peg_74

peg_74

GeneID in NCBI database:Locus tag:
Protein GI in NCBI database:not defined in NCBI databaseProtein Accession:
Gene range:+(74160, 74750)Protein Length:196aa
Gene description:
COG prediction:none
KEGG prediction:not defined in KEGG
SEED prediction:Ribonucleotide reductase of class Ia (aerobic), beta subunit (EC 1.17.4.1)
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Ribonucleotide reduction
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190------
MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFHYWNKRRRSRILTRSLRFLCRV
ccccccccHHccccccccHHHccHHccccccccccccccHHHHHHHHHHHHcccccccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHcc
ccccccccccccccccccccccHHHccccccEEEEcccHHHHHHHHHHHHcccccHHHcccHHHHHHccccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHcHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHEEEEEEcc
manntglspiqagekrvnvddkrmlnarsdvnqllplkYGWAWEKYLSACnnhwmptevpmqdDLALwkskngltddeRLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITslgldegelfnmyrevpsITAKANWALQytqtlsspsfhywnkrrrsRILTRSLRFLCRV
manntglspiqagekrvnvDDKRMlnarsdvnqllPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQtlsspsfhywnkrrrsriltrslrflcrv
MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFHYWNKrrrsriltrslrFLCRV
************************LNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFHYWNKRRRSRILTRSLRFLCRV
MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFHYWNKRRRSRILTRSLRFLCRV
*****GL*****GEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFHYWNKRRRSRILTRSLRFLCRV
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFHYWNKRRRSRILTRSLRFLCRV
MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFHYWNKRRRSRILTRSLRFLCRV
MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFHYWNKRRRSRILTRSLRFLCRV

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target196
254780964 352 ribonucleotide-diphosphate reductase subunit beta 1e-103
254780845 352 ribonucleotide-diphosphate reductase subunit beta 1e-103
25478115330 hypothetical protein CLIBASIA_05300 [Candidatus Li 2e-09
>gi|254780964|ref|YP_003065377.1| ribonucleotide-diphosphate reductase subunit beta [Candidatus Liberibacter asiaticus str. psy62] Length = 352 Back     alignment
 Score =  366 bits (940), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 174/174 (100%), Positives = 174/174 (100%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP
Sbjct: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ
Sbjct: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120

Query: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSF 174
           AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSF
Sbjct: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSF 174

>gi|254780845|ref|YP_003065258.1| ribonucleotide-diphosphate reductase subunit beta [Candidatus Liberibacter asiaticus str. psy62] Length = 352 Back     alignment
 Score =  366 bits (940), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 174/174 (100%), Positives = 174/174 (100%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP
Sbjct: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ
Sbjct: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120

Query: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSF 174
           AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSF
Sbjct: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSF 174

>gi|254781153|ref|YP_003065566.1| hypothetical protein CLIBASIA_05300 [Candidatus Liberibacter asiaticus str. psy62] Length = 30 Back     alignment
 Score = 54.3 bits (129), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 24/25 (96%), Positives = 25/25 (100%)

Query: 1  MANNTGLSPIQAGEKRVNVDDKRML 25
          MANNTGLSPIQAGEKRVNVDDKR+L
Sbjct: 1  MANNTGLSPIQAGEKRVNVDDKRIL 25

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target196
254780845 352 ribonucleotide-diphosphate reductase subunit beta [Cand 1 1e-100
72163401 354 ribonucleotide-diphosphate reductase subunit beta [Ther 1 5e-81
192291019 373 ribonucleotide-diphosphate reductase subunit beta [Rhod 1 9e-80
315122301 372 ribonucleotide-diphosphate reductase subunit beta [Cand 1 2e-79
110635036 369 ribonucleotide-diphosphate reductase subunit beta [Meso 1 2e-79
85714830 389 ribonucleotide reductase [Nitrobacter sp. Nb-311A] Leng 1 2e-79
92119123 416 ribonucleotide-diphosphate reductase subunit beta [Nitr 1 3e-79
75677068 391 ribonucleotide-diphosphate reductase subunit beta [Nitr 1 7e-79
297563527 360 ribonucleoside-diphosphate reductase [Nocardiopsis dass 1 4e-78
114321252 354 ribonucleotide-diphosphate reductase subunit beta [Alka 1 6e-78
>gi|254780845|ref|YP_003065258.1| ribonucleotide-diphosphate reductase subunit beta [Candidatus Liberibacter asiaticus str. psy62] Length = 352 Back     alignment and organism information
 Score =  366 bits (940), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 174/174 (100%), Positives = 174/174 (100%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP
Sbjct: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ
Sbjct: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120

Query: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSF 174
           AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSF
Sbjct: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSF 174


