secreted calcineurin-like phosphatase [Cel 96.82
smart00854239 PGA_cap Bacterial capsule synthesis protein PGA_cap. Th 95.08
COG1692266 Calcineurin-like phosphoesterase [General function pred 92.72
PRK10425258 DNase TatD; Provisional 91.99
PRK09982142 universal stress protein UspD; Provisional 91.78
COG1408284 Predicted phosphohydrolases [General function predictio 99.66
PRK05340240 UDP-2,3-diacylglucosamine hydrolase; Provisional 99.57
TIGR00619275 sbcd nuclease SbcCD, D subunit; InterPro: IPR004593 All 99.51
KOG3662410 consensus 98.66
COG1407235 Predicted ICC-like phosphoesterases [General function p 98.5
PHA02239235 putative protein phosphatase 98.5
PRK09968218 serine/threonine-specific protein phosphatase 2; Provis 98.24
PRK13625245 bis(5'-nucleosyl)-tetraphosphatase PrpE; Provisional 98.19
PRK11439218 pphA serine/threonine protein phosphatase 1; Provisiona 98.09
PRK00166275 apaH diadenosine tetraphosphatase; Reviewed 98.04
TIGR00024243 SbcD_rel_arch phosphoesterase, putative; InterPro: IPR0 98.03
pfam04042205 DNA_pol_E_B DNA polymerase alpha/epsilon subunit B. Thi 97.58
PRK09420 578 cpdB bifunctional 2',3'-cyclic nucleotide 2'-phosphodie 98.52
cd00144269 PP2Ac Protein phosphatase 2A homologues, catalytic doma 97.19
smart00156271 PP2Ac Protein phosphatase 2A homologues, catalytic doma 96.4
PTZ00244294 serine/threonine-protein phosphatase PP1; Provisional 96.03
KOG0374331 consensus 95.39
KOG3325183 consensus 96.82
PTZ00239303 serine/threonine protein phosphatase 2A; Provisional 95.98
pfam06874 641 FBPase_2 Firmicute fructose-1,6-bisphosphatase. This fa 95.25
TIGR00668280 apaH bis(5'-nucleosyl)-tetraphosphatase (symmetrical); 94.62
COG3855 648 Fbp Uncharacterized protein conserved in bacteria [Carb 91.43
KOG0371319 consensus 91.02
>PRK11148 cyclic 3',5'-adenosine monophosphate phosphodiesterase; Provisional Back     alignment and domain information
>COG1409 Icc Predicted phosphohydrolases [General function prediction only] Back     alignment and domain information
>PRK10966 exonuclease subunit SbcD; Provisional Back     alignment and domain information
>KOG3770 consensus Back     alignment and domain information
>COG0420 SbcD DNA repair exonuclease [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1432 consensus Back     alignment and domain information
>COG2129 Predicted phosphoesterases, related to the Icc protein [General function prediction only] Back     alignment and domain information
>PRK09453 phosphodiesterase; Provisional Back     alignment and domain information
>TIGR00040 yfcE phosphodiesterase, MJ0936 family; InterPro: IPR000979 Members of this largely uncharacterised family share a motif approximating DXH(X25)GDXXD(X25)GNHD as found in several phosphoesterases, including the nucleases SbcD and Mre11, and a family of uncharacterised archaeal putative phosphoesterases Back     alignment and domain information
>COG0622 Predicted phosphoesterase [General function prediction only] Back     alignment and domain information
>PRK09418 bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein; Reviewed Back     alignment and domain information
>KOG2310 consensus Back     alignment and domain information
>TIGR00583 mre11 DNA repair protein (mre11); InterPro: IPR003701 Mre11 and Rad50 are two proteins required for DNA repair and meiosis-specific double-strand break formation in Saccharomyces cerevisiae Back     alignment and domain information
>PRK09419 bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein; Reviewed Back     alignment and domain information
>PRK11907 bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein; Reviewed Back     alignment and domain information
>TIGR01390 CycNucDiestase 2',3'-cyclic-nucleotide 2'-phosphodiesterase; InterPro: IPR006294 These sequences represent 2',3'-cyclic-nucleotide 2'-phosphodiesterase; it is a bifunctional enzyme localized to the periplasm of Gram-negative bacteria Back     alignment and domain information
>PRK11340 phosphodiesterase YaeI; Provisional Back     alignment and domain information
>pfam00149 Metallophos Calcineurin-like phosphoesterase Back     alignment and domain information
>COG1768 Predicted phosphohydrolase [General function prediction only] Back     alignment and domain information
>TIGR01854 lipid_A_lpxH UDP-2,3-diacylglucosamine hydrolase; InterPro: IPR010138 This entry represents LpxH, or UDP-2,3-diacylglucosamine hydrolase (or pyrophosphatase), which is an essential enzyme in Escherichia coli that catalyses the fourth step in lipid A biosynthesis Back     alignment and domain information
>COG2908 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK04036 DNA polymerase II small subunit; Validated Back     alignment and domain information
>PRK09558 ushA bifunctional UDP-sugar hydrolase/5'-nucleotidase periplasmic precursor; Reviewed Back     alignment and domain information
>COG0737 UshA 5'-nucleotidase/2',3'-cyclic phosphodiesterase and related esterases [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK09419 bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein; Reviewed Back     alignment and domain information
>COG1311 HYS2 Archaeal DNA polymerase II, small subunit/DNA polymerase delta, subunit B [DNA replication, recombination, and repair] Back     alignment and domain information
>COG4186 Predicted phosphoesterase or phosphohydrolase [General function prediction only] Back     alignment and domain information
>TIGR01530 nadN NAD nucleotidase; InterPro: IPR006420 This family describes NadN of Haemophilus influenzae and a small number of close homologs in pathogenic, Gram-negative bacteria Back     alignment and domain information
>KOG4419 consensus Back     alignment and domain information