Species: Candidatus Liberibacter asiaticus
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|72163401|ref|YP_291058.1| ribonucleotide-diphosphate reductase subunit beta [Thermobifida fusca YX] Length = 354 Back     alignment and organism information
>gi|192291019|ref|YP_001991624.1| ribonucleotide-diphosphate reductase subunit beta [Rhodopseudomonas palustris TIE-1] Length = 373 Back     alignment and organism information
>gi|315122301|ref|YP_004062790.1| ribonucleotide-diphosphate reductase subunit beta [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 372 Back     alignment and organism information
>gi|110635036|ref|YP_675244.1| ribonucleotide-diphosphate reductase subunit beta [Mesorhizobium sp. BNC1] Length = 369 Back     alignment and organism information
>gi|85714830|ref|ZP_01045816.1| ribonucleotide reductase [Nitrobacter sp. Nb-311A] Length = 389 Back     alignment and organism information
>gi|92119123|ref|YP_578852.1| ribonucleotide-diphosphate reductase subunit beta [Nitrobacter hamburgensis X14] Length = 416 Back     alignment and organism information
>gi|75677068|ref|YP_319489.1| ribonucleotide-diphosphate reductase subunit beta [Nitrobacter winogradskyi Nb-255] Length = 391 Back     alignment and organism information
>gi|297563527|ref|YP_003682501.1| ribonucleoside-diphosphate reductase [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111] Length = 360 Back     alignment and organism information
>gi|114321252|ref|YP_742935.1| ribonucleotide-diphosphate reductase subunit beta [Alkalilimnicola ehrlichii MLHE-1] Length = 354 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target196
PRK07209 369 PRK07209, PRK07209, ribonucleotide-diphosphate reductas 1e-97
COG0208 348 COG0208, NrdF, Ribonucleotide reductase, beta subunit [ 7e-37
PTZ00211 330 PTZ00211, PTZ00211, ribonucleoside-diphosphate reductas 7e-19
KOG1567 344 KOG1567, KOG1567, KOG1567, Ribonucleotide reductase, be 5e-17
PLN02492 324 PLN02492, PLN02492, ribonucleoside-diphosphate reductas 2e-16
PRK09614 324 PRK09614, nrdF, ribonucleotide-diphosphate reductase su 1e-23
pfam00268 281 pfam00268, Ribonuc_red_sm, Ribonucleotide reductase, sm 4e-16
PRK12759 410 PRK12759, PRK12759, bifunctional gluaredoxin/ribonucleo 2e-06
PRK13967 322 PRK13967, nrdF1, ribonucleotide-diphosphate reductase s 2e-05
PRK13966 324 PRK13966, nrdF2, ribonucleotide-diphosphate reductase s 7e-05
PRK08326 311 PRK08326, PRK08326, ribonucleotide-diphosphate reductas 0.001
cd01049 288 cd01049, RNRR2, Ribonucleotide Reductase, R2/beta subun 7e-42
>gnl|CDD|180886 PRK07209, PRK07209, ribonucleotide-diphosphate reductase subunit beta; Validated Back     alignment and domain information
>gnl|CDD|30557 COG0208, NrdF, Ribonucleotide reductase, beta subunit [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|173476 PTZ00211, PTZ00211, ribonucleoside-diphosphate reductase small subunit; Provisional Back     alignment and domain information
>gnl|CDD|36780 KOG1567, KOG1567, KOG1567, Ribonucleotide reductase, beta subunit [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|178110 PLN02492, PLN02492, ribonucleoside-diphosphate reductase Back     alignment and domain information
>gnl|CDD|181991 PRK09614, nrdF, ribonucleotide-diphosphate reductase subunit beta; Reviewed Back     alignment and domain information
>gnl|CDD|144013 pfam00268, Ribonuc_red_sm, Ribonucleotide reductase, small chain Back     alignment and domain information
>gnl|CDD|139206 PRK12759, PRK12759, bifunctional gluaredoxin/ribonucleoside-diphosphate reductase subunit beta; Provisional Back     alignment and domain information
>gnl|CDD|140023 PRK13967, nrdF1, ribonucleotide-diphosphate reductase subunit beta; Provisional Back     alignment and domain information
>gnl|CDD|140022 PRK13966, nrdF2, ribonucleotide-diphosphate reductase subunit beta; Provisional Back     alignment and domain information
>gnl|CDD|181390 PRK08326, PRK08326, ribonucleotide-diphosphate reductase subunit beta; Validated Back     alignment and domain information
>gnl|CDD|153108 cd01049, RNRR2, Ribonucleotide Reductase, R2/beta subunit, ferritin-like diiron-binding domain Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 196
PRK07209 391 ribonucleotide-diphosphate reductase subunit beta; Vali 100.0
PTZ00211 330 ribonucleotide reductase small subunit; Provisional 100.0
PRK09101 376 nrdB ribonucleotide-diphosphate reductase subunit beta; 100.0
PRK09614 325 nrdF ribonucleotide-diphosphate reductase subunit beta; 100.0
COG0208 348 NrdF Ribonucleotide reductase, beta subunit [Nucleotide 100.0
KOG1567 344 consensus 100.0
PRK12759 410 bifunctional gluaredoxin/ribonucleoside-diphosphate red 100.0
pfam00268 281 Ribonuc_red_sm Ribonucleotide reductase, small chain. 100.0
cd01049 288 RNRR2 Ribonucleotide Reductase, R2/beta subunit, ferrit 100.0
PRK13966 324 nrdF2 ribonucleotide-diphosphate reductase subunit beta 100.0
PRK13965 337 ribonucleotide-diphosphate reductase subunit beta; Prov 100.0
PRK13967 322 nrdF1 ribonucleotide-diphosphate reductase subunit beta 100.0
cd07911 280 RNRR2_Rv0233_like Ribonucleotide Reductase R2-like prot 99.94
PRK08326 318 ribonucleotide-diphosphate reductase subunit beta; Vali 99.92
pfam11583 295 AurF P-aminobenzoate N-oxygenase AurF. AurF is a metall 92.71
PRK13778 316 paaA phenylacetate-CoA oxygenase subunit PaaA; Provisio 91.88
cd00657130 Ferritin_like Ferritin-like superfamily of diiron-conta 91.55
>PRK07209 ribonucleotide-diphosphate reductase subunit beta; Validated Back     alignment and domain information
>PTZ00211 ribonucleotide reductase small subunit; Provisional Back     alignment and domain information
>PRK09101 nrdB ribonucleotide-diphosphate reductase subunit beta; Reviewed Back     alignment and domain information
>PRK09614 nrdF ribonucleotide-diphosphate reductase subunit beta; Reviewed Back     alignment and domain information
>COG0208 NrdF Ribonucleotide reductase, beta subunit [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG1567 consensus Back     alignment and domain information
>PRK12759 bifunctional gluaredoxin/ribonucleoside-diphosphate reductase subunit beta; Provisional Back     alignment and domain information
>pfam00268 Ribonuc_red_sm Ribonucleotide reductase, small chain Back     alignment and domain information
>cd01049 RNRR2 Ribonucleotide Reductase, R2/beta subunit, ferritin-like diiron-binding domain Back     alignment and domain information
>PRK13966 nrdF2 ribonucleotide-diphosphate reductase subunit beta; Provisional Back     alignment and domain information
>PRK13965 ribonucleotide-diphosphate reductase subunit beta; Provisional Back     alignment and domain information
>PRK13967 nrdF1 ribonucleotide-diphosphate reductase subunit beta; Provisional Back     alignment and domain information
>cd07911 RNRR2_Rv0233_like Ribonucleotide Reductase R2-like protein, ferritin-like diiron-binding domain Back     alignment and domain information
>PRK08326 ribonucleotide-diphosphate reductase subunit beta; Validated Back     alignment and domain information
>pfam11583 AurF P-aminobenzoate N-oxygenase AurF Back     alignment and domain information
>PRK13778 paaA phenylacetate-CoA oxygenase subunit PaaA; Provisional Back     alignment and domain information
>cd00657 Ferritin_like Ferritin-like superfamily of diiron-containing four-helix-bundle proteins Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target196
2ani_A 346 Crystal Structure Of The F127y Mutant Of Ribonucleo 3e-43
1syy_A 346 Crystal Structure Of The R2 Subunit Of Ribonucleoti 3e-43
1h0n_A 390 Cobalt Substitution Of Mouse R2 Ribonucleotide Redu 2e-37
1jk0_A 419 Ribonucleotide Reductase Y2y4 Heterodimer Length = 3e-36
2uw2_A 332 Crystal Structure Of Human Ribonucleotide Reductase 7e-36
2vux_A 326 Human Ribonucleotide Reductase, Subunit M2 B Length 8e-36
3hf1_A 351 Crystal Structure Of Human P53r2 Length = 351 9e-36
1smq_A 399 Structure Of The Ribonucleotide Reductase Rnr2 Homo 1e-35
2o1z_A 311 Plasmodium Vivax Ribonucleotide Reductase Subunit R 4e-32
2p1i_A 349 Plasmodium Yoelii Ribonucleotide Reductase Subunit 5e-32
1jk0_B 345 Ribonucleotide Reductase Y2y4 Heterodimer Length = 4e-24
1biq_A 375 Ribonucleoside-Diphosphate Reductase 1 Beta Chain M 5e-18
1rsr_A 375 Azide Complex Of The Diferrous F208a Mutant R2 Subu 6e-18
1biq_B 375 Ribonucleoside-Diphosphate Reductase 1 Beta Chain M 6e-18
1xik_A 375 Ribonucleoside-Diphosphate Reductase 1 Beta Chain L 6e-18
1piy_A 375 Ribonucleotide Reductase R2 Soaked With Ferrous Ion 6e-18
1pim_A 375 Dithionite Reduced E. Coli Ribonucleotide Reductase 7e-18
1av8_A 340 Ribonucleotide Reductase R2 Subunit From E. Coli Le 1e-17
2av8_A 340 Y122f Mutant Of Ribonucleotide Reductase From Esche 1e-17
1pfr_A 340 Ribonucleoside-Diphosphate Reductase 1 Beta Chain L 1e-17
2alx_A 340 Ribonucleotide Reductase R2 From Escherichia Coli I 1e-17
1pm2_A 339 Crystal Structure Of Manganese Substituted R2-D84e 1e-17
2xof_A 375 Ribonucleotide Reductase Y122no2y Modified R2 Subun 2e-17
1yfd_A 375 Crystal Structure Of The Y122h Mutant Of Ribonucleo 2e-17
1rnr_A 375 Autocatalytic Generation Of Dopa In The Engineered 2e-17
1mrr_A 375 Substitution Of Manganese For Iron In Ribonucleotid 2e-17
1pj0_A 375 Ribonucleotide Reductase R2-D84eW48F MUTANT SOAKED 7e-16
2rcc_A 346 Crystal Structure Of Putative Class I Ribonucleotid 3e-14
2r2f_A 319 Ribonucleotide Reductase R2f Protein From Salmonell 7e-12
1uzr_A 296 Crystal Structure Of The Class Ib Ribonucleotide Re 4e-11
3n37_A 319 Ribonucleotide Reductase Dimanganese(Ii)-Nrdf From 5e-11
1kgn_A 329 R2f From Corynebacterium Ammoniagenes In Its Oxidis 2e-11
3mjo_A 296 Small Subunit (R2f) Of Native Ribonucleotide Reduct 3e-11
3ee4_A 323 R2-Like Ligand Binding MnFE OXIDASE FROM M. TUBERCU 6e-08
>gi|112489977|pdb|2ANI|A Chain A, Crystal Structure Of The F127y Mutant Of Ribonucleotide Reductase R2 From Chlamydia Trachomatis Length = 346 Back     alignment and structure
 Score =  178 bits (452), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 94/185 (50%), Positives = 132/185 (71%), Gaps = 2/185 (1%)

Query: 10  IQAGEKRVNVDDKRMLNAR-SDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALW 68
           +   +KRVN++ KR++N    DVNQL+P+KY WAWE YL+ C N+W+PTE+PM  D+ LW
Sbjct: 6   LDGKQKRVNLNSKRLVNCNQVDVNQLVPIKYKWAWEHYLNGCANNWLPTEIPMGKDIELW 65

Query: 69  KSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHS 128
           KS + L++DER +I  NLGFF+++ESLV NNIVLAI++H++NPE RQYLLRQAFEEAVH+
Sbjct: 66  KS-DRLSEDERRVILLNLGFFSTAESLVGNNIVLAIFKHVTNPEARQYLLRQAFEEAVHT 124

Query: 129 HTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFHYWNKRRRSRILTR 188
           HT+ YI  SLGLDE E+FN Y E  +I AK ++ ++ T  +  P+F   +       +  
Sbjct: 125 HTYLYICESLGLDEKEIFNAYNERAAIKAKDDFQMEITGKVLDPNFRTDSVEGLQEFVKN 184

Query: 189 SLRFL 193
            + + 
Sbjct: 185 LVGYY 189


gi|51247460|pdb|1SYY|A Chain A, Crystal Structure Of The R2 Subunit Of Ribonucleotide Reductase From Chlamydia Trachomatis Length = 346 Back     alignment and structure
gi|22218698|pdb|1H0N|A Chain A, Cobalt Substitution Of Mouse R2 Ribonucleotide Reductase To Model The Reactive Diferrous State Length = 390 Back     alignment and structure
>gi|15826569|pdb|1JK0|A Chain A, Ribonucleotide Reductase Y2y4 Heterodimer Length = 419 Back     alignment and structure
>gi|145580571|pdb|2UW2|A Chain A, Crystal Structure Of Human Ribonucleotide Reductase Subunit R2 Length = 332 Back     alignment and structure
>gi|194319980|pdb|2VUX|A Chain A, Human Ribonucleotide Reductase, Subunit M2 B Length = 326 Back     alignment and structure
gi|261278726|pdb|3HF1|A Chain A, Crystal Structure Of Human P53r2 Length = 351 Back     alignment and structure
gi|52695523|pdb|1SMQ|A Chain A, Structure Of The Ribonucleotide Reductase Rnr2 Homodimer From Saccharomyces Cerevisiae Length = 399 Back     alignment and structure
>gi|122921307|pdb|2O1Z|A Chain A, Plasmodium Vivax Ribonucleotide Reductase Subunit R2 (Pv086155) Length = 311 Back     alignment and structure
gi|145580416|pdb|2P1I|A Chain A, Plasmodium Yoelii Ribonucleotide Reductase Subunit R2 (Py03671) Length = 349 Back     alignment and structure
gi|15826570|pdb|1JK0|B Chain B, Ribonucleotide Reductase Y2y4 Heterodimer Length = 345 Back     alignment and structure
>gi|4389291|pdb|1BIQ|A Chain A, Ribonucleoside-Diphosphate Reductase 1 Beta Chain Mutant E238a Length = 375 Back     alignment and structure
>gi|40889712|pdb|1RSR|A Chain A, Azide Complex Of The Diferrous F208a Mutant R2 Subunit Of Ribonucleotide Reductase Length = 375 Back     alignment and structure
>gi|4389292|pdb|1BIQ|B Chain B, Ribonucleoside-Diphosphate Reductase 1 Beta Chain Mutant E238a Length = 375 Back     alignment and structure
>gi|1942079|pdb|1XIK|A Chain A, Ribonucleoside-Diphosphate Reductase 1 Beta Chain Length = 375 Back     alignment and structure
>gi|42543283|pdb|1PIY|A Chain A, Ribonucleotide Reductase R2 Soaked With Ferrous Ion At Neutral Ph Length = 375 Back     alignment and structure
>gi|33358114|pdb|1PIM|A Chain A, Dithionite Reduced E. Coli Ribonucleotide Reductase R2 Subunit, D84e Mutant Length = 375 Back     alignment and structure
>gi|3891582|pdb|1AV8|A Chain A, Ribonucleotide Reductase R2 Subunit From E. Coli Length = 340 Back     alignment and structure
>gi|3891570|pdb|2AV8|A Chain A, Y122f Mutant Of Ribonucleotide Reductase From Escherichia Coli Length = 340 Back     alignment and structure
>gi|1941986|pdb|1PFR|A Chain A, Ribonucleoside-Diphosphate Reductase 1 Beta Chain Length = 340 Back     alignment and structure
>gi|83754022|pdb|2ALX|A Chain A, Ribonucleotide Reductase R2 From Escherichia Coli In Space Group P6(1)22 Length = 340 Back     alignment and structure
>gi|42543295|pdb|1PM2|A Chain A, Crystal Structure Of Manganese Substituted R2-D84e (D84e Mutant Of The R2 Subunit Of E. Coli Ribonucleotide Reductase) Length = 339 Back     alignment and structure
>gi|304445703|pdb|2XOF|A Chain A, Ribonucleotide Reductase Y122no2y Modified R2 Subunit Of E. Coli Length = 375 Back     alignment and structure
>gi|61680624|pdb|1YFD|A Chain A, Crystal Structure Of The Y122h Mutant Of Ribonucleotide Reductase R2 Protein From E. Coli Length = 375 Back     alignment and structure
>gi|157879968|pdb|1RNR|A Chain A, Autocatalytic Generation Of Dopa In The Engineered Protein R2 F208y From Escherichia Coli Ribonucleotide Reductase And Crystal Structure Of The Dopa-208 Protein Length = 375 Back     alignment and structure
>gi|494379|pdb|1MRR|A Chain A, Substitution Of Manganese For Iron In Ribonucleotide Reductase From Escherichia Coli. Spectroscopic And Crystallographic Characterization Length = 375 Back     alignment and structure
>gi|42543287|pdb|1PJ0|A Chain A, Ribonucleotide Reductase R2-D84eW48F MUTANT SOAKED WITH Ferrous Ions At Neutral Ph Length = 375 Back     alignment and structure
>gi|158430770|pdb|2RCC|A Chain A, Crystal Structure Of Putative Class I Ribonucleotide Reductase (Np_241368.1) From Bacillus Halodurans At 1.90 A Resolution Length = 346 Back     alignment and structure
gi|4389108|pdb|2R2F|A Chain A, Ribonucleotide Reductase R2f Protein From Salmonella Typhimurium (Oxidized) Length = 319 Back     alignment and structure
>gi|51247866|pdb|1UZR|A Chain A, Crystal Structure Of The Class Ib Ribonucleotide Reductase R2f-2 Subunit From Mycobacterium Tuberculosis Length = 296 Back     alignment and structure
gi|303325061|pdb|3N37|A Chain A, Ribonucleotide Reductase Dimanganese(Ii)-Nrdf From Escherichia Coli Length = 319 Back     alignment and structure
>gi|18158911|pdb|1KGN|A Chain A, R2f From Corynebacterium Ammoniagenes In Its Oxidised, Fe Containing, Form Length = 329 Back     alignment and structure
>gi|304445906|pdb|3MJO|A Chain A, Small Subunit (R2f) Of Native Ribonucleotide Reductase From Corynebacterium Ammoniagenes Length = 296 Back     alignment and structure
>gi|226438223|pdb|3EE4|A Chain A, R2-Like Ligand Binding MnFE OXIDASE FROM M. TUBERCULOSIS Length = 323 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target196
1syy_A 346 Ribonucleoside-diphosphate reductase beta chain; DIIRON 1e-41
1jk0_A 419 RNR Y2, ribonucleoside-diphosphate reductase small chai 6e-38
1jk0_B 345 RNR Y4, ribonucleoside-diphosphate reductase small chai 4e-35
1h0o_A 390 Ribonucleoside-diphosphate reductase; oxidoreductase, r 2e-34
3dhz_A 329 Ribonucleotide reductase subunit R2F; metal free, hydro 3e-33
1mxr_A 375 Ribonucleotide reductase R2; radical protein, DI iron, 6e-33
1r2f_A 319 Protein (ribonucleotide reductase R2); nucleotide metab 5e-28
3mjo_A 296 Ribonucleotide reductase subunit R2F; Mn ribonucleotide 8e-28
3n37_A 319 Ribonucleoside-diphosphate reductase 2 subunit BE; ribo 1e-27
2p1i_A 349 Ribonucleotide reductase, small chain; F222 twinning, p 6e-27
2o1z_A 311 Ribonucleotide reductase subunit R2; small subunit ribo 1e-25
2rcc_A 346 Ribonucleoside-diphosphate reductase subunit beta; NP_2 1e-24
3ee4_A 323 Probable ribonucleoside-diphosphate reductase; manganes 4e-24
>1syy_A Ribonucleoside-diphosphate reductase beta chain; DIIRON, oxygen activation, iron coupled radical, immune evasion, replication; 1.70A {Chlamydia trachomatis} SCOP: a.25.1.2 PDB: 2ani_A Length = 346 Back     alignment and structure
 Score =  164 bits (415), Expect = 1e-41
 Identities = 95/186 (51%), Positives = 133/186 (71%), Gaps = 2/186 (1%)