>pfam09587 PGA_cap Bacterial capsule synthesis protein PGA_cap Back     alignment and domain information
>KOG1378 consensus Back     alignment and domain information
>KOG2679 consensus Back     alignment and domain information
>pfam09423 PhoD PhoD-like phosphatase Back     alignment and domain information
>KOG3947 consensus Back     alignment and domain information
>KOG2863 consensus Back     alignment and domain information
>COG3540 PhoD Phosphodiesterase/alkaline phosphatase D [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG5555 Cytolysin, a secreted calcineurin-like phosphatase [Cell motility and secretion] Back     alignment and domain information
>smart00854 PGA_cap Bacterial capsule synthesis protein PGA_cap Back     alignment and domain information
>COG1692 Calcineurin-like phosphoesterase [General function prediction only] Back     alignment and domain information
>PRK10425 DNase TatD; Provisional Back     alignment and domain information
>PRK09982 universal stress protein UspD; Provisional Back     alignment and domain information
>COG1408 Predicted phosphohydrolases [General function prediction only] Back     alignment and domain information
>PRK05340 UDP-2,3-diacylglucosamine hydrolase; Provisional Back     alignment and domain information
>TIGR00619 sbcd nuclease SbcCD, D subunit; InterPro: IPR004593 All proteins in this family for which functions are known are double-stranded DNA exonuclease (as part of a complex with SbcC homologs) Back     alignment and domain information
>KOG3662 consensus Back     alignment and domain information
>COG1407 Predicted ICC-like phosphoesterases [General function prediction only] Back     alignment and domain information
>PHA02239 putative protein phosphatase Back     alignment and domain information
>PRK09968 serine/threonine-specific protein phosphatase 2; Provisional Back     alignment and domain information
>PRK13625 bis(5'-nucleosyl)-tetraphosphatase PrpE; Provisional Back     alignment and domain information
>PRK11439 pphA serine/threonine protein phosphatase 1; Provisional Back     alignment and domain information
>PRK00166 apaH diadenosine tetraphosphatase; Reviewed Back     alignment and domain information
>TIGR00024 SbcD_rel_arch phosphoesterase, putative; InterPro: IPR004376 Members of this uncharacterised family share a motif approximating DXH(X25)GDXXD(X25)GNHD as found in several phosphoesterases, including the nucleases SbcD and Mre11 Back     alignment and domain information
>pfam04042 DNA_pol_E_B DNA polymerase alpha/epsilon subunit B Back     alignment and domain information
>PRK09420 cpdB bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase periplasmic precursor protein; Reviewed Back     alignment and domain information
>cd00144 PP2Ac Protein phosphatase 2A homologues, catalytic domain Back     alignment and domain information
>smart00156 PP2Ac Protein phosphatase 2A homologues, catalytic domain Back     alignment and domain information
>PTZ00244 serine/threonine-protein phosphatase PP1; Provisional Back     alignment and domain information
>KOG0374 consensus Back     alignment and domain information
>KOG3325 consensus Back     alignment and domain information
>PTZ00239 serine/threonine protein phosphatase 2A; Provisional Back     alignment and domain information
>pfam06874 FBPase_2 Firmicute fructose-1,6-bisphosphatase Back     alignment and domain information
>TIGR00668 apaH bis(5'-nucleosyl)-tetraphosphatase (symmetrical); InterPro: IPR004617 Diadenosine 5',5"'-P1,P4-tetraphosphate (Ap4A) is a regulatory metabolite of stress conditions Back     alignment and domain information
>COG3855 Fbp Uncharacterized protein conserved in bacteria [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0371 consensus Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target309 putative phosphoesterase protein [Candidatus Liberibact
3ib7_A330 Crystal Structure Of Full Length Rv0805 Length = 33 4e-21
2hy1_A280 Crystal Structure Of Rv0805 Length = 280 1e-20
2hyo_A280 Crystal Structure Of Rv0805 N97a Mutant Length = 28 7e-20
2hyp_A280 Crystal Structure Of Rv0805 D66a Mutant Length = 28 7e-20
1war_A310 Recombinant Human Purple Acid Phosphatase Expressed 2e-09
2bq8_X304 Crystal Structure Of Human Purple Acid Phosphatase 2e-09
1qhw_A327 Purple Acid Phosphatase From Rat Bone Length = 327 4e-09
1ute_A313 Pig Purple Acid Phosphatase Complexed With Phosphat 2e-08
3dsc_A349 Crystal Structure Of P. Furiosus Mre11 Dna Synaptic 5e-08
1ii7_A333 Crystal Structure Of P. Furiosus Mre11 With Mangane 8e-08
3dsd_A349 Crystal Structure Of P. Furiosus Mre11-H85s Bound T 2e-07
1s8e_A333 Crystal Structure Of Mre11-3 Length = 333 3e-06
2dxl_A274 Glycerophosphodiesterase From Enterobacter Aerogene 4e-15
2zo9_B274 Malonate-Bound Structure Of The Glycerophosphodiest 4e-15
2q8u_A336 Crystal Structure Of Mre11 From Thermotoga Maritima 2e-09
3qg5_C379 The Mre11:rad50 Complex Forms An Atp Dependent Mole 3e-09
2xmo_A443 The Crystal Structure Of Lmo2642 Length = 443 7e-14
1kbp_A432 Kidney Bean Purple Acid Phosphatase Length = 432 2e-09
1qfc_A306 Structure Of Rat Purple Acid Phosphatase Length = 3 3e-09
2qfp_A424 Crystal Structure Of Red Kidney Bean Purple Acid Ph 3e-09
1xzw_A426 Sweet Potato Purple Acid PhosphatasePHOSPHATE COMPL 5e-07
>gi|260100110|pdb|3IB7|A Chain A, Crystal Structure Of Full Length Rv0805 Length = 330 Back     alignment and structure
 Score =  106 bits (264), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 40/281 (14%), Positives = 77/281 (27%), Gaps = 52/281 (18%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILL--HNVDH 67
           +VL HISD HL                +           + +    L+  +       D 
Sbjct: 26  YVLLHISDTHL----------------IGGDRRLYGAVDADDRLGELLEQLNQSGLRPDA 69