Query: 10  IQAGEKRVNVDDKRMLNA-RSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALW 68
           +   +KRVN++ KR++N  + DVNQL+P+KY WAWE YL+ C N+W+PTE+PM  D+ LW
Sbjct: 6   LDGKQKRVNLNSKRLVNCNQVDVNQLVPIKYKWAWEHYLNGCANNWLPTEIPMGKDIELW 65

Query: 69  KSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHS 128
           KS + L++DER +I  NLGFF+++ESLV NNIVLAI++H++NPE RQYLLRQAFEEAVH+
Sbjct: 66  KS-DRLSEDERRVILLNLGFFSTAESLVGNNIVLAIFKHVTNPEARQYLLRQAFEEAVHT 124

Query: 129 HTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFHYWNKRRRSRILTR 188
           HTF YI  SLGLDE E+FN Y E  +I AK ++ ++ T  +  P+F   +       +  
Sbjct: 125 HTFLYICESLGLDEKEIFNAYNERAAIKAKDDFQMEITGKVLDPNFRTDSVEGLQEFVKN 184

Query: 189 SLRFLC 194
            + +  
Sbjct: 185 LVGYYI 190


>1jk0_A RNR Y2, ribonucleoside-diphosphate reductase small chain 1; ribonucleotide reductase, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: a.25.1.2 PDB: 1smq_A Length = 419 Back     alignment and structure
>1jk0_B RNR Y4, ribonucleoside-diphosphate reductase small chain 2; ribonucleotide reductase, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: a.25.1.2 PDB: 1sms_A Length = 345 Back     alignment and structure
>1h0o_A Ribonucleoside-diphosphate reductase; oxidoreductase, ribonucleotide reductase, dinuclear metal-cluster; 2.2A {Mus musculus} SCOP: a.25.1.2 PDB: 1h0n_A 1w68_A 1w69_A 1xsm_A 2uw2_A 3hf1_A 2vux_A Length = 390 Back     alignment and structure
>3dhz_A Ribonucleotide reductase subunit R2F; metal free, hydrogen bond, metal binding protein; 1.63A {Corynebacterium ammoniagenes} SCOP: a.25.1.2 PDB: 1kgo_A 1kgp_A 1oqu_A 1kgn_A 1uzr_A* Length = 329 Back     alignment and structure
>1mxr_A Ribonucleotide reductase R2; radical protein, DI iron, oxidoreductase; 1.42A {Escherichia coli} SCOP: a.25.1.2 PDB: 1jpr_A 1jqc_A 1xik_A 1yfd_A 1piy_A 1r65_A 1biq_B* 1rsv_A 1piz_A 1piu_A 1pim_A 1rsr_A 1biq_A* 1rib_A 1mrr_A 1rnr_A* 1pj0_A 1pj1_A 1av8_A 1pfr_A ... Length = 375 Back     alignment and structure
>1r2f_A Protein (ribonucleotide reductase R2); nucleotide metabolism, oxidoreductase; 2.10A {Salmonella typhimurium} SCOP: a.25.1.2 PDB: 2bq1_I* 2r2f_A Length = 319 Back     alignment and structure
>3mjo_A Ribonucleotide reductase subunit R2F; Mn ribonucleotide reductase, RNR, radical enzyme, split SIGN metallocofactor; 1.36A {Corynebacterium ammoniagenes} PDB: 1uzr_A* Length = 296 Back     alignment and structure
>3n37_A Ribonucleoside-diphosphate reductase 2 subunit BE; ribonucleotide reductase, four-helix bundle, dimanganese CLU oxidoreductase; 1.65A {Escherichia coli} PDB: 3n38_A 3n39_B* 3n3a_B* 3n3b_B* 1r2f_A 2bq1_I* 2r2f_A Length = 319 Back     alignment and structure
>2p1i_A Ribonucleotide reductase, small chain; F222 twinning, plasmodb PY03671, structural genomics consortium, SGC, oxidoreductase; 2.70A {Plasmodium yoelii yoelii str} Length = 349 Back     alignment and structure
>2o1z_A Ribonucleotide reductase subunit R2; small subunit ribonucleotide reductase, oxidoreductase, DNA replication, iron, DIIRON, radical, R2 subunit; 2.40A {Plasmodium vivax} Length = 311 Back     alignment and structure
>2rcc_A Ribonucleoside-diphosphate reductase subunit beta; NP_241368.1, putative class I ribonucleotide reductase, ribonucleotide reductase; HET: MSE PGE PG4; 1.90A {Bacillus halodurans c-125} Length = 346 Back     alignment and structure
>3ee4_A Probable ribonucleoside-diphosphate reductase; manganese, iron, DIIRON, carboxylate, oxidase, ligand, cavity, monooxygenase; HET: MYR; 1.90A {Mycobacterium tuberculosis} Length = 323 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target196
1syy_A 346 Ribonucleoside-diphosphate reductase beta chain; DIIRON 100.0
1h0o_A 390 Ribonucleoside-diphosphate reductase; oxidoreductase, r 100.0
1jk0_A 419 RNR Y2, ribonucleoside-diphosphate reductase small chai 100.0
2rcc_A 346 Ribonucleoside-diphosphate reductase subunit beta; NP_2 100.0
1mxr_A 375 Ribonucleotide reductase R2; radical protein, DI iron, 100.0
2p1i_A 349 Ribonucleotide reductase, small chain; F222 twinning, p 100.0
1jk0_B 345 RNR Y4, ribonucleoside-diphosphate reductase small chai 100.0
2o1z_A 311 Ribonucleotide reductase subunit R2; small subunit ribo 100.0
3n37_A 319 Ribonucleoside-diphosphate reductase 2 subunit BE; ribo 100.0
3dhz_A 329 Ribonucleotide reductase subunit R2F; metal free, hydro 100.0
3mjo_A 296 Ribonucleotide reductase subunit R2F; Mn ribonucleotide 100.0
3ee4_A 323 Probable ribonucleoside-diphosphate reductase; manganes 99.96
2inc_A 491 Toluene, O-xylene monooxygenase oxygenase subunit; DIIR 95.76
3ge3_A 500 Toluene-4-monooxygenase system protein A; DIIRON hydrox 94.41
>1syy_A Ribonucleoside-diphosphate reductase beta chain; DIIRON, oxygen activation, iron coupled radical, immune evasion, replication; 1.70A {Chlamydia trachomatis} SCOP: a.25.1.2 PDB: 2ani_A Back     alignment and structure
Probab=100.00  E-value=1.7e-44  Score=311.69  Aligned_cols=187  Identities=51%  Similarity=0.914  Sum_probs=176.8

Q ss_pred             HHHHHCCCCCCCCCCCCCCCCC-CCHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCHHHHHHHHCCCCCCCHHHHHHHHHH
Q ss_conf             4666306766783202242776-682200876278999999999850498334673461685204014898999999999
Q 537021.9.peg.7    7 LSPIQAGEKRVNVDDKRMLNAR-SDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRN   85 (196)
Q Consensus         7 ~~~i~~~~~~~~~~~~~ii~~~-~~~~~l~PikY~~~~~~yk~~~~~fW~peEI~l~~D~~dw~~~~~Lt~~Er~~~~~i   85 (196)
                      .|.+.++++++..++||||+|+ ++++||+||+|||+|++|++++++||+|+||||++|+.||++ ++||++||++++++
T Consensus         3 ~~~~~~~~~~~~~~~~~~~~g~~~~~~~l~PikYp~~~~~ykk~~~~fW~peEi~ls~D~~dw~~-~kL~~~er~~~~~~   81 (346)
T 1syy_A            3 ADILDGKQKRVNLNSKRLVNCNQVDVNQLVPIKYKWAWEHYLNGCANNWLPTEIPMGKDIELWKS-DRLSEDERRVILLN   81 (346)
T ss_dssp             CSSGGGGGGSCCGGGCCSSSCCSSCTTCCCSCCCHHHHHHHHHHHHTCCCGGGSCCHHHHHHHHS-SCSCHHHHHHHHHH
T ss_pred             CCHHCCCCCCCCCCCCEEECCCCCCHHHCCCCCCHHHHHHHHHHHHCCCCCHHCCCCCCHHHHHH-CCCCHHHHHHHHHH
T ss_conf             41310545456711040258998765550898777999999999976998311075123988865-89999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHCCHHHHHHHHHHHHH
Q ss_conf             99997763677777788887652868999999999999999999999999982376368999995099999999999999
Q 537021.9.peg.7   86 LGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQY  165 (196)
Q Consensus        86 L~ffs~~D~~v~~nl~~~i~~~i~~pE~~~~~~~q~~~E~iHs~sYs~il~tl~~d~~eif~~~~~~p~i~~K~~~~~k~  165 (196)
                      |+||+++|++|+.++...+++.++.||+++++++|+++|+||++||+++++++++|++|+|+++.++|++++|++|+.++
T Consensus        82 l~~~~~~D~~v~~~~~~~~~~~~~~~E~~~~~~~~~~~E~iHs~sYs~i~~~l~~d~~e~~~~~~~~~~i~~k~~~~~~~  161 (346)
T 1syy_A           82 LGFFSTAESLVGNNIVLAIFKHVTNPEARQYLLRQAFEEAVHTHTFLYICESLGLDEKEIFNAYNERAAIKAKDDFQMEI  161 (346)
T ss_dssp             HHHHHHHHHHHHHHHHHTHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHTCCHHHHTTHHHHCHHHHHHHHHHHHT
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999898899830799899883809999999999999999999999999985688899999984059999999999986


Q ss_pred             HHHHHCCCCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             98530113344793348999999999963
Q 537021.9.peg.7  166 TQTLSSPSFHYWNKRRRSRILTRSLRFLC  194 (196)
Q Consensus       166 ~~~i~~~~~~~~~~e~~~~~l~~li~f~~  194 (196)
                      ++.+.++.......+..+.+++.+++|.+
T Consensus       162 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  190 (346)
T 1syy_A          162 TGKVLDPNFRTDSVEGLQEFVKNLVGYYI  190 (346)
T ss_dssp             TSGGGSTTCCSSSHHHHHHHHHHHHHHHT
T ss_pred             HHHHCCCCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             64100333110231008999999999999



>1h0o_A Ribonucleoside-diphosphate reductase; oxidoreductase, ribonucleotide reductase, dinuclear metal-cluster; 2.2A {Mus musculus} SCOP: a.25.1.2 PDB: 1h0n_A 1w68_A 1w69_A 1xsm_A 2uw2_A 3hf1_A 2vux_A Back     alignment and structure
>1jk0_A RNR Y2, ribonucleoside-diphosphate reductase small chain 1; ribonucleotide reductase, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: a.25.1.2 PDB: 1smq_A Back     alignment and structure
>2rcc_A Ribonucleoside-diphosphate reductase subunit beta; NP_241368.1, putative class I ribonucleotide reductase, ribonucleotide reductase; HET: MSE PGE PG4; 1.90A {Bacillus halodurans c-125} Back     alignment and structure
>1mxr_A Ribonucleotide reductase R2; radical protein, DI iron, oxidoreductase; 1.42A {Escherichia coli} SCOP: a.25.1.2 PDB: 1jpr_A 1jqc_A 1xik_A 1yfd_A 1piy_A 1r65_A 1biq_B* 1rsv_A 1piz_A 1piu_A 1pim_A 1rsr_A 1biq_A* 1rib_A 1mrr_A 1rnr_A* 1pj0_A 1pj1_A 1av8_A 1pfr_A ... Back     alignment and structure
>2p1i_A Ribonucleotide reductase, small chain; F222 twinning, plasmodb PY03671, structural genomics consortium, SGC, oxidoreductase; 2.70A {Plasmodium yoelii yoelii str} Back     alignment and structure
>1jk0_B RNR Y4, ribonucleoside-diphosphate reductase small chain 2; ribonucleotide reductase, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: a.25.1.2 PDB: 1sms_A Back     alignment and structure
>2o1z_A Ribonucleotide reductase subunit R2; small subunit ribonucleotide reductase, oxidoreductase, DNA replication, iron, DIIRON, radical, R2 subunit; 2.40A {Plasmodium vivax} Back     alignment and structure
>3n37_A Ribonucleoside-diphosphate reductase 2 subunit BE; ribonucleotide reductase, four-helix bundle, dimanganese CLU oxidoreductase; 1.65A {Escherichia coli} PDB: 3n38_A 3n39_B* 3n3a_B* 3n3b_B* 1r2f_A 2bq1_I* 2r2f_A Back     alignment and structure
>3dhz_A Ribonucleotide reductase subunit R2F; metal free, hydrogen bond, metal binding protein; 1.63A {Corynebacterium ammoniagenes} SCOP: a.25.1.2 PDB: 1kgo_A 1kgp_A 1oqu_A 1kgn_A 1uzr_A* Back     alignment and structure
>3mjo_A Ribonucleotide reductase subunit R2F; Mn ribonucleotide reductase, RNR, radical enzyme, split SIGN metallocofactor; 1.36A {Corynebacterium ammoniagenes} PDB: 1uzr_A* Back     alignment and structure
>3ee4_A Probable ribonucleoside-diphosphate reductase; manganese, iron, DIIRON, carboxylate, oxidase, ligand, cavity, monooxygenase; HET: MYR; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>2inc_A Toluene, O-xylene monooxygenase oxygenase subunit; DIIRON, 4-helix bundle, carboxylate bridge, metalloenzyme, oxidoreductase; HET: P6G; 1.85A {Pseudomonas stutzeri} SCOP: a.25.1.2 PDB: 2ind_A* 1t0q_A 1t0r_A 1t0s_A 2rdb_A* Back     alignment and structure
>3ge3_A Toluene-4-monooxygenase system protein A; DIIRON hydroxylase, effector protein, T201A, aromatic hydrocarbons catabolism, FAD, flavoprotein; 1.52A {Pseudomonas mendocina} PDB: 3ge8_A 3dhi_A* 3dhh_A* 3dhg_A* 3i5j_A 3i63_A Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 196
d1syya_ 317 a.25.1.2 (A:) Ribonucleotide reductase R2 {Chlamydia tr 5e-40
d1jk0a_ 334 a.25.1.2 (A:) Ribonucleotide reductase R2 {Baker's yeas 1e-27
d1mxra_ 339 a.25.1.2 (A:) Ribonucleotide reductase R2 {Escherichia 4e-27
d1jk0b_285 a.25.1.2 (B:) Ribonucleotide reductase R2 {Baker's yeas 2e-25
d1r2fa_ 283 a.25.1.2 (A:) Ribonucleotide reductase R2 {Salmonella t 2e-23
d1w68a_ 281 a.25.1.2 (A:) Ribonucleotide reductase R2 {Mouse (Mus m 5e-23
d3dhza1 284 a.25.1.2 (A:14-297) Ribonucleotide reductase R2 {Coryne 1e-22
>d1syya_ a.25.1.2 (A:) Ribonucleotide reductase R2 {Chlamydia trachomatis [TaxId: 813]} Length = 317 Back     information, alignment and structure