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHD--ISIVPGNHDAYISGAKEKSLHAWKDYI 125
           +  TGD+ +             +          +  V GNHD               +  
Sbjct: 70  IVFTGDLADKGEPAAYRKLRGLVEPFAAQLGAELVWVMGNHDDR------------AELR 117

Query: 126 TSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
                 +        + + + + +I   T++   P   +G     Q    ++ L      
Sbjct: 118 KFLLDEAPSMAPLDRVCMIDGLRIIVLDTSV---PGHHHGEIRASQLGWLAEELATPAPD 174

Query: 186 GFFRIIMMHHPPVLDTSSLYNRMF--GIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK 243
           G   I+ +HHPP+     +   +         +++       IL GH H ++        
Sbjct: 175 GT--ILALHHPPIPSVLDMAVTVELRDQAALGRVLRGTDVRAILAGHLHYSTNATFVG-- 230

Query: 244 KLIPVVGIASASQK---------VHSNKPQASYNLFYIEKK 275
             IPV   ++                       NL ++   
Sbjct: 231 --IPVSVASATCYTQDLTVAAGGTRGRDGAQGCNLVHVYPD 269


>gi|122920483|pdb|2HY1|A Chain A, Crystal Structure Of Rv0805 Length = 280 Back     alignment and structure
>gi|122920485|pdb|2HYO|A Chain A, Crystal Structure Of Rv0805 N97a Mutant Length = 280 Back     alignment and structure
>gi|122920487|pdb|2HYP|A Chain A, Crystal Structure Of Rv0805 D66a Mutant Length = 280 Back     alignment and structure
>gi|157880621|pdb|1WAR|A Chain A, Recombinant Human Purple Acid Phosphatase Expressed In Pichia Pastoris Length = 310 Back     alignment and structure
>gi|82408131|pdb|2BQ8|X Chain X, Crystal Structure Of Human Purple Acid Phosphatase With An Inhibitory Conformation Of The Repression Loop Length = 304 Back     alignment and structure
gi|6137538|pdb|1QHW|A Chain A, Purple Acid Phosphatase From Rat Bone Length = 327 Back     alignment and structure
>gi|6137386|pdb|1UTE|A Chain A, Pig Purple Acid Phosphatase Complexed With Phosphate Length = 313 Back     alignment and structure
>gi|209447464|pdb|3DSC|A Chain A, Crystal Structure Of P. Furiosus Mre11 Dna Synaptic Complex Length = 349 Back     alignment and structure
>gi|14488686|pdb|1II7|A Chain A, Crystal Structure Of P. Furiosus Mre11 With Manganese And Damp Length = 333 Back     alignment and structure
>gi|209447466|pdb|3DSD|A Chain A, Crystal Structure Of P. Furiosus Mre11-H85s Bound To A Branched Dna And Manganese Length = 349 Back     alignment and structure
>gi|52695447|pdb|1S8E|A Chain A, Crystal Structure Of Mre11-3 Length = 333 Back     alignment and structure
>gi|149241216|pdb|2DXL|A Chain A, Glycerophosphodiesterase From Enterobacter Aerogenes Length = 274 Back     alignment and structure
>gi|209156407|pdb|2ZO9|B Chain B, Malonate-Bound Structure Of The Glycerophosphodiesterase From Enterobacter Aerogenes (Gpdq) And Characterization Of The Native Fe2+ Metal Ion Preference Length = 274 Back     alignment and structure
>gi|151567968|pdb|2Q8U|A Chain A, Crystal Structure Of Mre11 From Thermotoga Maritima Msb8 (Tm1635) At 2.20 A Resolution Length = 336 Back     alignment and structure
>gi|329666215|pdb|3QG5|C Chain C, The Mre11:rad50 Complex Forms An Atp Dependent Molecular Clamp In Dna Double-Strand Break Repair Length = 379 Back     alignment and structure
>gi|323714329|pdb|2XMO|A Chain A, The Crystal Structure Of Lmo2642 Length = 443 Back     alignment and structure
>gi|1827635|pdb|1KBP|A Chain A, Kidney Bean Purple Acid Phosphatase Length = 432 Back     alignment and structure
>gi|7767180|pdb|1QFC|A Chain A, Structure Of Rat Purple Acid Phosphatase Length = 306 Back     alignment and structure
>gi|209447303|pdb|2QFP|A Chain A, Crystal Structure Of Red Kidney Bean Purple Acid Phosphatase In Complex With Fluoride Length = 424 Back     alignment and structure
>gi|60594488|pdb|1XZW|A Chain A, Sweet Potato Purple Acid PhosphatasePHOSPHATE COMPLEX Length = 426 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target309 putative phosphoesterase protein [Candidatus Liberibact
3ib7_A330 ICC protein; metallophosphoesterase, alpha-beta fold, s 7e-11
1ii7_A333 MRE11 nuclease; RAD50, DNA double-strand break repair, 6e-10
2q8u_A336 Exonuclease, putative; TM1635, structural genomics, joi 2e-09
2nxf_A322 Putative dimetal phosphatase; dinuclear metal center ph 5e-08
3d03_A274 Phosphohydrolase; glycerophosphodiesterase, metallohydr 1e-07
3c9f_A 557 5'-nucleotidase; 2',3'-cyclic phosphodiesterase, protei 3e-04
2yvt_A260 Hypothetical protein AQ_1956; structural genomics, unkn 8e-04
1uf3_A228 Hypothetical protein TT1561; metallo-dependent phosphat 4e-09
3ck2_A176 Conserved uncharacterized protein (predicted phosphoest 0.002
2z72_A342 Protein-tyrosine-phosphatase; cold-active enzyme, psych 0.003
>3ib7_A ICC protein; metallophosphoesterase, alpha-beta fold, swapped-dimer, hydrolase; HET: BTB; 1.60A {Mycobacterium tuberculosis} PDB: 3ib8_A* 2hy1_A 2hyp_A 2hyo_A Length = 330 Back     alignment and structure
 Score = 63.0 bits (152), Expect = 7e-11
 Identities = 43/252 (17%), Positives = 73/252 (28%), Gaps = 43/252 (17%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDI--LLHNVDH 67
           +VL HISD HL           +R+ G V+         + +    L+  +       D 
Sbjct: 26  YVLLHISDTHLIGGD-------RRLYGAVD---------ADDRLGELLEQLNQSGLRPDA 69

Query: 68  VSITGDIVNF--TCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYI 125
           +  TGD+ +                 +     ++  V GNHD      K     A     
Sbjct: 70  IVFTGDLADKGEPAAYRKLRGLVEPFAAQLGAELVWVMGNHDDRAELRKFLLDEAP-SMA 128

Query: 126 TSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
             D  C         L                + P   +G     Q    ++ L      
Sbjct: 129 PLDRVCMIDGLRIIVLDT--------------SVPGHHHGEIRASQLGWLAEELATPAPD 174

Query: 186 GFFRIIMMHHPPVLDTSSLYNRM--FGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK 243
           G    + +HHPP+     +   +         +++       IL GH H ++        
Sbjct: 175 GTI--LALHHPPIPSVLDMAVTVELRDQAALGRVLRGTDVRAILAGHLHYSTNATFVG-- 230