class: All alpha proteins
fold: Ferritin-like
superfamily: Ferritin-like
family: Ribonucleotide reductase-like
domain: Ribonucleotide reductase R2
species: Chlamydia trachomatis [TaxId: 813]
 Score =  157 bits (398), Expect = 5e-40
 Identities = 95/186 (51%), Positives = 133/186 (71%), Gaps = 2/186 (1%)

Query: 10  IQAGEKRVNVDDKRMLNA-RSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALW 68
           +   +KRVN++ KR++N  + DVNQL+P+KY WAWE YL+ C N+W+PTE+PM  D+ LW
Sbjct: 5   LDGKQKRVNLNSKRLVNCNQVDVNQLVPIKYKWAWEHYLNGCANNWLPTEIPMGKDIELW 64

Query: 69  KSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHS 128
           KS + L++DER +I  NLGFF+++ESLV NNIVLAI++H++NPE RQYLLRQAFEEAVH+
Sbjct: 65  KS-DRLSEDERRVILLNLGFFSTAESLVGNNIVLAIFKHVTNPEARQYLLRQAFEEAVHT 123

Query: 129 HTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFHYWNKRRRSRILTR 188
           HTF YI  SLGLDE E+FN Y E  +I AK ++ ++ T  +  P+F   +       +  
Sbjct: 124 HTFLYICESLGLDEKEIFNAYNERAAIKAKDDFQMEITGKVLDPNFRTDSVEGLQEFVKN 183

Query: 189 SLRFLC 194
            + +  
Sbjct: 184 LVGYYI 189


>d1jk0a_ a.25.1.2 (A:) Ribonucleotide reductase R2 {Baker's yeast (Saccharomyces cerevisiae), Y2 [TaxId: 4932]} Length = 334 Back     information, alignment and structure
>d1mxra_ a.25.1.2 (A:) Ribonucleotide reductase R2 {Escherichia coli [TaxId: 562]} Length = 339 Back     information, alignment and structure
>d1jk0b_ a.25.1.2 (B:) Ribonucleotide reductase R2 {Baker's yeast (Saccharomyces cerevisiae), Y4 [TaxId: 4932]} Length = 285 Back     information, alignment and structure
>d1r2fa_ a.25.1.2 (A:) Ribonucleotide reductase R2 {Salmonella typhimurium [TaxId: 90371]} Length = 283 Back     information, alignment and structure
>d1w68a_ a.25.1.2 (A:) Ribonucleotide reductase R2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 281 Back     information, alignment and structure
>d3dhza1 a.25.1.2 (A:14-297) Ribonucleotide reductase R2 {Corynebacterium ammoniagenes [TaxId: 1697]} Length = 284 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target196
d1syya_ 317 Ribonucleotide reductase R2 {Chlamydia trachomatis [Tax 100.0
d1jk0a_ 334 Ribonucleotide reductase R2 {Baker's yeast (Saccharomyc 100.0
d1mxra_ 339 Ribonucleotide reductase R2 {Escherichia coli [TaxId: 5 100.0
d1jk0b_ 285 Ribonucleotide reductase R2 {Baker's yeast (Saccharomyc 100.0
d1w68a_ 281 Ribonucleotide reductase R2 {Mouse (Mus musculus) [TaxI 100.0
d1r2fa_ 283 Ribonucleotide reductase R2 {Salmonella typhimurium [Ta 100.0
d3dhza1 284 Ribonucleotide reductase R2 {Corynebacterium ammoniagen 100.0
d2inca1 491 Toluene, o-xylene monooxygenase oxygenase subunit TouA 93.98
d1mtyd_ 512 Methane monooxygenase hydrolase alpha subunit {Methyloc 90.32
>d1syya_ a.25.1.2 (A:) Ribonucleotide reductase R2 {Chlamydia trachomatis [TaxId: 813]} Back     information, alignment and structure
class: All alpha proteins
fold: Ferritin-like
superfamily: Ferritin-like
family: Ribonucleotide reductase-like
domain: Ribonucleotide reductase R2
species: Chlamydia trachomatis [TaxId: 813]
Probab=100.00  E-value=4.2e-45  Score=314.49  Aligned_cols=186  Identities=51%  Similarity=0.921  Sum_probs=177.6

Q ss_pred             HHHHCCCCCCCCCCCCCCCCC-CCHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCHHHHHHHHCCCCCCCHHHHHHHHHHH
Q ss_conf             666306766783202242776-6822008762789999999998504983346734616852040148989999999999
Q 537021.9.peg.7    8 SPIQAGEKRVNVDDKRMLNAR-SDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNL   86 (196)
Q Consensus         8 ~~i~~~~~~~~~~~~~ii~~~-~~~~~l~PikY~~~~~~yk~~~~~fW~peEI~l~~D~~dw~~~~~Lt~~Er~~~~~iL   86 (196)
                      |-+.++..|++.++||||||+ ++++||+||||||+|++|++++++||+|+||+|++|+.||++ ++||+.||++++++|
T Consensus         3 ~~~~~~~~~~~~~~~~~~~~~~~~~~~l~p~kYp~~~~~yk~~~~~fW~peEi~ls~D~~dw~~-~kL~~~e~~~~~~~l   81 (317)
T d1syya_           3 DILDGKQKRVNLNSKRLVNCNQVDVNQLVPIKYKWAWEHYLNGCANNWLPTEIPMGKDIELWKS-DRLSEDERRVILLNL   81 (317)
T ss_dssp             SSGGGGGGSCCGGGCCSSSCCSSCTTCCCSCCCHHHHHHHHHHHHTCCCGGGSCCHHHHHHHHS-SCSCHHHHHHHHHHH
T ss_pred             CHHHCCCCCCCCCCCEEECCCCCCHHHCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHH-CCCCHHHHHHHHHHH
T ss_conf             1321534456711140268998765551898777999999999976999510574013888865-889989999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHCCHHHHHHHHHHHHHH
Q ss_conf             99977636777777888876528689999999999999999999999999823763689999950999999999999999
Q 537021.9.peg.7   87 GFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYT  166 (196)
Q Consensus        87 ~ffs~~D~~v~~nl~~~i~~~i~~pE~~~~~~~q~~~E~iHs~sYs~il~tl~~d~~eif~~~~~~p~i~~K~~~~~k~~  166 (196)
                      +||+.+|++|++++...+++.++.||+++++++|+++|+||++|||+++++++.|++|+|+++.++|.+++|++|+.+++
T Consensus        82 ~~~~~~d~~v~~~~~~~l~~~i~~pE~~~~~~~q~~~E~iH~~sYs~il~~l~~d~~e~~~~~~~~~~i~~k~~~~~~~~  161 (317)
T d1syya_          82 GFFSTAESLVGNNIVLAIFKHVTNPEARQYLLRQAFEEAVHTHTFLYICESLGLDEKEIFNAYNERAAIKAKDDFQMEIT  161 (317)
T ss_dssp             HHHHHHHHHHHHHHHHTHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHTCCHHHHTTHHHHCHHHHHHHHHHHHTT
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99988866875405764012378599999999999998789999999999856778999999842999999999999977


Q ss_pred             HHHHCCCCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             8530113344793348999999999963
Q 537021.9.peg.7  167 QTLSSPSFHYWNKRRRSRILTRSLRFLC  194 (196)
Q Consensus       167 ~~i~~~~~~~~~~e~~~~~l~~li~f~~  194 (196)
                      ..+.+++......+..+.++.++++++|
T Consensus       162 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~  189 (317)
T d1syya_         162 GKVLDPNFRTDSVEGLQEFVKNLVGYYI  189 (317)
T ss_dssp             SGGGSTTCCSSSHHHHHHHHHHHHHHHT
T ss_pred             HHHCCCCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             5311434344644339999999999999



>d1jk0a_ a.25.1.2 (A:) Ribonucleotide reductase R2 {Baker's yeast (Saccharomyces cerevisiae), Y2 [TaxId: 4932]} Back     information, alignment and structure
>d1mxra_ a.25.1.2 (A:) Ribonucleotide reductase R2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jk0b_ a.25.1.2 (B:) Ribonucleotide reductase R2 {Baker's yeast (Saccharomyces cerevisiae), Y4 [TaxId: 4932]} Back     information, alignment and structure
>d1w68a_ a.25.1.2 (A:) Ribonucleotide reductase R2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r2fa_ a.25.1.2 (A:) Ribonucleotide reductase R2 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d3dhza1 a.25.1.2 (A:14-297) Ribonucleotide reductase R2 {Corynebacterium ammoniagenes [TaxId: 1697]} Back     information, alignment and structure
>d2inca1 a.25.1.2 (A:2-492) Toluene, o-xylene monooxygenase oxygenase subunit TouA {Pseudomonas stutzeri [TaxId: 316]} Back     information, alignment and structure
>d1mtyd_ a.25.1.2 (D:) Methane monooxygenase hydrolase alpha subunit {Methylococcus capsulatus [TaxId: 414]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 196
1h0o_A_1-218218 (A:1-218) Ribonucleoside-diphosphate reductase; ox 5e-37
1mxr_A_ 375 (A:) Ribonucleotide reductase R2; radical protein, 2e-35
2p1i_A_1-161161 (A:1-161) Ribonucleotide reductase, small chain; F 5e-35
1syy_A_ 346 (A:) Ribonucleoside-diphosphate reductase beta cha 9e-33
1jk0_A_104-227124 (A:104-227) RNR Y2, ribonucleoside-diphosphate red 2e-31
2o1z_A_38-160123 (A:38-160) Ribonucleotide reductase subunit R2; sm 4e-30
1r2f_A_1-128128 (A:1-128) Protein (ribonucleotide reductase R2); n 1e-29
1jk0_B_33-146114 (B:33-146) RNR Y4, ribonucleoside-diphosphate redu 1e-28
3dhz_A_21-138118 (A:21-138) Ribonucleotide reductase subunit R2F; m 1e-27
2rcc_A_1-149149 (A:1-149) Ribonucleoside-diphosphate reductase sub 8e-27
3ee4_A_ 323 (A:) Probable ribonucleoside-diphosphate reductase 8e-24
3chh_A_ 336 (A:) P-aminobenzoate N-oxygenase; DI-iron oxygenas 2e-19
>1h0o_A (A:1-218) Ribonucleoside-diphosphate reductase; oxidoreductase, ribonucleotide reductase, dinuclear metal-cluster; 2.2A {Mus musculus}Length = 218 Back     alignment and structure
 Score =  148 bits (374), Expect = 5e-37
 Identities = 44/156 (28%), Positives = 73/156 (46%), Gaps = 6/156 (3%)

Query: 15  KRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGL 74
              +V+D+ +L        + P++Y   W+ Y  A  + W   EV +  D+  W++   L
Sbjct: 64  TNPSVEDEPLLRENPRRFVVFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWEA---L 120

Query: 75  TDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYI 134
             DER  I   L FFA+S+ +V  N+V    + +   E R +   Q   E +HS  +  +
Sbjct: 121 KPDERHFISHVLAFFAASDGIVNENLVERFSQEVQVTEARCFYGFQIAMENIHSEMYSLL 180

Query: 135 ITSLGLDEGE---LFNMYREVPSITAKANWALQYTQ 167
           I +   D  E   LFN    +P +  KA+WAL++  
Sbjct: 181 IDTYIKDPKEREYLFNAIETMPCVKKKADWALRWIG 216


>1mxr_A (A:) Ribonucleotide reductase R2; radical protein, DI iron, oxidoreductase; 1.42A {Escherichia coli}Length = 375 Back     alignment and structure
>2p1i_A (A:1-161) Ribonucleotide reductase, small chain; F222 twinning, plasmodb PY03671, structural genomics consortium, SGC, oxidoreductase; 2.70A {Plasmodium yoelii yoelii str}Length = 161 Back     alignment and structure
>1syy_A (A:) Ribonucleoside-diphosphate reductase beta chain; DIIRON, oxygen activation, iron coupled radical, immune evasion, replication; 1.70A {Chlamydia trachomatis}Length = 346 Back     alignment and structure
>1jk0_A (A:104-227) RNR Y2, ribonucleoside-diphosphate reductase small chain 1; ribonucleotide reductase, oxidoreductase; 2.80A {Saccharomyces cerevisiae}Length = 124 Back     alignment and structure
>2o1z_A (A:38-160) Ribonucleotide reductase subunit R2; small subunit ribonucleotide reductase, oxidoreductase, DNA replication, iron, DIIRON, radical, R2 subunit; 2.40A {Plasmodium vivax}Length = 123 Back     alignment and structure
>1r2f_A (A:1-128) Protein (ribonucleotide reductase R2); nucleotide metabolism, oxidoreductase; 2.10A {Salmonella typhimurium}Length = 128 Back     alignment and structure
>1jk0_B (B:33-146) RNR Y4, ribonucleoside-diphosphate reductase small chain 2; ribonucleotide reductase, oxidoreductase; 2.80A {Saccharomyces cerevisiae}Length = 114 Back     alignment and structure
>3dhz_A (A:21-138) Ribonucleotide reductase subunit R2F; metal free, hydrogen bond, metal binding protein; 1.63A {Corynebacterium ammoniagenes}Length = 118 Back     alignment and structure
>2rcc_A (A:1-149) Ribonucleoside-diphosphate reductase subunit beta; NP_241368.1, putative class I ribonucleotide reductase, ribonucleotide reductase; HET: MSE PGE PG4; 1.90A {Bacillus halodurans c-125}Length = 149 Back     alignment and structure
>3ee4_A (A:) Probable ribonucleoside-diphosphate reductase; manganese, iron, DIIRON, carboxylate, oxidase, ligand, cavity, monooxygenase; HET: MYR; 1.90A {Mycobacterium tuberculosis}Length = 323 Back     alignment and structure
>3chh_A (A:) P-aminobenzoate N-oxygenase; DI-iron oxygenase, oxidoreductase; 2.00A {Streptomyces thioluteus} PDB: 3chi_A 3cht_A* 3chu_A 2jcd_ALength = 336 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target196
1h0o_A_1-218218 Ribonucleoside-diphosphate reductase; oxidoreducta 100.0
1syy_A_ 346 Ribonucleoside-diphosphate reductase beta chain; D 100.0
2p1i_A_1-161161 Ribonucleotide reductase, small chain; F222 twinni 100.0
2rcc_A_1-149149 Ribonucleoside-diphosphate reductase subunit beta; 100.0
1r2f_A_1-128128 Protein (ribonucleotide reductase R2); nucleotide 100.0
2o1z_A_38-160123 Ribonucleotide reductase subunit R2; small subunit 99.98
1jk0_A_104-227124 RNR Y2, ribonucleoside-diphosphate reductase small 99.97
1jk0_B_33-146114 RNR Y4, ribonucleoside-diphosphate reductase small 99.97
3dhz_A_21-138118 Ribonucleotide reductase subunit R2F; metal free, 99.97
3ee4_A_ 323 Probable ribonucleoside-diphosphate reductase; man 99.95
3chh_A_ 336 P-aminobenzoate N-oxygenase; DI-iron oxygenase, ox 99.69
1mxr_A_ 375 Ribonucleotide reductase R2; radical protein, DI i 100.0
1mty_D_1-248248 Methane monooxygenase hydroxylase; dinuclear iron 96.77
1za0_A_275 Possible acyl-[acyl-carrier protein] desaturase DE 93.11
3ge3_A_1-349_476-500 374 Toluene-4-monooxygenase system protein A; DIIRON h 95.17
2inp_A_84-180_340-347_443-482145 Phenol hydroxylase component PHN; DIIRON, four-hel 90.49
1jk0_A_1-103_228-419295 RNR Y2, ribonucleoside-diphosphate reductase small 90.17
>1h0o_A (A:1-218) Ribonucleoside-diphosphate reductase; oxidoreductase, ribonucleotide reductase, dinuclear metal-cluster; 2.2A {Mus musculus} Back     alignment and structure
Probab=100.00  E-value=3.9e-41  Score=290.57  Aligned_cols=153  Identities=29%  Similarity=0.526  Sum_probs=146.9