Query: 244 KLIPVVGIASAS 255
             IPV   ++  
Sbjct: 231 --IPVSVASATC 240


>1ii7_A MRE11 nuclease; RAD50, DNA double-strand break repair, DAMP, manganese, replication; HET: DA; 2.20A {Pyrococcus furiosus} SCOP: d.159.1.4 PDB: 3dsc_A* 3dsd_A* 1s8e_A Length = 333 Back     alignment and structure
>2q8u_A Exonuclease, putative; TM1635, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 2.20A {Thermotoga maritima MSB8} Length = 336 Back     alignment and structure
>2nxf_A Putative dimetal phosphatase; dinuclear metal center phosphatase, metalloprotein, metallophosphoesterase, protein structure initiative; 1.70A {Danio rerio} SCOP: d.159.1.12 Length = 322 Back     alignment and structure
>3d03_A Phosphohydrolase; glycerophosphodiesterase, metallohydrolase, phosphatase, metal ION; 1.90A {Enterobacter aerogenes} SCOP: d.159.1.11 PDB: 2zoa_A 2zo9_B 2dxn_A 2dxl_A Length = 274 Back     alignment and structure
>3c9f_A 5'-nucleotidase; 2',3'-cyclic phosphodiesterase, protein structure initiative, PSI-2; 1.90A {Candida albicans SC5314} SCOP: d.114.1.1 d.159.1.2 Length = 557 Back     alignment and structure
>2yvt_A Hypothetical protein AQ_1956; structural genomics, unknown function, NPPSFA, national project on protein structural and functional analyses; 1.60A {Aquifex aeolicus VF5} SCOP: d.159.1.6 Length = 260 Back     alignment and structure
>1uf3_A Hypothetical protein TT1561; metallo-dependent phosphatases, structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.10A {Thermus thermophilus} SCOP: d.159.1.6 Length = 228 Back     alignment and structure
>3ck2_A Conserved uncharacterized protein (predicted phosphoesterase COG0622); structural genomics, predicted phosphodiesterase, PSI-2; HET: SRT; 2.30A {Streptococcus pneumoniae TIGR4} SCOP: d.159.1.7 Length = 176 Back     alignment and structure
>2z72_A Protein-tyrosine-phosphatase; cold-active enzyme, psychrophIle, hydrolase; 1.10A {Shewanella SP} PDB: 1v73_A 2zbm_A Length = 342 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target309 putative phosphoesterase protein [Candidatus Liberibact
3ib7_A330 ICC protein; metallophosphoesterase, alpha-beta fold, s 100.0
3d03_A274 Phosphohydrolase; glycerophosphodiesterase, metallohydr 100.0
2nxf_A322 Putative dimetal phosphatase; dinuclear metal center ph 99.96
2q8u_A336 Exonuclease, putative; structural genomics, joint cente 99.93
1ii7_A333 MRE11 nuclease; RAD50, DNA double-strand break repair, 99.9
2yvt_A260 Hypothetical protein AQ_1956; structural genomics, unkn 99.89
1uf3_A228 Hypothetical protein TT1561; metallo-dependent phosphat 99.89
1ute_A313 Protein (II purple acid phosphatase); tartrate resistan 99.84
1nnw_A252 Hypothetical protein; structural genomics, PSI, protein 99.83
1s3l_A190 Hypothetical protein MJ0936; phosphodiesterase, nucleas 99.72
2a22_A215 Vacuolar protein sorting 29; alpha-beta-BETA-alpha sand 99.7
1z2w_A192 Vacuolar protein sorting 29; VPS29, retromer, phosphata 99.69
1su1_A208 Hypothetical protein YFCE; structural genomics, phospho 99.58
3ck2_A176 Conserved uncharacterized protein (predicted phosphoest 99.56
2kkn_A178 Uncharacterized protein; protein phosphatase 2A homolog 99.52
3gve_A341 YFKN protein; alpha-beta-BETA-alpha sandwich, structura 99.32
3jyf_A339 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'- nucleo 99.27
3e0j_A476 DNA polymerase subunit delta-2; DNA polymerase delta, P 98.45
1xzw_A426 Purple acid phosphatase; hydrolase; HET: NAG FUC MAN; 2 99.88
2qfp_A424 Purple acid phosphatase; binuclear, Fe-Zn, hydrolase; H 99.86
2z1a_A 552 5'-nucleotidase; metal-binding, nucleotide-binding, hyd 99.2
3ive_A 509 Nucleotidase; structural genomics, PSI-2, protein struc 99.19
1xm7_A195 Hypothetical protein AQ_1665; structural genomics, prot 99.17
1hp1_A 516 5'-nucleotidase; metallophosphatase, dinuclear, metallo 99.16
3c9f_A 557 5'-nucleotidase; 2',3'-cyclic phosphodiesterase, protei 99.08
2wdc_A 562 SOXB, sulfur oxidation protein SOXB; sulfur-sulfur hydr 98.92
1g5b_A221 Serine/threonine protein phosphatase; bacteriophage lam 98.71
2z72_A342 Protein-tyrosine-phosphatase; cold-active enzyme, psych 98.49
2qjc_A262 Diadenosine tetraphosphatase, putative; putative diaden 98.48
2dfj_A280 Diadenosinetetraphosphatase; helices and strands mixtur 97.88
2ie4_C309 PP2A-alpha;, serine/threonine-protein phosphatase 2A ca 97.04
3h63_A315 Serine/threonine-protein phosphatase 5; metalloenzyme, 96.07
3icf_A335 PPT, serine/threonine-protein phosphatase T; iron, meta 95.33
3flo_A460 DNA polymerase alpha subunit B; protein-protein complex 97.74
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, prot 95.8
1aui_A 521 Calcineurin, serine/threonine phosphatase 2B; hydrolase 94.95
3e7a_A299 PP-1A, serine/threonine-protein phosphatase PP1-alpha c 94.72
1fjm_A330 Protein serine/threonine phosphatase-1 (alpha isoform, 93.96
>3ib7_A ICC protein; metallophosphoesterase, alpha-beta fold, swapped-dimer, hydrolase; HET: BTB; 1.60A {Mycobacterium tuberculosis} PDB: 3ib8_A* 2hy1_A 2hyp_A 2hyo_A Back     alignment and structure
Probab=100.00  E-value=1.3e-33  Score=238.61  Aligned_cols=232  Identities=16%  Similarity=0.196  Sum_probs=171.4

Q ss_pred             EEEEEEECCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCHHHHHHHHHHHHHC--CCCEEEECCCCCCCCCHHHHHHHH
Q ss_conf             788994111427885410002221000121000001233089999999999626--997999937444489989999999
Q gi|255764495|r   10 FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH--NVDHVSITGDIVNFTCNREIFTST   87 (309)
Q Consensus        10 ~ri~hlSDlHlg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~i~~~--~pD~vvitGDl~~~~~~~~~~~~~   87 (309)
                      ++|+||||+||+......                .......+.|+++++.|++.  +||+||++|||++.|.+++|+.+.
T Consensus        26 ~~i~hiSD~Hl~~~~~~~----------------~~~~~~~~~l~~~l~~i~~~~~~pD~vvitGDl~~~g~~~~y~~~~   89 (330)
T 3ib7_A           26 YVLLHISDTHLIGGDRRL----------------YGAVDADDRLGELLEQLNQSGLRPDAIVFTGDLADKGEPAAYRKLR   89 (330)
T ss_dssp             EEEEEECCCCBCSSSCCB----------------TTTBCHHHHHHHHHHHHHHHTCCCSEEEECSCCBTTCCHHHHHHHH
T ss_pred             EEEEEECCCCCCCCCCCC----------------CCCCCHHHHHHHHHHHHHHCCCCCCEEEECCCCCCCCCHHHHHHHH
T ss_conf             899997888708987631----------------2574999999999999982298999999898778999999999999


Q ss_pred             HHHHHHC--CCCCEEEEECCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCEEEEECCCEEEEEECCCCCCCCCCCCC
Q ss_conf             9998618--99718999458842222035676643245431344444555621279971987999832888888755476
Q gi|255764495|r   88 HWLRSIG--NPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANG  165 (309)
Q Consensus        88 ~~~~~l~--~~~~v~~v~GNHD~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~l~s~~~~~~~~~~g  165 (309)
                      ++++.+.  .+.|+++|+||||....         +..++....   .......+....+++.+++|||....   ...|
T Consensus        90 ~~l~~~~~~~~~pv~~v~GNHD~~~~---------~~~~~~~~~---~~~~~~~~~~~~~~~~~~~ldt~~~~---~~~G  154 (330)
T 3ib7_A           90 GLVEPFAAQLGAELVWVMGNHDDRAE---------LRKFLLDEA---PSMAPLDRVCMIDGLRIIVLDTSVPG---HHHG  154 (330)
T ss_dssp             HHHHHHHHHHTCEEEECCCTTSCHHH---------HHHHHHCCC---CCCSCCCEEEEETTEEEEECCCCCTT---CCSB
T ss_pred             HHHHHHHHHCCCCEEEECCCCCCHHH---------HHHHHCCCC---CCCCCCEEEEEECCCEEEECCCCCCC---CCCC
T ss_conf             99999875249977995787764455---------544310136---66676304787078326643666678---7688


Q ss_pred             EECHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCC--CCCCCHHHHHHHHHHCCCEEEEECCCCCCEEEEEECCC
Q ss_conf             0089999999999852433697089998376888764311--01279789999998749819999876753247871699
Q gi|255764495|r  166 YFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLY--NRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK  243 (309)
Q Consensus       166 ~~~~~q~~~l~~~L~~~~~~~~~~iv~~Hhpp~~~~~~~~--~~~~~~~~l~~~l~~~~v~lvl~GH~H~~~~~~~~~~~  243 (309)
                      .++++|++||++.|++.+.  ..+|+++||||......+.  ..+.+++.+.+++++++++++||||+|.+....+.|  
T Consensus       155 ~~~~~ql~wL~~~L~~~~~--~~~iv~~HHpp~~~~~~~~~~~~~~~~~~l~~ll~~~~v~~vl~GH~H~~~~~~~~G--  230 (330)
T 3ib7_A          155 EIRASQLGWLAEELATPAP--DGTILALHHPPIPSVLDMAVTVELRDQAALGRVLRGTDVRAILAGHLHYSTNATFVG--  230 (330)
T ss_dssp             CCCHHHHHHHHHHTTSCCT--TCEEEECSSCSSCCSSGGGGGGSBSCHHHHHHHHTTSSEEEEEECSSSSCEEEEETT--
T ss_pred             CCCHHHHHHHHHHHHHCCC--CCEEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCEEEECCCCCCCEEEECC--
T ss_conf             5599999999998864778--876999816985677753344334447999999974698199977788049379999--


Q ss_pred             CCEEEEEECCCCCCCC---------CCCCCCCEEEEEEECCCCE
Q ss_conf             8689999576235778---------8887785489999538983
Q gi|255764495|r  244 KLIPVVGIASASQKVH---------SNKPQASYNLFYIEKKNEY  278 (309)
Q Consensus       244 ~~~~~~~~~s~~~~~~---------~~~~~~~y~li~i~~~~~~  278 (309)
                        ++++.+||++....         .....+||++|++.+++..
T Consensus       231 --i~~~~~pst~~~~~~~~~~~~~~~~~~~~g~~~i~~~~d~~v  272 (330)
T 3ib7_A          231 --IPVSVASATCYTQDLTVAAGGTRGRDGAQGCNLVHVYPDTVV  272 (330)
T ss_dssp             --EEEEECCCSSCEECTTSCTTCCCEESCSCEEEEEEECSSCEE
T ss_pred             --EEEEEECCCHHCCCCCCCCCCCCCCCCCCCEEEEEEECCCEE
T ss_conf             --999996962532667778887555568997599999599779



>3d03_A Phosphohydrolase; glycerophosphodiesterase, metallohydrolase, phosphatase, metal ION; 1.90A {Enterobacter aerogenes} SCOP: d.159.1.11 PDB: 2zoa_A 2zo9_B 2dxn_A 2dxl_A Back     alignment and structure
>2nxf_A Putative dimetal phosphatase; dinuclear metal center phosphatase, metalloprotein, metallophosphoesterase, protein structure initiative; 1.70A {Danio rerio} SCOP: d.159.1.12 Back     alignment and structure
>2q8u_A Exonuclease, putative; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 2.20A {Thermotoga maritima MSB8} Back     alignment and structure
>1ii7_A MRE11 nuclease; RAD50, DNA double-strand break repair, DAMP, manganese, replication; HET: DA; 2.20A {Pyrococcus furiosus} SCOP: d.159.1.4 PDB: 3dsc_A* 3dsd_A* 1s8e_A Back     alignment and structure
>2yvt_A Hypothetical protein AQ_1956; structural genomics, unknown function, NPPSFA, national project on protein structural and functional analyses; 1.60A {Aquifex aeolicus VF5} SCOP: d.159.1.6 Back     alignment and structure
>1uf3_A Hypothetical protein TT1561; metallo-dependent phosphatases, structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.10A {Thermus thermophilus} SCOP: d.159.1.6 Back     alignment and structure
>1ute_A Protein (II purple acid phosphatase); tartrate resistant acid phosphatase, metalloenzyme, uteroferrin, hydrolase; HET: NAG; 1.55A {Sus scrofa} SCOP: d.159.1.1 PDB: 1war_A* 2bq8_X 1qfc_A* 1qhw_A* Back     alignment and structure
>1nnw_A Hypothetical protein; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 1.90A {Pyrococcus furiosus} SCOP: d.159.1.5 PDB: 2gju_A Back     alignment and structure
>1s3l_A Hypothetical protein MJ0936; phosphodiesterase, nuclease, structural genomics, BSGC structure funded by NIH; 2.40A {Methanocaldococcus jannaschii} SCOP: d.159.1.7 PDB: 1s3m_A 1s3n_A 2ahd_A Back     alignment and structure
>2a22_A Vacuolar protein sorting 29; alpha-beta-BETA-alpha sandwich, structural genomics, structural genomics consortium, SGC, protein transport; 2.20A {Cryptosporidium parvum} SCOP: d.159.1.7 Back     alignment and structure
>1z2w_A Vacuolar protein sorting 29; VPS29, retromer, phosphatase, manganese, protein transport; 2.00A {Mus musculus} SCOP: d.159.1.7 PDB: 1z2x_A 3lh6_A 3lh7_A 1w24_A 2r17_A Back     alignment and structure
>1su1_A Hypothetical protein YFCE; structural genomics, phosphoesterase, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.25A {Escherichia coli} SCOP: d.159.1.7 Back     alignment and structure
>3ck2_A Conserved uncharacterized protein (predicted phosphoesterase COG0622); structural genomics, predicted phosphodiesterase, PSI-2; HET: SRT; 2.30A {Streptococcus pneumoniae TIGR4} SCOP: d.159.1.7 Back     alignment and structure
>2kkn_A Uncharacterized protein; protein phosphatase 2A homologue, structural genomics, PSI- 2, protein structure initiative; NMR {Thermotoga maritima} Back     alignment and structure
>3gve_A YFKN protein; alpha-beta-BETA-alpha sandwich, structural genomics, PSI-2, protein structure initiative; HET: CIT; 1.25A {Bacillus subtilis subsp} Back     alignment and structure
>3jyf_A 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'- nucleotidase bifunctional periplasmic...; APC63187.2; HET: EPE TAM; 2.43A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3e0j_A DNA polymerase subunit delta-2; DNA polymerase delta, P66 subunit, P50 subunit, human, DNA replication, DNA-directed DNA polymerase; HET: DNA; 3.00A {Homo sapiens} Back     alignment and structure
>1xzw_A Purple acid phosphatase; hydrolase; HET: NAG FUC MAN; 2.50A {Ipomoea batatas} SCOP: b.1.12.1 d.159.1.1 Back     alignment and structure
>2qfp_A Purple acid phosphatase; binuclear, Fe-Zn, hydrolase; HET: NAG NDG; 2.20A {Phaseolus vulgaris} SCOP: b.1.12.1 d.159.1.1 PDB: 2qfr_A* 1kbp_A* 3kbp_A* 4kbp_A* Back     alignment and structure
>2z1a_A 5'-nucleotidase; metal-binding, nucleotide-binding, hydrolase, structural genomics, NPPSFA; HET: THM; 1.75A {Thermus thermophilus HB8} SCOP: d.114.1.1 d.159.1.2 Back     alignment and structure
>3ive_A Nucleotidase; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics, nysgxrc; HET: CTN; 1.70A {Escherichia coli O6} PDB: 3ivd_A* Back     alignment and structure
>1xm7_A Hypothetical protein AQ_1665; structural genomics, protein structure initiative, midwest center for structural genomics, PSI, MCSG; 2.40A {Aquifex aeolicus VF5} SCOP: d.159.1.8 Back     alignment and structure
>1hp1_A 5'-nucleotidase; metallophosphatase, dinuclear, metalloenzyme, hydrolase, domain movement; HET: ATP; 1.70A {Escherichia coli} SCOP: d.114.1.1 d.159.1.2 PDB: 1ush_A 2ush_A 1hpu_A* 1ho5_A* 1oi8_A 1oid_A 1oie_A Back     alignment and structure
>3c9f_A 5'-nucleotidase; 2',3'-cyclic phosphodiesterase, protein structure initiative, PSI-2; 1.90A {Candida albicans SC5314} SCOP: d.114.1.1 d.159.1.2 Back     alignment and structure
>2wdc_A SOXB, sulfur oxidation protein SOXB; sulfur-sulfur hydrolysis, sulfur oxidation pathway, Cys S-thiosulfonate, hydrolase; 1.50A {Thermus thermophilus} PDB: 2wdd_A* 2wde_A 2wdf_A Back     alignment and structure
>1g5b_A Serine/threonine protein phosphatase; bacteriophage lambda, Ser/Thr protein phosphatase, ppase, manganese, sulfate, viral protein; 2.15A {Enterobacteria phage lambda} SCOP: d.159.1.3 Back     alignment and structure
>2z72_A Protein-tyrosine-phosphatase; cold-active enzyme, psychrophIle, hydrolase; 1.10A {Shewanella SP} PDB: 1v73_A 2zbm_A Back     alignment and structure
>2qjc_A Diadenosine tetraphosphatase, putative; putative diadenosine tetraphosphatase, monomer, PSI- 2, protein structure initiative, nysgrc; 2.05A {Trypanosoma brucei} Back     alignment and structure
>2dfj_A Diadenosinetetraphosphatase; helices and strands mixture, hydrolase; 2.72A {Shigella flexneri 2A} Back     alignment and structure
>2ie4_C PP2A-alpha;, serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform; protein-protein complex, heat repeat, signaling protein; HET: OKA; 2.60A {Homo sapiens} SCOP: d.159.1.3 PDB: 2npp_C* 3dw8_C* 3k7v_C* 3k7w_C* 3c5w_C 2ie3_C* 3fga_C* 2iae_C* 2nym_C* 2nyl_C* Back     alignment and structure
>3h63_A Serine/threonine-protein phosphatase 5; metalloenzyme, inhibitors, drug design, cytoplasm, hydrolase, iron, manganese, metal-binding, nucleus; HET: NHC; 1.30A {Homo sapiens} PDB: 3h60_A* 3h61_A* 3h62_C* 3h64_A* 3h66_A 3h67_A* 3h68_A* 3h69_A* 1s95_A Back     alignment and structure
>3icf_A PPT, serine/threonine-protein phosphatase T; iron, metalloprotein, structural genomics, PSI-2, protein structure initiative; 2.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3flo_A DNA polymerase alpha subunit B; protein-protein complex, phosphoesterase fold, OB fold, zinc-binding motif, DNA replication; HET: DNA; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1aui_A Calcineurin, serine/threonine phosphatase 2B; hydrolase, immunosuppression; 2.10A {Homo sapiens} SCOP: d.159.1.3 PDB: 2p6b_A 1tco_A* 1mf8_A* 1m63_A* 2jog_A Back     alignment and structure
>3e7a_A PP-1A, serine/threonine-protein phosphatase PP1-alpha catalytic subunit; PP1:nodularin CO-carbohydrate metabolism, cell cycle, cell division; HET: X9A; 1.63A {Homo sapiens} PDB: 3e7b_A* 3egg_A* 3egh_A* 3hvq_A 1jk7_A* 1it6_A* 2bcd_A* 2bdx_A* 2o8g_A 2o8a_A 1u32_A* 1s70_A* Back     alignment and structure
>1fjm_A Protein serine/threonine phosphatase-1 (alpha isoform, type 1); hydrolase, complex (hydrolase/toxin) complex; HET: ADD; 2.10A {Oryctolagus cuniculus} SCOP: d.159.1.3 Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 309 putative phosphoesterase protein [Candidatus Liberibact
d2nxfa1320 d.159.1.12 (A:3-322) Uncharacterized C17orf48 homolog z 1e-08
d2hy1a1256 d.159.1.11 (A:10-265) Rv0805 cyclic nucleotide phosphod 6e-08
d3d03a1271 d.159.1.11 (A:1-271) Glycerophosphodiesterase GpdQ {Ent 1e-07
d2yvta1257 d.159.1.6 (A:4-260) Uncharacterized protein Aq_1956 {Aq 1e-07
d1ii7a_333 d.159.1.4 (A:) Mre11 {Archaeon Pyrococcus furiosus [Tax 4e-07
d1uf3a_228 d.159.1.6 (A:) Hypothetical protein TT1561 {Thermus the 2e-08
d1nnwa_251 d.159.1.5 (A:) Hypothetical protein PF1291 {Archaeon Py 0.002
d3ck2a1173 d.159.1.7 (A:1-173) Uncharacterized protein SP1879 {Str 0.003
>d2nxfa1 d.159.1.12 (A:3-322) Uncharacterized C17orf48 homolog zgc:64213 {Zebrafish (Danio rerio) [TaxId: 7955]} Length = 320 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Metallo-dependent phosphatases
superfamily: Metallo-dependent phosphatases
family: ADPRibase-Mn-like
domain: Uncharacterized C17orf48 homolog zgc:64213
species: Zebrafish (Danio rerio) [TaxId: 7955]
 Score = 54.0 bits (128), Expect = 1e-08
 Identities = 33/283 (11%), Positives = 66/283 (23%), Gaps = 61/283 (21%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANL--LINDILLHNVD 66
           +F    I+D+  +                 N+   R++Y+      L   +       V 
Sbjct: 3   VFTFGLIADVQYADIEDGE-----------NYLRTRRRYYRGSADLLRDAVLQWRRERVQ 51

Query: 67  HVSITGDIVN------FTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHA 120
            V   GDI++         +R + T    L +                +   +   S   
Sbjct: 52  CVVQLGDIIDGHNRRRDASDRALDTVMAELDACSVDVHHVWGNHEFYNFSRPSLLSSRLN 111

Query: 121 WKDYITSDTTCSTGKKLFPYLRIRNN---------------------------------- 146
                 +DT                                                   
Sbjct: 112 SAQRTGTDTGSDLIGDDIYAYEFSPAPNFRFVLLDAYDLSVIGREEESEKHTHSWRILTQ 171

Query: 147 -------IALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVL 199
                  + L   S  +       NG F ++Q      +L  ++ K    +I  H P   
Sbjct: 172 HNHNLQDLNLPPVSVGLEQRFVKFNGGFSEQQLQWLDAVLTLSDHKQERVLIFSHLPVHP 231

Query: 200 DTSSLYNRMFGIQRFQKMIW-HEGADLILHGHTHLNSLHWIKN 241
             +      +  +    ++  H+     + GH H        +
Sbjct: 232 CAADPICLAWNHEAVLSVLRSHQSVLCFIAGHDHDGGRCTDSS 274


>d2hy1a1 d.159.1.11 (A:10-265) Rv0805 cyclic nucleotide phosphodiesterase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 256 Back     information, alignment and structure
>d3d03a1 d.159.1.11 (A:1-271) Glycerophosphodiesterase GpdQ {Enterobacter aerogenes [TaxId: 548]} Length = 271 Back     information, alignment and structure
>d2yvta1 d.159.1.6 (A:4-260) Uncharacterized protein Aq_1956 {Aquifex aeolicus [TaxId: 63363]} Length = 257 Back     information, alignment and structure
>d1ii7a_ d.159.1.4 (A:) Mre11 {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 333 Back     information, alignment and structure
>d1uf3a_ d.159.1.6 (A:) Hypothetical protein TT1561 {Thermus thermophilus [TaxId: 274]} Length = 228 Back     information, alignment and structure
>d1nnwa_ d.159.1.5 (A:) Hypothetical protein PF1291 {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 251 Back     information, alignment and structure
>d3ck2a1 d.159.1.7 (A:1-173) Uncharacterized protein SP1879 {Streptococcus pneumoniae [TaxId: 1313]} Length = 173 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target309 putative phosphoesterase protein [Candidatus Liberibact
d3d03a1271 Glycerophosphodiesterase GpdQ {Enterobacter aerogenes [ 100.0
d2hy1a1256 Rv0805 cyclic nucleotide phosphodiesterase {Mycobacteri 100.0
d2nxfa1320 Uncharacterized C17orf48 homolog zgc:64213 {Zebrafish ( 99.97
d2yvta1257 Uncharacterized protein Aq_1956 {Aquifex aeolicus [TaxI 99.93
d1ii7a_333 Mre11 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 99.9
d1uf3a_228 Hypothetical protein TT1561 {Thermus thermophilus [TaxI 99.9
d1utea_302 Mammalian purple acid phosphatase {Pig (Sus scrofa) [Ta 99.88
d1nnwa_251 Hypothetical protein PF1291 {Archaeon Pyrococcus furios 99.82
d2a22a1193 Vacuolar protein sorting 29, VPS29 {Cryptosporidium par 99.73
d1z2wa1182 Vacuolar protein sorting 29, VPS29 {Mouse (Mus musculus 99.71
d1s3la_165 Putative phosphodiesterase MJ0936 {Methanococcus jannas 99.64
d3ck2a1173 Uncharacterized protein SP1879 {Streptococcus pneumonia 99.58
d1su1a_184 Phosphodiesterase yfcE {Escherichia coli [TaxId: 562]} 99.47
d3c9fa2322 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal 99.04
d2qfra2312 Plant purple acid phosphatase, catalytic domain {Kidney 99.91
d1usha2337 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal 99.4
d1xm7a_188 Hypothetical protein aq_1666 {Aquifex aeolicus [TaxId: 99.3
d2z1aa2302 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal 99.15
d1t71a_281 Hypothetical protein MPN349 {Mycoplasma pneumoniae [Tax 90.62
d1g5ba_219 lambda ser/thr protein phosphatase {Bacteriophage lambd 98.75
d3c5wc1288 Protein phosphatase 2A catalytic subunit alpha isoform, 96.73
d1s95a_324 Serine/threonine protein phosphatase 5, PP5 {Human (Hom 96.18
d1auia_ 473 Protein phosphatase-2B (PP-2B, calcineurin A subunit) { 94.67
d1jk7a_294 Protein phosphatase-1 (PP-1) {Human (Homo sapiens), bet 94.53
>d3d03a1 d.159.1.11 (A:1-271) Glycerophosphodiesterase GpdQ {Enterobacter aerogenes [TaxId: 548]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Metallo-dependent phosphatases
superfamily: Metallo-dependent phosphatases
family: GpdQ-like
domain: Glycerophosphodiesterase GpdQ
species: Enterobacter aerogenes [TaxId: 548]
Probab=100.00  E-value=5e-31  Score=219.98  Aligned_cols=230  Identities=18%  Similarity=0.166  Sum_probs=164.1

Q ss_pred             EEEEEEECCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCHHHHHHHHHHHHH--CCCCEEEECCCCCCCCCHHHHHHHH
Q ss_conf             78899411142788541000222100012100000123308999999999962--6997999937444489989999999
Q gi|255764495|r   10 FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILL--HNVDHVSITGDIVNFTCNREIFTST   87 (309)
Q Consensus        10 ~ri~hlSDlHlg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~i~~--~~pD~vvitGDl~~~~~~~~~~~~~   87 (309)
                      -+|+||||+||+......                .......+.++.+++.+++  .+||+||++|||++.+.+++|+.+.
T Consensus         1 M~i~hiSD~Hl~~~~~~~----------------~~~~~~~~~l~~~~~~i~~~~~~~D~vv~~GDl~~~~~~~~y~~~~   64 (271)
T d3d03a1           1 MLLAHISDTHFRSRGEKL----------------YGFIDVNAANADVVSQLNALRERPDAVVVSGDIVNCGRPEEYQVAR   64 (271)
T ss_dssp             CEEEEECCCCBCSTTCCB----------------TTTBCHHHHHHHHHHHHHTCSSCCSEEEEESCCBSSCCHHHHHHHH
T ss_pred             CEEEEEECCCCCCCCCCC----------------CCCCCHHHHHHHHHHHHHHCCCCCCEEEECCCCCCCCCCHHHHHHH
T ss_conf             989999157579886420----------------2676899999999999983589999999895467288422689999


Q ss_pred             HHHHHHCCCCCEEEEECCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCEEEEECCCEEEEEECCCCCCCCCCCCCEE
Q ss_conf             99986189971899945884222203567664324543134444455562127997198799983288888875547600
Q gi|255764495|r   88 HWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYF  167 (309)
Q Consensus        88 ~~~~~l~~~~~v~~v~GNHD~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~l~s~~~~~~~~~~g~~  167 (309)
                      ++++++  ++|+++|+||||....  ............      ........+....+++++++|||.....   ..+.+
T Consensus        65 ~~l~~l--~~p~~~i~GNHD~~~~--~~~~~~~~~~~~------~~~~~~~~~~~~~~~~~~i~ldt~~~~~---~~~~l  131 (271)
T d3d03a1          65 QILGSL--NYPLYLIPGNHDDKAL--FLEYLQPLCPQL------GSDANNMRCAVDDFATRLLFIDSSRAGT---SKGWL  131 (271)
T ss_dssp             HHHTTC--SSCEEEECCTTSCHHH--HHHHHGGGSGGG------CSCGGGCCEEECSSSSEEEECCCCCTTC---SSBCC
T ss_pred             HHHHCC--CCCEEEEECCCCCHHH--HHHHHHHHHHCC------CCCCCCCEEEEECCCEEEEECCCCCCCC---CCCEE
T ss_conf             987505--9989999368642678--888766654203------3345763379943874798425565898---76412


Q ss_pred             CHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCC--CCCCCHHHHHHHHHHC-CCEEEEECCCCCCEEEEEECCCC
Q ss_conf             89999999999852433697089998376888764311--0127978999999874-98199998767532478716998
Q gi|255764495|r  168 GQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLY--NRMFGIQRFQKMIWHE-GADLILHGHTHLNSLHWIKNEKK  244 (309)
Q Consensus       168 ~~~q~~~l~~~L~~~~~~~~~~iv~~Hhpp~~~~~~~~--~~~~~~~~l~~~l~~~-~v~lvl~GH~H~~~~~~~~~~~~  244 (309)
                      +++|++||++.|++.+.  ...++++||||......+.  ..+.+++++.++|+++ +|+++||||+|++....+.|   
T Consensus       132 ~~~ql~wL~~~L~~~~~--~~~iv~~Hh~p~~~~~~~~d~~~~~~~~~l~~~l~~~~~v~~vl~GH~H~~~~~~~~g---  206 (271)
T d3d03a1         132 TDETISWLEAQLFEGGD--KPATIFMHHPPLPLGNAQMDPIACENGHRLLALVERFPSLTRIFCGHNHSLTMTQYRQ---  206 (271)
T ss_dssp             CHHHHHHHHHHHHHHTT--SCEEEEESSCSSCCSCTTTGGGSBTTTHHHHHHHHHCTTEEEEEECSSSSCEEEEETT---
T ss_pred             CHHHHHHHHHHHHHHCC--CEEEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCEEEEEECCCCHHHCEEECC---
T ss_conf             39999899998764136--4059995467535686544443433547899999734784799827756346059999---


Q ss_pred             CEEEEEECCCCCCCCCC---------CCCCCEEEEEEEC
Q ss_conf             68999957623577888---------8778548999953
Q gi|255764495|r  245 LIPVVGIASASQKVHSN---------KPQASYNLFYIEK  274 (309)
Q Consensus       245 ~~~~~~~~s~~~~~~~~---------~~~~~y~li~i~~  274 (309)
                       ++++.+||++......         -.+++|.+.....
T Consensus       207 -~~~~~~pst~~~~~~~~~~~~~~~~~~p~~~~~~~~~~  244 (271)
T d3d03a1         207 -ALISTLPGTVHQVPYCHADTDPYYDLSPASCLMHRQVG  244 (271)
T ss_dssp             -EEEEECCCSSCBCCCCSSCCSCEEBCCCCEEEEEEEET
T ss_pred             -EEEEECCCCEEECCCCCCCCCCCCCCCCCEEEEEEEEC
T ss_conf             -99998487415121577877755455898799999949



>d2hy1a1 d.159.1.11 (A:10-265) Rv0805 cyclic nucleotide phosphodiesterase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2nxfa1 d.159.1.12 (A:3-322) Uncharacterized C17orf48 homolog zgc:64213 {Zebrafish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d2yvta1 d.159.1.6 (A:4-260) Uncharacterized protein Aq_1956 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ii7a_ d.159.1.4 (A:) Mre11 {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1utea_ d.159.1.1 (A:) Mammalian purple acid phosphatase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1nnwa_ d.159.1.5 (A:) Hypothetical protein PF1291 {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2a22a1 d.159.1.7 (A:4-196) Vacuolar protein sorting 29, VPS29 {Cryptosporidium parvum [TaxId: 5807]}