Q ss_pred             CCCCCCCCCCCCCCCCCCHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             67667832022427766822008762789999999998504983346734616852040148989999999999999776
Q 537021.9.peg.7   13 GEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASS   92 (196)
Q Consensus        13 ~~~~~~~~~~~ii~~~~~~~~l~PikY~~~~~~yk~~~~~fW~peEI~l~~D~~dw~~~~~Lt~~Er~~~~~iL~ffs~~   92 (196)
                      ...+.+.++++|++++++.++++|++|||+|++|++++++||+|+||+|++|+.||++   ||+.||++++++|+||+++
T Consensus        62 ~~~~~~~~~e~il~~~~~~~~~~piky~~~~~lykk~~~~fW~peEi~ls~D~~dw~~---Lt~~Er~~i~~~la~fa~~  138 (218)
T 1h0o_A           62 APTNPSVEDEPLLRENPRRFVVFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWEA---LKPDERHFISHVLAFFAAS  138 (218)
T ss_dssp             ---CCSCTTCTTTSSCCSCCCSSSCSCHHHHHHHHHHHHTCCCGGGSCCTTHHHHHHH---SCHHHHHHHHHHHHHHHHH
T ss_pred             CCCCCCCCCCCCCCCCCCCEEECCCCCHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHH---CCHHHHHHHHHHHHHHHHH
T ss_conf             2467876667664688775233387777999999999874898330681754999986---9999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHH---HHHHHHCCHHHHHHHHHHHHHHHH
Q ss_conf             3677777788887652868999999999999999999999999982376368---999995099999999999999985
Q 537021.9.peg.7   93 ESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQT  168 (196)
Q Consensus        93 D~~v~~nl~~~i~~~i~~pE~~~~~~~q~~~E~iHs~sYs~il~tl~~d~~e---if~~~~~~p~i~~K~~~~~k~~~~  168 (196)
                      |++|++|+...|++.++.||+++||++|++||+||+++|++|+++|+.|++|   +|+++.++|+|++|++|+.+|+++
T Consensus       139 D~iv~~nl~~~~~~~i~~pE~~~~~~~q~~~E~iHsesYs~il~tl~~d~~e~~~if~~~~~~p~i~~K~~~~~~~~~~  217 (218)
T 1h0o_A          139 DGIVNENLVERFSQEVQVTEARCFYGFQIAMENIHSEMYSLLIDTYIKDPKEREYLFNAIETMPCVKKKADWALRWIGD  217 (218)
T ss_dssp             HHHHHHHHHHTHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHTHHHHCHHHHHHHHHHHHHHHC
T ss_pred             HHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             9999854899887547979999999999999999999999999985013778887778988768899998988863044



>1syy_A (A:) Ribonucleoside-diphosphate reductase beta chain; DIIRON, oxygen activation, iron coupled radical, immune evasion, replication; 1.70A {Chlamydia trachomatis} Back     alignment and structure
>2p1i_A (A:1-161) Ribonucleotide reductase, small chain; F222 twinning, plasmodb PY03671, structural genomics consortium, SGC, oxidoreductase; 2.70A {Plasmodium yoelii yoelii str} Back     alignment and structure
>2rcc_A (A:1-149) Ribonucleoside-diphosphate reductase subunit beta; NP_241368.1, putative class I ribonucleotide reductase, ribonucleotide reductase; HET: MSE PGE PG4; 1.90A {Bacillus halodurans c-125} Back     alignment and structure
>1r2f_A (A:1-128) Protein (ribonucleotide reductase R2); nucleotide metabolism, oxidoreductase; 2.10A {Salmonella typhimurium} Back     alignment and structure
>2o1z_A (A:38-160) Ribonucleotide reductase subunit R2; small subunit ribonucleotide reductase, oxidoreductase, DNA replication, iron, DIIRON, radical, R2 subunit; 2.40A {Plasmodium vivax} Back     alignment and structure
>1jk0_A (A:104-227) RNR Y2, ribonucleoside-diphosphate reductase small chain 1; ribonucleotide reductase, oxidoreductase; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1jk0_B (B:33-146) RNR Y4, ribonucleoside-diphosphate reductase small chain 2; ribonucleotide reductase, oxidoreductase; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3dhz_A (A:21-138) Ribonucleotide reductase subunit R2F; metal free, hydrogen bond, metal binding protein; 1.63A {Corynebacterium ammoniagenes} Back     alignment and structure
>3ee4_A (A:) Probable ribonucleoside-diphosphate reductase; manganese, iron, DIIRON, carboxylate, oxidase, ligand, cavity, monooxygenase; HET: MYR; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>3chh_A (A:) P-aminobenzoate N-oxygenase; DI-iron oxygenase, oxidoreductase; 2.00A {Streptomyces thioluteus} PDB: 3chi_A 3cht_A* 3chu_A 2jcd_A Back     alignment and structure
>1mxr_A (A:) Ribonucleotide reductase R2; radical protein, DI iron, oxidoreductase; 1.42A {Escherichia coli} Back     alignment and structure
>1mty_D (D:1-248) Methane monooxygenase hydroxylase; dinuclear iron center monooxygenase; 1.70A {Methylococcus capsulatus str} Back     alignment and structure
>1za0_A (A:) Possible acyl-[acyl-carrier protein] desaturase DESA2 (acyl-[ACP] desaturase) (stearoyl-ACP...; four-helix bundle; 2.00A {Mycobacterium tuberculosis H37RV} Back     alignment and structure
>3ge3_A (A:1-349,A:476-500) Toluene-4-monooxygenase system protein A; DIIRON hydroxylase, effector protein, T201A, aromatic hydrocarbons catabolism, FAD, flavoprotein; 1.52A {Pseudomonas mendocina} PDB: 3ge8_A 3dhi_A* 3dhh_A* 3dhg_A* 3i5j_A 3i63_A Back     alignment and structure
>2inp_A (A:84-180,A:340-347,A:443-482) Phenol hydroxylase component PHN; DIIRON, four-helix bundle, regulatory protein, oxidoreductase; 2.30A {Pseudomonas stutzeri} PDB: 2inn_A Back     alignment and structure
>1jk0_A (A:1-103,A:228-419) RNR Y2, ribonucleoside-diphosphate reductase small chain 1; ribonucleotide reductase, oxidoreductase; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure