254780758

254780758

hypothetical protein CLIBASIA_03225

GeneID in NCBI database:8209763Locus tag:CLIBASIA_03225
Protein GI in NCBI database:254780758Protein Accession:YP_003065171.1
Gene range:-(508500, 509150)Protein Length:216aa
Gene description:hypothetical protein
COG prediction:[R] Zn-dependent hydrolases, including glyoxylases
KEGG prediction:hypothetical protein
SEED prediction:Hypothetical metal-binding enzyme, YcbL homolog
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Glutathione: Non-redox reactions
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210------
MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI
ccccEEEEEEcccccccEEEEEEccccEEEEEcccccHHHHHHHHHHccccccEEEEccccccHHcHHHHHHHHHcccEEEEcHHHHHHHHHHHHHHHHccccccccccccEEEEccccEEEEccEEEEEEEccccccccEEEEEccccEEEEEEEEEcccccccccccccHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHcHHHcccc
ccccEEEEEEccccccccEEEEccccccEEEEcccccHHHHHHHHHHccccHHEEEEccccHHHHHHHHHHHHHccccEEccccccHHHHHcHHHHHHHcccccccccccccHHcccccEEEEccEEEEEEEcccccccEEEEEccHccEEEEcHHHEcccccccccccccHHHHHHHHHHHcccccccEEEEccccccccccHcccccccccccc
MSKLSFHIVQvtpfkqnctflfdeesleavvvdpggdldiIKDVIQSRNFHVKQIWIThghvdhvggaaqlkedlsltiigphkddaammgKVDEQARLLSIRMNArnassdrwlqdgdtlllGTHIfkvfhcpghspghviyvnfennfahlgdtlfrssigrtdilhGDYQQLINSInnkilplgdeisfvcghgpnstigrerrlnpflksni
MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEISFVCGHGpnstigrerrlnpflksni
MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI
**KLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEISFVCGHGPNSTIGRERRLNPFLKSN*
MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI
*SKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEISFVCGHGPNSTIGRERRLNPFL****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI
MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI
MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

Original result of BLAST against C. L. asiaticus genome

IdentityAlignment graphLength Definition E-value
Target216 hypothetical protein CLIBASIA_03225 [Candidatus Liberib
254780583256 glyoxalase II [Candidatus Liberibacter asiaticus s 2e-15
>gi|254780583|ref|YP_003064996.1| glyoxalase II [Candidatus Liberibacter asiaticus str. psy62] Length = 256 Back     alignment 
 Score = 73.6 bits (179), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 50/188 (26%), Positives = 80/188 (42%), Gaps = 22/188 (11%)

Query: 9   VQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGA 68
           + ++ +  N   L               D  II  +++ + + +  I+ TH H+DH    
Sbjct: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65

Query: 69  AQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIF 128
             LK+  + TI GP          ++E +++  I         D  L DGDT   G+H  
Sbjct: 66  LNLKKFFNCTIFGP----------LEESSKIPGI---------DHGLSDGDTFDFGSHPI 106

Query: 129 KVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGD 188
           K+   PGH+ GH+ Y    ++F  +GDTLF    GR  I    Y ++  S+  KI    D
Sbjct: 107 KIIATPGHTIGHICYHFMNDHFLCVGDTLFSLGCGR--IFEDSYAEMFESL-EKIKSFSD 163

Query: 189 EISFVCGH 196
           +     GH
Sbjct: 164 KTHIYFGH 171

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

Original result of PSI-BLAST first 2 iterations

IdentityAlignment graphLength Definition Round E-value
Target216 hypothetical protein CLIBASIA_03225 [Candidatus Liberib
315121921216 hypothetical protein CKC_00855 [Candidatus Liberibacter 1 1e-108
163761577215 putative beta-lactamase family protein [Hoeflea phototr 1 7e-70
227822823213 metallo-beta-lactamase family protein [Sinorhizobium fr 1 1e-69
15966085213 hypothetical protein SMc01587 [Sinorhizobium meliloti 1 1 3e-69
325293561222 hydrolase [Agrobacterium sp. H13-3] Length = 222 1 9e-69
150397440213 beta-lactamase domain-containing protein [Sinorhizobium 1 1e-68
222086575214 hydrolase protein [Agrobacterium radiobacter K84] Lengt 1 3e-67
116253200214 beta-lactamase family protein [Rhizobium leguminosarum 1 3e-66
15889480214 hydrolase [Agrobacterium tumefaciens str. C58] Length = 1 3e-66
209550332217 beta-lactamase [Rhizobium leguminosarum bv. trifolii WS 1 3e-66
>gi|315121921|ref|YP_004062410.1| hypothetical protein CKC_00855 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 216 Back     alignment and organism information
 Score =  394 bits (1013), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 185/216 (85%), Positives = 202/216 (93%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           MSKLSF+ ++VTPFKQNCTFLFDEESLEAVV+DPGGDLD IKDVI+SRNF VKQIWITHG
Sbjct: 1   MSKLSFYSLKVTPFKQNCTFLFDEESLEAVVIDPGGDLDRIKDVIKSRNFRVKQIWITHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DHVGGAAQLKEDLSL IIGPHKDDA MM  V+EQA+LLS+ MN RN SSD WLQDGD+
Sbjct: 61  HIDHVGGAAQLKEDLSLQIIGPHKDDAMMMNNVEEQAKLLSVCMNERNTSSDHWLQDGDS 120

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           + +G H+FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFR SIG+TDILHG+YQQL+NSIN
Sbjct: 121 VSVGKHVFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRDSIGKTDILHGNYQQLMNSIN 180

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           NKILPLGDEISFVCGHGPNSTIGRERRLNPFLKSN+
Sbjct: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNM 216



Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|163761577|ref|ZP_02168648.1| putative beta-lactamase family protein [Hoeflea phototrophica DFL-43] Length = 215 Back     alignment and organism information
>gi|227822823|ref|YP_002826795.1| metallo-beta-lactamase family protein [Sinorhizobium fredii NGR234] Length = 213 Back     alignment and organism information
>gi|15966085|ref|NP_386438.1| hypothetical protein SMc01587 [Sinorhizobium meliloti 1021] Length = 213 Back     alignment and organism information
>gi|325293561|ref|YP_004279425.1| hydrolase [Agrobacterium sp. H13-3] Length = 222 Back     alignment and organism information
>gi|150397440|ref|YP_001327907.1| beta-lactamase domain-containing protein [Sinorhizobium medicae WSM419] Length = 213 Back     alignment and organism information
>gi|222086575|ref|YP_002545109.1| hydrolase protein [Agrobacterium radiobacter K84] Length = 214 Back     alignment and organism information
>gi|116253200|ref|YP_769038.1| beta-lactamase family protein [Rhizobium leguminosarum bv. viciae 3841] Length = 214 Back     alignment and organism information
>gi|15889480|ref|NP_355161.1| hydrolase [Agrobacterium tumefaciens str. C58] Length = 214 Back     alignment and organism information
>gi|209550332|ref|YP_002282249.1| beta-lactamase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 217 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

Original result of RPS-BLASTagainst CDD database part II

IdentityAlignment graphLength Definition E-value
Target216 hypothetical protein CLIBASIA_03225 [Candidatus Liberib
TIGR03413248 TIGR03413, GSH_gloB, hydroxyacylglutathione hydrolase 1e-25
smart00849183 smart00849, Lactamase_B, Metallo-beta-lactamase superfa 5e-24
KOG0814237 KOG0814, KOG0814, KOG0814, Glyoxylase [General function 2e-18
PLN02398329 PLN02398, PLN02398, hydroxyacylglutathione hydrolase 1e-16
PRK10241251 PRK10241, PRK10241, hydroxyacylglutathione hydrolase; P 9e-15
PLN02469258 PLN02469, PLN02469, hydroxyacylglutathione hydrolase 3e-13
KOG0813265 KOG0813, KOG0813, KOG0813, Glyoxylase [General function 2e-12
PLN02962251 PLN02962, PLN02962, hydroxyacylglutathione hydrolase 4e-10
COG0491252 COG0491, GloB, Zn-dependent hydrolases, including glyox 1e-28
pfam00753148 pfam00753, Lactamase_B, Metallo-beta-lactamase superfam 2e-15
>gnl|CDD|163252 TIGR03413, GSH_gloB, hydroxyacylglutathione hydrolase Back     alignment and domain information
>gnl|CDD|129082 smart00849, Lactamase_B, Metallo-beta-lactamase superfamily Back     alignment and domain information
>gnl|CDD|36032 KOG0814, KOG0814, KOG0814, Glyoxylase [General function prediction only] Back     alignment and domain information
>gnl|CDD|178020 PLN02398, PLN02398, hydroxyacylglutathione hydrolase Back     alignment and domain information
>gnl|CDD|182327 PRK10241, PRK10241, hydroxyacylglutathione hydrolase; Provisional Back     alignment and domain information
>gnl|CDD|178088 PLN02469, PLN02469, hydroxyacylglutathione hydrolase Back     alignment and domain information
>gnl|CDD|36031 KOG0813, KOG0813, KOG0813, Glyoxylase [General function prediction only] Back     alignment and domain information
>gnl|CDD|178547 PLN02962, PLN02962, hydroxyacylglutathione hydrolase Back     alignment and domain information
>gnl|CDD|30837 COG0491, GloB, Zn-dependent hydrolases, including glyoxylases [General function prediction only] Back     alignment and domain information
>gnl|CDD|144377 pfam00753, Lactamase_B, Metallo-beta-lactamase superfamily Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

Original result of HHsearch against CDD database

IdentityAlignment graphLength Definition Probability
Target 216 hypothetical protein CLIBASIA_03225 [Candidatus Liberib
TIGR03413248 GSH_gloB hydroxyacylglutathione hydrolase. Members of t 100.0
PRK10241251 hydroxyacylglutathione hydrolase; Provisional 100.0
KOG0813265 consensus 100.0
KOG0814237 consensus 100.0
smart00849183 Lactamase_B Metallo-beta-lactamase superfamily. Apart f 99.97
COG0491252 GloB Zn-dependent hydrolases, including glyoxylases [Ge 99.96
PRK11921 395 metallo-beta-lactamase/flavodoxin domain-containing pro 99.84
COG0426 388 FpaA Uncharacterized flavoproteins [Energy production a 99.83
PRK05452 479 anaerobic nitric oxide reductase flavorubredoxin; Provi 99.81
COG0595 555 mRNA degradation ribonucleases J1/J2 (metallo-beta-lact 99.77
TIGR00649 593 MG423 conserved hypothetical protein; InterPro: IPR0046 99.72
PRK11539754 hypothetical protein; Provisional 99.68
COG2333293 ComEC Predicted hydrolase (metallo-beta-lactamase super 99.56
COG2015 655 Alkyl sulfatase and related hydrolases [Secondary metab 99.18
KOG4736302 consensus 98.91
PRK00685228 metal-dependent hydrolase; Provisional 98.88
COG2220258 Predicted Zn-dependent hydrolases of the beta-lactamase 98.5
TIGR00361731 ComEC_Rec2 DNA internalization-related competence prote 96.87
pfam00753148 Lactamase_B Metallo-beta-lactamase superfamily. 99.82
TIGR03675 630 arCOG00543 arCOG01782 universal archaeal KH-domain/beta 99.64
PRK00055259 ribonuclease Z; Reviewed 99.5
COG1236 427 YSH1 Predicted exonuclease of the beta-lactamase fold i 99.45
PRK02113252 putative hydrolase; Provisional 99.28
COG1782 637 Predicted metal-dependent RNase, consists of a metallo- 99.19
TIGR02651327 RNase_Z ribonuclease Z; InterPro: IPR013471 All tRNA mo 99.18
PRK11244250 phnP carbon-phosphorus lyase complex accessory protein; 99.14
TIGR03307249 PhnP phosphonate metabolism protein PhnP. This family o 99.05
KOG1136 501 consensus 98.91
KOG1137 668 consensus 98.78
PRK04286294 hypothetical protein; Provisional 98.75
KOG1135 764 consensus 98.64
pfam02112323 PDEase_II cAMP phosphodiesterases class-II. 98.6
COG2248304 Predicted hydrolase (metallo-beta-lactamase superfamily 98.25
KOG1361 481 consensus 97.53
TIGR02649304 true_RNase_BN ribonuclease BN; InterPro: IPR013469 Prot 96.61
COG1237259 Metal-dependent hydrolases of the beta-lactamase superf 99.24
PRK05184302 pyrroloquinoline quinone biosynthesis protein PqqB; Pro 99.09
PRK02126 334 ribonuclease Z; Provisional 99.01
COG1234292 ElaC Metal-dependent hydrolases of the beta-lactamase s 98.79
COG1235269 PhnP Metal-dependent hydrolases of the beta-lactamase s 98.78
KOG2121746 consensus 97.17
TIGR02650277 RNase_Z_T_toga ribonuclease Z, Thermotoga type; InterPr 96.31
TIGR02108314 PQQ_syn_pqqB coenzyme PQQ biosynthesis protein B; Inter 94.27
PRK11709355 putative L-ascorbate 6-phosphate lactonase; Provisional 97.41
COG5212356 PDE1 Low-affinity cAMP phosphodiesterase [Signal transd 96.99
TIGR01393 598 lepA GTP-binding protein LepA; InterPro: IPR006297 LepA 93.55
>TIGR03413 GSH_gloB hydroxyacylglutathione hydrolase Back     alignment and domain information
>PRK10241 hydroxyacylglutathione hydrolase; Provisional Back     alignment and domain information
>KOG0813 consensus Back     alignment and domain information
>KOG0814 consensus Back     alignment and domain information
>smart00849 Lactamase_B Metallo-beta-lactamase superfamily Back     alignment and domain information
>COG0491 GloB Zn-dependent hydrolases, including glyoxylases [General function prediction only] Back     alignment and domain information
>PRK11921 metallo-beta-lactamase/flavodoxin domain-containing protein; Provisional Back     alignment and domain information
>COG0426 FpaA Uncharacterized flavoproteins [Energy production and conversion] Back     alignment and domain information
>PRK05452 anaerobic nitric oxide reductase flavorubredoxin; Provisional Back     alignment and domain information
>COG0595 mRNA degradation ribonucleases J1/J2 (metallo-beta-lactamase superfamily) [Translation, ribosomal structure and biogenesis; Replication, recombination and repair] Back     alignment and domain information
>TIGR00649 MG423 conserved hypothetical protein; InterPro: IPR004613 This is a family of conserved hypothetical proteins, the members of which contain an ATP-binding domain at the N-terminal end of the protein Back     alignment and domain information
>PRK11539 hypothetical protein; Provisional Back     alignment and domain information
>COG2333 ComEC Predicted hydrolase (metallo-beta-lactamase superfamily) [General function prediction only] Back     alignment and domain information
>COG2015 Alkyl sulfatase and related hydrolases [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG4736 consensus Back     alignment and domain information
>PRK00685 metal-dependent hydrolase; Provisional Back     alignment and domain information
>COG2220 Predicted Zn-dependent hydrolases of the beta-lactamase fold [General function prediction only] Back     alignment and domain information
>TIGR00361 ComEC_Rec2 DNA internalization-related competence protein ComEC/Rec2; InterPro: IPR004797 This is the DNA internalisation-related competence protein ComEC/Rec2 family Back     alignment and domain information
>pfam00753 Lactamase_B Metallo-beta-lactamase superfamily Back     alignment and domain information
>TIGR03675 arCOG00543 arCOG01782 universal archaeal KH-domain/beta-lactamase-domain protein Back     alignment and domain information
>PRK00055 ribonuclease Z; Reviewed Back     alignment and domain information
>COG1236 YSH1 Predicted exonuclease of the beta-lactamase fold involved in RNA processing [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK02113 putative hydrolase; Provisional Back     alignment and domain information
>COG1782 Predicted metal-dependent RNase, consists of a metallo-beta-lactamase domain and an RNA-binding KH domain [General function prediction only] Back     alignment and domain information
>TIGR02651 RNase_Z ribonuclease Z; InterPro: IPR013471 All tRNA molecules are synthesised as long precursors with extra sequence at both the 5' and 3' ends, which undergo several processing steps to form the mature tRNA molecule Back     alignment and domain information
>PRK11244 phnP carbon-phosphorus lyase complex accessory protein; Provisional Back     alignment and domain information
>TIGR03307 PhnP phosphonate metabolism protein PhnP Back     alignment and domain information
>KOG1136 consensus Back     alignment and domain information
>KOG1137 consensus Back     alignment and domain information
>PRK04286 hypothetical protein; Provisional Back     alignment and domain information
>KOG1135 consensus Back     alignment and domain information
>pfam02112 PDEase_II cAMP phosphodiesterases class-II Back     alignment and domain information
>COG2248 Predicted hydrolase (metallo-beta-lactamase superfamily) [General function prediction only] Back     alignment and domain information
>KOG1361 consensus Back     alignment and domain information
>TIGR02649 true_RNase_BN ribonuclease BN; InterPro: IPR013469 Proteins in this entry include ribonuclease BN of Escherichia coli (strain K-12) and closely related proteins believed to be equivalent in function Back     alignment and domain information
>COG1237 Metal-dependent hydrolases of the beta-lactamase superfamily II [General function prediction only] Back     alignment and domain information
>PRK05184 pyrroloquinoline quinone biosynthesis protein PqqB; Provisional Back     alignment and domain information
>PRK02126 ribonuclease Z; Provisional Back     alignment and domain information
>COG1234 ElaC Metal-dependent hydrolases of the beta-lactamase superfamily III [General function prediction only] Back     alignment and domain information
>COG1235 PhnP Metal-dependent hydrolases of the beta-lactamase superfamily I [General function prediction only] Back     alignment and domain information
>KOG2121 consensus Back     alignment and domain information
>TIGR02650 RNase_Z_T_toga ribonuclease Z, Thermotoga type; InterPro: IPR013470 All tRNA molecules are synthesised as long precursors with extra sequence at both the 5' and 3' ends, which undergo several processing steps to form the mature tRNA molecule Back     alignment and domain information
>TIGR02108 PQQ_syn_pqqB coenzyme PQQ biosynthesis protein B; InterPro: IPR011842 This entry describes coenzyme PQQ biosynthesis protein B, a gene required for the biosynthesis of pyrrolo-quinoline-quinone (coenzyme PQQ) Back     alignment and domain information
>PRK11709 putative L-ascorbate 6-phosphate lactonase; Provisional Back     alignment and domain information
>COG5212 PDE1 Low-affinity cAMP phosphodiesterase [Signal transduction mechanisms] Back     alignment and domain information
>TIGR01393 lepA GTP-binding protein LepA; InterPro: IPR006297 LepA (GUF1 in Saccaromyces) is a GTP-binding membrane protein related to EF-G and EF-Tu Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

Original result of PSI-BLAST

IdentityAlignment graphLength Definition E-value
Target216 hypothetical protein CLIBASIA_03225 [Candidatus Liberib
2xf4_A210 Crystal Structure Of Salmonella Enterica Serovar Ty 2e-47
2zwr_A207 Crystal Structure Of Ttha1623 From Thermus Thermoph 3e-33
1xm8_A254 X-Ray Structure Of Glyoxalase Ii From Arabidopsis T 3e-25
2gcu_A245 X-Ray Structure Of Gene Product From Arabidopsis Th 9e-20
1qh3_A260 Human Glyoxalase Ii With Cacodylate And Acetate Ion 4e-19
3r2u_A 466 2.1 Angstrom Resolution Crystal Structure Of Metall 1e-17
2qed_A258 Crystal Structure Of Salmonella Thyphimurium Lt2 Gl 7e-17
2p18_A311 Crystal Structure Of The Leishmania Infantum Glyoxa 2e-06
2zo4_A317 Crystal Structure Of Metallo-Beta-Lactamase Family 0.001
2vw8_A303 Crystal Structure Of Quinolone Signal Response Prot 0.001
3dh8_A303 Structure Of Pseudomonas Quinolone Signal Response 0.001
2q0j_A321 Structure Of Pseudomonas Quinolone Signal Response 0.001
2q0i_A303 Structure Of Pseudomonas Quinolone Signal Response 0.001
>gi|301598408|pdb|2XF4|A Chain A, Crystal Structure Of Salmonella Enterica Serovar Typhimurium Ycbl Length = 210 Back     alignment and structure 
 Score =  192 bits (489), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 86/211 (40%), Positives = 138/211 (65%), Gaps = 1/211 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++ I+ VT F QNC+ ++ E++  A +VDPGGD + IK  + +    + QI +THGH+D
Sbjct: 1   MNYRIIPVTAFSQNCSLIWCEQTRLAALVDPGGDAEKIKQEVDASGVTLMQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG A++L +   + +IGP K+D   +  +  Q+R+  +    +  + DRWL DGD + +
Sbjct: 61  HVGAASELAQHYGVPVIGPEKEDEFWLQGLPAQSRMFGLDEC-QPLTPDRWLNDGDRVSV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGHV++ + ++     GD +F+  +GR+D   GD+ QLI++I  K+
Sbjct: 120 GNVTLQVLHCPGHTPGHVVFFDEQSQLLISGDVIFKGGVGRSDFPRGDHTQLIDAIKRKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           LPLGD+++F+ GHGP ST+G ER  NPFL+ 
Sbjct: 180 LPLGDDVTFIPGHGPLSTLGYERLHNPFLQD 210
gi|260656160|pdb|2ZWR|A Chain A, Crystal Structure Of Ttha1623 From Thermus Thermophilus Hb8 Length = 207 Back     alignment and structure
>gi|56554604|pdb|1XM8|A Chain A, X-Ray Structure Of Glyoxalase Ii From Arabidopsis Thaliana Gene At2g31350 Length = 254 Back     alignment and structure
>gi|99032459|pdb|2GCU|A Chain A, X-Ray Structure Of Gene Product From Arabidopsis Thaliana At1g53580 Length = 245 Back     alignment and structure
gi|6137437|pdb|1QH3|A Chain A, Human Glyoxalase Ii With Cacodylate And Acetate Ions Present In The Active Site Length = 260 Back     alignment and structure
>gi|326634640|pdb|3R2U|A Chain A, 2.1 Angstrom Resolution Crystal Structure Of Metallo-Beta-Lactamase From Staphylococcus Aureus Subsp. Aureus Col Length = 466 Back     alignment and structure
>gi|158430160|pdb|2QED|A Chain A, Crystal Structure Of Salmonella Thyphimurium Lt2 Glyoxalase Ii Length = 258 Back     alignment and structure
>gi|165760938|pdb|2P18|A Chain A, Crystal Structure Of The Leishmania Infantum Glyoxalase Ii Length = 311 Back     alignment and structure
gi|225698002|pdb|2ZO4|A Chain A, Crystal Structure Of Metallo-Beta-Lactamase Family Protein Ttha1429 From Thermus Thermophilus Hb8 Length = 317 Back     alignment and structure
>gi|300508335|pdb|2VW8|A Chain A, Crystal Structure Of Quinolone Signal Response Protein Pqse From Pseudomonas Aeruginosa Length = 303 Back     alignment and structure
>gi|241913148|pdb|3DH8|A Chain A, Structure Of Pseudomonas Quinolone Signal Response Protein Pqse Length = 303 Back     alignment and structure
>gi|189339511|pdb|2Q0J|A Chain A, Structure Of Pseudomonas Quinolone Signal Response Protein Pqse Length = 321 Back     alignment and structure
>gi|189339510|pdb|2Q0I|A Chain A, Structure Of Pseudomonas Quinolone Signal Response Protein Pqse Length = 303 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

IdentityAlignment graphLength Definition E-value
Target216 hypothetical protein CLIBASIA_03225 [Candidatus Liberib
2xf4_A210 Hydroxyacylglutathione hydrolase; HET: PG4; 2.30A {Salm 2e-52
2zwr_A207 Metallo-beta-lactamase superfamily protein; hydrolase; 2e-31
2vw8_A303 PA1000, PQSE; quinolone signal response protein, signal 1e-24
1qh5_A260 Glyoxalase II, protein (hydroxyacylglutathione hydrolas 3e-24
1xm8_A254 Glyoxalase II; structural genomics, protein structure i 4e-24
3l6n_A219 Metallo-beta-lactamase; zinc, hydolase, antibiotics res 7e-24
3adr_A261 Putative uncharacterized protein ST1585; quorum sensing 1e-23
1k07_A263 FEZ-1 beta-lactamase; monomer with alpha-beta/BETA-alph 1e-22
2whg_A230 VIM-4 metallo-beta-lactamase; hydrolase, alpha-beta/BET 1e-21
1ko3_A230 VIM-2 metallo-beta-lactamase; alpha-beta/BETA-alpha fol 3e-20
1m2x_A223 Class B carbapenemase BLAB-1; alpha-beta/BETA-alpha fol 3e-19
1jjt_A228 IMP-1 metallo beta-lactamase; metallo-beta-lactamase in 4e-19
2gmn_A274 Metallo-beta-lactamase; hydrolase; 1.40A {Bradyrhizobiu 2e-17
2p18_A311 Glyoxalase II; metalloprotein, beta sandwich, alpha-hel 2e-17
1a7t_A232 Metallo-beta-lactamase; hydrolase (beta-lactamase), zin 3e-17
3iog_A227 Beta-lactamase; hydrolase, antibiotic resistance, metal 4e-17
2qed_A258 Hydroxyacylglutathione hydrolase; metallo-B- lactamase 5e-17
1mqo_A227 Beta-lactamase II; alpha-beta/BETA-alpha fold, hydrolas 2e-16
2q0i_A303 Quinolone signal response protein; quorum sensing, pseu 3e-16
1e5d_A 402 Rubredoxin\:oxygen oxidoreductase; oxygenreductase, DII 6e-16
2yz3_A266 Metallo-beta-lactamase; enzyme-inhibitor complex, hydro 8e-16
2gcu_A245 Putative hydroxyacylglutathione hydrolase 3; ethylmalon 3e-15
1sml_A269 Protein (penicillinase); metallo-beta-lactamase, antibi 6e-15
2p97_A201 Hypothetical protein; structural genomics, joint center 2e-14
2q9u_A 414 A-type flavoprotein; flavodoxin like, beta lactamase li 1e-13
1ycg_A 398 Nitric oxide reductase; DIIRON site, oxidoreductase; HE 2e-12
1x8h_A228 Beta-lactamase; hydrolase; 1.60A {Aeromonas hydrophila} 2e-12
2ohh_A 404 Type A flavoprotein FPRA; beta-lactamase like domain, f 2e-12
1vme_A 410 Flavoprotein; TM0755, structural genomics, JCSG, protei 3e-12
1p9e_A331 Methyl parathion hydrolase; Zn containing; 2.40A {Pseud 4e-12
2zo4_A317 Metallo-beta-lactamase family protein; hydrolase; 2.10A 8e-11
2fhx_A246 SPM-1; metallo-beta-lactamase, dinuclear zinc, antibiot 1e-10
3hnn_A262 Putative diflavin flavoprotein A 5; PSI-2, protein stru 7e-10
1ztc_A221 Hypothetical protein TM0894; structural genomics, PSI, 6e-09
2cfu_A 658 SDSA1; SDS-hydrolase, lactamase, hydrolase; HET: 1DB; 1 2e-08
3bk2_A 562 RNAse J, metal dependent hydrolase; endoribonuclease, e 8e-04
2r2d_A276 AGR_PTI_140P, Zn-dependent hydrolases; lactonase, N-acy 3e-11
3dha_A254 N-acyl homoserine lactone hydrolase; zinc bimetallohydr 9e-08
3esh_A280 Protein similar to metal-dependent hydrolase; structura 5e-06
2az4_A 429 Hypothetical protein EF2904; structural genomics, PSI, 2e-05
3af5_A 651 Putative uncharacterized protein PH1404; archaeal CPSF, 2e-05
2bib_A 547 CBPE, teichoic acid phosphorylcholine esterase/ choline 0.001
2zdf_A 431 Metallo-beta-lactamase superfamily protein; metallo bet 0.001
2xr1_A 640 Cleavage and polyadenylation specificity factor 1 subun 4e-04
>2xf4_A Hydroxyacylglutathione hydrolase; HET: PG4; 2.30A {Salmonella enterica} Length = 210 Back     alignment and structure
 Score =  200 bits (509), Expect = 2e-52
 Identities = 86/208 (41%), Positives = 135/208 (64%), Gaps = 1/208 (0%)

Query: 6   FHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHV 65
           + I+ VT F QNC+ ++ E++  A +VDPGGD + IK  + +    + QI +THGH+DHV
Sbjct: 3   YRIIPVTAFSQNCSLIWCEQTRLAALVDPGGDAEKIKQEVDASGVTLMQILLTHGHLDHV 62

Query: 66  GGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGT 125
           G A++L +   + +IGP K+D   +  +  Q+R+       +  + DRWL DGD + +G 
Sbjct: 63  GAASELAQHYGVPVIGPEKEDEFWLQGLPAQSRMFG-LDECQPLTPDRWLNDGDRVSVGN 121

Query: 126 HIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILP 185
              +V HCPGH+PGHV++ + ++     GD +F+  +GR+D   GD+ QLI++I  K+LP
Sbjct: 122 VTLQVLHCPGHTPGHVVFFDEQSQLLISGDVIFKGGVGRSDFPRGDHTQLIDAIKRKLLP 181

Query: 186 LGDEISFVCGHGPNSTIGRERRLNPFLK 213
           LGD+++F+ GHGP ST+G ER  NPFL+
Sbjct: 182 LGDDVTFIPGHGPLSTLGYERLHNPFLQ 209
>2zwr_A Metallo-beta-lactamase superfamily protein; hydrolase; 2.20A {Thermus thermophilus} Length = 207 Back     alignment and structure
>2vw8_A PA1000, PQSE; quinolone signal response protein, signaling protein, SSPF; 1.45A {Pseudomonas aeruginosa PAO1} PDB: 2q0j_A 2q0i_A 3dh8_A* Length = 303 Back     alignment and structure
>1qh5_A Glyoxalase II, protein (hydroxyacylglutathione hydrolase); metallo-hydrolase; HET: GTT GBP; 1.45A {Homo sapiens} SCOP: d.157.1.2 PDB: 1qh3_A* Length = 260 Back     alignment and structure
>1xm8_A Glyoxalase II; structural genomics, protein structure initiative, CESG, AT2G31350, metallo-hydrolase, zinc/iron binuclear center; 1.74A {Arabidopsis thaliana} SCOP: d.157.1.2 PDB: 2q42_A Length = 254 Back     alignment and structure
>3l6n_A Metallo-beta-lactamase; zinc, hydolase, antibiotics resistance, hydrolase; 1.65A {Chryseobacterium indologenes} Length = 219 Back     alignment and structure
>3adr_A Putative uncharacterized protein ST1585; quorum sensing, quinolone signal, metallo-beta-lactamase FOL conserved hypothetical protein; HET: EPE; 1.80A {Sulfolobus tokodaii} Length = 261 Back     alignment and structure
>1k07_A FEZ-1 beta-lactamase; monomer with alpha-beta/BETA-alpha fold. two monomers PER assymmetric UNIT., hydrolase; HET: GOL; 1.65A {Fluoribacter gormanii} SCOP: d.157.1.1 PDB: 1jt1_A* 1l9y_A Length = 263 Back     alignment and structure
>2whg_A VIM-4 metallo-beta-lactamase; hydrolase, alpha-beta/BETA-alpha fold; HET: FLC; 1.90A {Pseudomonas aeruginosa} PDB: 2wrs_A* 1ko3_A 1ko2_A Length = 230 Back     alignment and structure
>1ko3_A VIM-2 metallo-beta-lactamase; alpha-beta/BETA-alpha fold, hydrolase; 1.91A {Pseudomonas aeruginosa} SCOP: d.157.1.1 PDB: 1ko2_A Length = 230 Back     alignment and structure
>1m2x_A Class B carbapenemase BLAB-1; alpha-beta/BETA-alpha fold., hydrolase; HET: MCO; 1.50A {Elizabethkingia meningoseptica} SCOP: d.157.1.1 Length = 223 Back     alignment and structure
>1jjt_A IMP-1 metallo beta-lactamase; metallo-beta-lactamase inhibitor, succinic acid inhibitor, hydrolase; HET: BDS; 1.80A {Pseudomonas aeruginosa} SCOP: d.157.1.1 PDB: 1dd6_A* 1vgn_A* 2doo_A* 1wup_A 1wuo_A 1jje_A* 1ddk_A Length = 228 Back     alignment and structure
>2gmn_A Metallo-beta-lactamase; hydrolase; 1.40A {Bradyrhizobium japonicum usda 110} SCOP: d.157.1.1 Length = 274 Back     alignment and structure
>2p18_A Glyoxalase II; metalloprotein, beta sandwich, alpha-helical domain, hydrolase; HET: SPD; 1.80A {Leishmania infantum} PDB: 2p1e_A* Length = 311 Back     alignment and structure
>1a7t_A Metallo-beta-lactamase; hydrolase (beta-lactamase), zinc; HET: MES; 1.85A {Bacteroides fragilis} SCOP: d.157.1.1 PDB: 1a8t_A* 2bmi_A 1kr3_A 1znb_A 2znb_A 3znb_A 4znb_A 1hlk_A* Length = 232 Back     alignment and structure
>3iog_A Beta-lactamase; hydrolase, antibiotic resistance, metal-binding, periplasm,; HET: SDF; 1.41A {Aeromonas hydrophila} PDB: 1x8i_A 3fai_A* 3iof_A* 1x8h_A 2qds_A* 2gkl_A* 1x8g_A* 3f9o_A Length = 227 Back     alignment and structure
>2qed_A Hydroxyacylglutathione hydrolase; metallo-B- lactamase superfamily; 1.45A {Salmonella typhimurium LT2} SCOP: d.157.1.2 Length = 258 Back     alignment and structure
>1mqo_A Beta-lactamase II; alpha-beta/BETA-alpha fold, hydrolase; HET: CIT; 1.35A {Bacillus cereus} SCOP: d.157.1.1 PDB: 1bc2_A 1bvt_A* 3i0v_A 3i11_A 3i13_A 3i14_A 3i15_A 2uyx_A 2bc2_A 3bc2_A 2bfl_A 2bfk_A 2bfz_B 2bg2_A 2bg7_A 2bg8_A 1dxk_A 2bfz_A 2bg6_A 2bga_A ... Length = 227 Back     alignment and structure
>2q0i_A Quinolone signal response protein; quorum sensing, pseudomonas quinolone signal, PQS, metall- beta-lactamase, iron, phosphodiesterase; 1.57A {Pseudomonas aeruginosa} SCOP: d.157.1.14 PDB: 2q0j_A 3dh8_A* Length = 303 Back     alignment and structure
>1e5d_A Rubredoxin\:oxygen oxidoreductase; oxygenreductase, DIIRON-centre, flavoproteins, lactamase-fold; HET: FMN; 2.5A {Desulfovibrio gigas} SCOP: c.23.5.1 d.157.1.3 Length = 402 Back     alignment and structure
>2yz3_A Metallo-beta-lactamase; enzyme-inhibitor complex, hydrolase; HET: M5P; 2.30A {Pseudomonas putida} SCOP: d.157.1.1 Length = 266 Back     alignment and structure
>2gcu_A Putative hydroxyacylglutathione hydrolase 3; ethylmalonic encephalopathy, ETHE1, structural genomics, protein structure initiative; 1.48A {Arabidopsis thaliana} Length = 245 Back     alignment and structure
>1sml_A Protein (penicillinase); metallo-beta-lactamase, antibiotic resistance, binuclear zinc, hydrolase; 1.70A {Stenotrophomonas maltophilia} SCOP: d.157.1.1 PDB: 2aio_A* 2fm6_A 2fu6_A 2fu7_A* 2fu8_A* 2fu9_A* 2gfj_A* 2gfk_A* 2h6a_A 2hb9_A* 2qdt_A* 2qjs_A 2qin_A Length = 269 Back     alignment and structure
>2p97_A Hypothetical protein; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.65A {Anabaena variabilis atcc 29413} SCOP: d.157.1.12 Length = 201 Back     alignment and structure
>2q9u_A A-type flavoprotein; flavodoxin like, beta lactamase like, oxidoreductase; HET: FMN; 1.90A {Giardia intestinalis} Length = 414 Back     alignment and structure
>1ycg_A Nitric oxide reductase; DIIRON site, oxidoreductase; HET: FMN; 2.80A {Moorella thermoacetica} SCOP: c.23.5.1 d.157.1.3 PDB: 1ycf_A* 1ych_A* Length = 398 Back     alignment and structure
>1x8h_A Beta-lactamase; hydrolase; 1.60A {Aeromonas hydrophila} SCOP: d.157.1.1 PDB: 3fai_A 1x8i_A 2qds_A* 2gkl_A* 1x8g_A* 3f9o_A Length = 228 Back     alignment and structure
>2ohh_A Type A flavoprotein FPRA; beta-lactamase like domain, flavodoxine like domain, oxidoreductase; HET: FMN; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2ohi_A* 2ohj_A* Length = 404 Back     alignment and structure
>1vme_A Flavoprotein; TM0755, structural genomics, JCSG, protein structure initiative, PSI, joint center for structural genomics; HET: MSE; 1.80A {Thermotoga maritima} SCOP: c.23.5.1 d.157.1.3 Length = 410 Back     alignment and structure
>1p9e_A Methyl parathion hydrolase; Zn containing; 2.40A {Pseudomonas SP} SCOP: d.157.1.5 Length = 331 Back     alignment and structure
>2zo4_A Metallo-beta-lactamase family protein; hydrolase; 2.10A {Thermus thermophilus HB8} Length = 317 Back     alignment and structure
>2fhx_A SPM-1; metallo-beta-lactamase, dinuclear zinc, antibiotic resistance, structure, hydrolase, metal binding protein; 1.90A {Pseudomonas aeruginosa} Length = 246 Back     alignment and structure
>3hnn_A Putative diflavin flavoprotein A 5; PSI-2, protein structure initiative, northeast structural genomics consortium, NESG, NSR435A, DFA5; 1.80A {Nostoc SP} Length = 262 Back     alignment and structure
>1ztc_A Hypothetical protein TM0894; structural genomics, PSI, protein structure initiative, joint center for structural genomics, JCSG; HET: MSE; 2.10A {Thermotoga maritima} SCOP: d.157.1.11 Length = 221 Back     alignment and structure
>2cfu_A SDSA1; SDS-hydrolase, lactamase, hydrolase; HET: 1DB; 1.9A {Pseudomonas aeruginosa} SCOP: d.106.1.3 d.157.1.13 PDB: 2cfz_A* 2cg2_A 2cg3_A* Length = 658 Back     alignment and structure
>3bk2_A RNAse J, metal dependent hydrolase; endoribonuclease, exoribonuclease, metallo-beta-lactamase; HET: U5P; 2.10A {Thermus thermophilus HB27} PDB: 3bk1_A* Length = 562 Back     alignment and structure
>2r2d_A AGR_PTI_140P, Zn-dependent hydrolases; lactonase, N-acyl hompserine lactone, DI-nuclear zinc center, quorum quenching, AIIB, phosphate; HET: PO4; 1.75A {Agrobacterium tumefaciens} Length = 276 Back     alignment and structure
>3dha_A N-acyl homoserine lactone hydrolase; zinc bimetallohydrolase, quorum quenching, alternative binding site, product complex; HET: C6L GOL; 0.95A {Bacillus thuringiensis serovarkurstaki} PDB: 3dhb_A* 3dhc_A* 2a7m_A* 2br6_A 2btn_A Length = 254 Back     alignment and structure
>3esh_A Protein similar to metal-dependent hydrolase; structural genomics, PSI-2, protein structure initiative; 2.50A {Staphylococcus aureus subsp} Length = 280 Back     alignment and structure
>2az4_A Hypothetical protein EF2904; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.00A {Enterococcus faecalis V583} SCOP: d.157.1.10 Length = 429 Back     alignment and structure
>3af5_A Putative uncharacterized protein PH1404; archaeal CPSF, beta-CAsp family, KH domain, ribonuclease, ME beta-lactamase superfamily, archaea; 2.60A {Pyrococcus horikoshii} PDB: 3af6_A* Length = 651 Back     alignment and structure
>2bib_A CBPE, teichoic acid phosphorylcholine esterase/ choline binding protein; PCE, hydrolase; HET: PC BTB; 1.92A {Streptococcus pneumoniae} SCOP: b.109.1.1 d.157.1.8 PDB: 1wra_A* Length = 547 Back     alignment and structure
>2xr1_A Cleavage and polyadenylation specificity factor 1 subunit; hydrolase, metallo-beta-lactamase, beta-CAsp, RNA processing; 2.59A {Methanosarcina mazei} Length = 640 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

Original result of HHsearch against PDB70 database

IdentityAlignment graphLength Definition Probability
Target216 hypothetical protein CLIBASIA_03225 [Candidatus Liberib
2xf4_A210 Hydroxyacylglutathione hydrolase; HET: PG4; 2.30A {Salm 100.0
1xm8_A254 Glyoxalase II; structural genomics, protein structure i 100.0
2qed_A258 Hydroxyacylglutathione hydrolase; metallo-B- lactamase 100.0
2gcu_A245 Putative hydroxyacylglutathione hydrolase 3; ethylmalon 100.0
1qh5_A260 Glyoxalase II, protein (hydroxyacylglutathione hydrolas 100.0
2p18_A311 Glyoxalase II; metalloprotein, beta sandwich, alpha-hel 100.0
2zwr_A207 Metallo-beta-lactamase superfamily protein; hydrolase; 100.0
2vw8_A303 PA1000, PQSE; quinolone signal response protein, signal 100.0
2gmn_A274 Metallo-beta-lactamase; hydrolase; 1.40A {Bradyrhizobiu 100.0
2zo4_A317 Metallo-beta-lactamase family protein; hydrolase; 2.10A 100.0
1a7t_A232 Metallo-beta-lactamase; hydrolase (beta-lactamase), zin 100.0
1m2x_A223 Class B carbapenemase BLAB-1; alpha-beta/BETA-alpha fol 100.0
3l6n_A219 Metallo-beta-lactamase; zinc, hydolase, antibiotics res 100.0
3adr_A261 Putative uncharacterized protein ST1585; quorum sensing 100.0
2yz3_A266 Metallo-beta-lactamase; enzyme-inhibitor complex, hydro 99.97
1k07_A263 FEZ-1 beta-lactamase; monomer with alpha-beta/BETA-alph 99.97
2whg_A230 VIM-4 metallo-beta-lactamase; hydrolase, alpha-beta/BET 99.97
1mqo_A227 Beta-lactamase II; alpha-beta/BETA-alpha fold, hydrolas 99.97
1jjt_A228 IMP-1 metallo beta-lactamase; metallo-beta-lactamase in 99.97
3iog_A227 Beta-lactamase; hydrolase, antibiotic resistance, metal 99.97
1sml_A269 Protein (penicillinase); metallo-beta-lactamase, antibi 99.97
2fhx_A246 SPM-1; metallo-beta-lactamase, dinuclear zinc, antibiot 99.96
2cfu_A 658 SDSA1; SDS-hydrolase, lactamase, hydrolase; HET: 1DB; 1 99.96
2p97_A201 Hypothetical protein; putative metal-dependent hydrolas 99.96
2q9u_A 414 A-type flavoprotein; flavodoxin like, beta lactamase li 99.96
2ohh_A 404 Type A flavoprotein FPRA; beta-lactamase like domain, f 99.96
1ycg_A 398 Nitric oxide reductase; DIIRON site, oxidoreductase; HE 99.95
1e5d_A 402 Rubredoxin\:oxygen oxidoreductase; oxygenreductase, DII 99.95
1vme_A 410 Flavoprotein; TM0755, structural genomics, JCSG, protei 99.95
3esh_A280 Protein similar to metal-dependent hydrolase; structura 99.95
3hnn_A262 Putative diflavin flavoprotein A 5; PSI-2, protein stru 99.94
3dha_A254 N-acyl homoserine lactone hydrolase; zinc bimetallohydr 99.94
2r2d_A276 AGR_PTI_140P, Zn-dependent hydrolases; lactonase, N-acy 99.92
1ztc_A221 Hypothetical protein TM0894; structural genomics, PSI, 99.92
1p9e_A331 Methyl parathion hydrolase; Zn containing; 2.40A {Pseud 99.92
2bib_A 547 CBPE, teichoic acid phosphorylcholine esterase/ choline 99.72
3kl7_A235 Putative metal-dependent hydrolase; structural genomics 98.87
3bv6_A379 Metal-dependent hydrolase; metallo protein, beta-lactam 98.67
1vjn_A220 Zn-dependent hydrolase of metallo-beta-lactamase superf 98.56
3bk2_A 562 RNAse J, metal dependent hydrolase; endoribonuclease, e 99.79
3af5_A 651 Putative uncharacterized protein PH1404; archaeal CPSF, 99.73
2i7t_A 459 Cleavage and polyadenylation specificity factor 73 kDa 99.72
2xr1_A 640 Cleavage and polyadenylation specificity factor 1 subun 99.69
2az4_A 429 Hypothetical protein EF2904; structural genomics, PSI, 99.65
2i7x_A 717 Protein CFT2; polyadenylation, metallo-B-lactamase, PRE 99.64
1zkp_A268 Hypothetical protein BA1088; zinc binding protein, stru 99.5
3g1p_A258 Protein PHNP; C-P lyase, phosphodiesterase, phosphonate 99.38
2wyl_A360 L-ascorbate-6-phosphate lactonase ULAG; hydrolase; 2.59 98.52
2p4z_A284 Metal-dependent hydrolases of the beta-lactamase superf 99.57
3jxp_A321 Coenzyme PQQ synthesis protein B; alpha-beta protein, P 99.19
2cbn_A306 Ribonuclease Z; phosphodiesterase beta lactamase tRNAse 99.14
3h3e_A267 Uncharacterized protein TM1679; structural genomics, su 99.1
1y44_A320 Ribonuclease Z; zinc-dependent metal hydrolase; HET: ME 99.0
3md7_A293 Beta-lactamase-like; ssgcid, hydrolase, structural geno 98.68
2e7y_A280 TRNAse Z; tRNA maturation, metallo-beta-lactaMSe, struc 98.43
>2xf4_A Hydroxyacylglutathione hydrolase; HET: PG4; 2.30A {Salmonella enterica} Back     alignment and structure
Probab=100.00  E-value=0  Score=353.41  Aligned_cols=210  Identities=41%  Similarity=0.843  Sum_probs=192.1

Q ss_pred             CEEEEEECCCCCCCEEEEEECCCCEEEEECCCCCHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCHHHHHHHCCCEEECC
Q ss_conf             35999970876571699998899849998389999999999997499752999869885210110567886079554058
Q gi|254780758|r    4 LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLKEDLSLTIIGPH   83 (216)
Q Consensus         4 ~~~~~i~v~~~~~N~~li~~~~~~~~ilID~G~~~~~i~~~l~~~~~~i~~Ii~TH~H~DH~gg~~~l~~~~~~~i~~~~   83 (216)
                      |++++||+++|++|||+|.++++++++|||||.+.+.+++.+++.+++|++|++||.|+||+||+..|++++++++++..
T Consensus         1 m~~~~i~~~~~~~N~yli~~~~~~~~ilID~G~~~~~i~~~l~~~~~~i~~Vi~TH~H~DH~gg~~~l~~~~~~~i~~~~   80 (210)
T 2xf4_A            1 MNYRIIPVTAFSQNCSLIWCEQTRLAALVDPGGDAEKIKQEVDASGVTLMQILLTHGHLDHVGAASELAQHYGVPVIGPE   80 (210)
T ss_dssp             CEEEEEEETTTTEEEEEEECTTTCEEEEECCCSCHHHHHHHHHHHTCEEEEEECSCSCHHHHTTHHHHHHHHTCCEECCC
T ss_pred             CCEEEEECCCHHCEEEEEEECCCCEEEEEECCCCHHHHHHHHHHCCCCEEEEEECCCCCCCCCCHHHHHHHHCCCEEEEC
T ss_conf             94399987844668999998999989999798089999999997799348999787998553518998775098478501


Q ss_pred             HHHHHHHCCHHHHHHHHHCCCCCCCCCCEEEECCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHCCCC
Q ss_conf             43898840123444432002346666741896478399762012331012224721000001234321111000001356
Q gi|254780758|r   84 KDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIG  163 (216)
Q Consensus        84 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~gd~i~lg~~~~~vi~tPGHt~g~~~~~~~~~~~lftGD~lf~~~~G  163 (216)
                      ..+..+..........+.. .......++..+++++.+.+|+.++++++||||||||++++.++.+++|+||.+|.+++|
T Consensus        81 ~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~dg~~~~~g~~~~~~i~tPGHT~g~~~~~~~~~~~l~~GD~~~~~~~~  159 (210)
T 2xf4_A           81 KEDEFWLQGLPAQSRMFGL-DECQPLTPDRWLNDGDRVSVGNVTLQVLHCPGHTPGHVVFFDEQSQLLISGDVIFKGGVG  159 (210)
T ss_dssp             GGGHHHHHTHHHHHHHTTC-CCCCCCCCSBCCCTTCEEEETTEEEEEEECCSSSTTCEEEEETTTTEEEEETSEETTEEC
T ss_pred             CHHHHHHCCCHHHHHHCCC-CCCCCCCCCEEECCCCCCEECCEEEEEEEECCCCCCCEEEEECCCCCCCCCCEEECCCCC
T ss_conf             0456652042123211033-345567785893168742369989999992699998689997788842148886379704


Q ss_pred             CCCCCCCCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHCHHHHC
Q ss_conf             634679899999999999985199978998488798888999882814514
Q gi|254780758|r  164 RTDILHGDYQQLINSINNKILPLGDEISFVCGHGPNSTIGRERRLNPFLKS  214 (216)
Q Consensus       164 ~~d~~~~d~~~~~~sl~~~l~~l~~~~~v~PgHG~~tt~~~e~~~n~~~~~  214 (216)
                      +++++.+|..++++||++++..++++++|+|||||+||+++||+.|||||+
T Consensus       160 ~~~~~~~d~~~~~~sl~~~l~~l~~~~~v~PGHG~~st~~~e~~~N~~~~~  210 (210)
T 2xf4_A          160 RSDFPRGDHTQLIDAIKRKLLPLGDDVTFIPGHGPLSTLGYERLHNPFLQD  210 (210)
T ss_dssp             CCCSTTCCHHHHHHHHHHHTGGGCTTCEEEESSSCCEEHHHHHHHCTTC-C
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHCCCCEEEECCCCCCCCHHHHHHHCHHHCC
T ss_conf             766788999999999999997089983998999986549999875845249
>1xm8_A Glyoxalase II; structural genomics, protein structure initiative, CESG, AT2G31350, metallo-hydrolase, zinc/iron binuclear center; 1.74A {Arabidopsis thaliana} SCOP: d.157.1.2 PDB: 2q42_A Back     alignment and structure
>2qed_A Hydroxyacylglutathione hydrolase; metallo-B- lactamase superfamily; 1.45A {Salmonella typhimurium LT2} SCOP: d.157.1.2 Back     alignment and structure
>2gcu_A Putative hydroxyacylglutathione hydrolase 3; ethylmalonic encephalopathy, ETHE1, structural genomics, protein structure initiative; 1.48A {Arabidopsis thaliana} Back     alignment and structure
>1qh5_A Glyoxalase II, protein (hydroxyacylglutathione hydrolase); metallo-hydrolase; HET: GTT GBP; 1.45A {Homo sapiens} SCOP: d.157.1.2 PDB: 1qh3_A* Back     alignment and structure
>2p18_A Glyoxalase II; metalloprotein, beta sandwich, alpha-helical domain, hydrolase; HET: SPD; 1.80A {Leishmania infantum} PDB: 2p1e_A* Back     alignment and structure
>2zwr_A Metallo-beta-lactamase superfamily protein; hydrolase; 2.20A {Thermus thermophilus} PDB: 2zzi_A Back     alignment and structure
>2vw8_A PA1000, PQSE; quinolone signal response protein, signaling protein, SSPF; 1.45A {Pseudomonas aeruginosa PAO1} PDB: 2q0j_A 2q0i_A 3dh8_A* Back     alignment and structure
>2gmn_A Metallo-beta-lactamase; hydrolase; 1.40A {Bradyrhizobium japonicum usda 110} SCOP: d.157.1.1 Back     alignment and structure
>2zo4_A Metallo-beta-lactamase family protein; hydrolase; 2.10A {Thermus thermophilus HB8} Back     alignment and structure
>1a7t_A Metallo-beta-lactamase; hydrolase (beta-lactamase), zinc; HET: MES; 1.85A {Bacteroides fragilis} SCOP: d.157.1.1 PDB: 1a8t_A* 2bmi_A 1kr3_A 1znb_A 2znb_A 3znb_A 4znb_A 1hlk_A* Back     alignment and structure
>1m2x_A Class B carbapenemase BLAB-1; alpha-beta/BETA-alpha fold., hydrolase; HET: MCO; 1.50A {Elizabethkingia meningoseptica} SCOP: d.157.1.1 Back     alignment and structure
>3l6n_A Metallo-beta-lactamase; zinc, hydolase, antibiotics resistance, hydrolase; 1.65A {Chryseobacterium indologenes} Back     alignment and structure
>3adr_A Putative uncharacterized protein ST1585; quorum sensing, quinolone signal, metallo-beta-lactamase FOL conserved hypothetical protein; HET: EPE; 1.80A {Sulfolobus tokodaii} Back     alignment and structure
>2yz3_A Metallo-beta-lactamase; enzyme-inhibitor complex, hydrolase; HET: M5P; 2.30A {Pseudomonas putida} SCOP: d.157.1.1 Back     alignment and structure
>1k07_A FEZ-1 beta-lactamase; monomer with alpha-beta/BETA-alpha fold. two monomers PER assymmetric UNIT., hydrolase; HET: GOL; 1.65A {Fluoribacter gormanii} SCOP: d.157.1.1 PDB: 1jt1_A* 1l9y_A Back     alignment and structure
>2whg_A VIM-4 metallo-beta-lactamase; hydrolase, alpha-beta/BETA-alpha fold; HET: FLC; 1.90A {Pseudomonas aeruginosa} PDB: 2wrs_A* 1ko3_A 1ko2_A Back     alignment and structure
>1mqo_A Beta-lactamase II; alpha-beta/BETA-alpha fold, hydrolase; HET: CIT; 1.35A {Bacillus cereus} SCOP: d.157.1.1 PDB: 1bc2_A 1bvt_A* 3i0v_A 3i11_A 3i13_A 3i14_A 3i15_A 2uyx_A 2bc2_A 3bc2_A 2bfl_A 2bfk_A 2bfz_B 2bg2_A 2bg7_A 2bg8_A 1dxk_A 2bfz_A 2bg6_A 2bga_A ... Back     alignment and structure
>1jjt_A IMP-1 metallo beta-lactamase; metallo-beta-lactamase inhibitor, succinic acid inhibitor, hydrolase; HET: BDS; 1.80A {Pseudomonas aeruginosa} SCOP: d.157.1.1 PDB: 1dd6_A* 1vgn_A* 2doo_A* 1wup_A 1wuo_A 1jje_A* 1ddk_A Back     alignment and structure
>3iog_A Beta-lactamase; hydrolase, antibiotic resistance, metal-binding, periplasm,; HET: SDF; 1.41A {Aeromonas hydrophila} PDB: 1x8i_A 3fai_A* 3iof_A* 1x8h_A 2qds_A* 2gkl_A* 1x8g_A* 3f9o_A Back     alignment and structure
>1sml_A Protein (penicillinase); metallo-beta-lactamase, antibiotic resistance, binuclear zinc, hydrolase; 1.70A {Stenotrophomonas maltophilia} SCOP: d.157.1.1 PDB: 2aio_A* 2fm6_A 2fu6_A 2fu7_A* 2fu8_A* 2fu9_A* 2gfj_A* 2gfk_A* 2h6a_A 2hb9_A* 2qdt_A* 2qjs_A 2qin_A Back     alignment and structure
>2fhx_A SPM-1; metallo-beta-lactamase, dinuclear zinc, antibiotic resistance, structure, hydrolase, metal binding protein; 1.90A {Pseudomonas aeruginosa} Back     alignment and structure
>2cfu_A SDSA1; SDS-hydrolase, lactamase, hydrolase; HET: 1DB; 1.9A {Pseudomonas aeruginosa} SCOP: d.106.1.3 d.157.1.13 PDB: 2cfz_A* 2cg2_A 2cg3_A* Back     alignment and structure
>2p97_A Hypothetical protein; putative metal-dependent hydrolase, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 1.65A {Anabaena variabilis atcc 29413} SCOP: d.157.1.12 Back     alignment and structure
>2q9u_A A-type flavoprotein; flavodoxin like, beta lactamase like, oxidoreductase; HET: FMN; 1.90A {Giardia intestinalis} Back     alignment and structure
>2ohh_A Type A flavoprotein FPRA; beta-lactamase like domain, flavodoxine like domain, oxidoreductase; HET: FMN; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2ohi_A* 2ohj_A* Back     alignment and structure
>1ycg_A Nitric oxide reductase; DIIRON site, oxidoreductase; HET: FMN; 2.80A {Moorella thermoacetica} SCOP: c.23.5.1 d.157.1.3 PDB: 1ycf_A* 1ych_A* Back     alignment and structure
>1e5d_A Rubredoxin\:oxygen oxidoreductase; oxygenreductase, DIIRON-centre, flavoproteins, lactamase-fold; HET: FMN; 2.5A {Desulfovibrio gigas} SCOP: c.23.5.1 d.157.1.3 Back     alignment and structure
>1vme_A Flavoprotein; TM0755, structural genomics, JCSG, protein structure initiative, PSI, joint center for structural genomics; HET: MSE; 1.80A {Thermotoga maritima} SCOP: c.23.5.1 d.157.1.3 Back     alignment and structure
>3esh_A Protein similar to metal-dependent hydrolase; structural genomics, PSI-2, protein structure initiative; 2.50A {Staphylococcus aureus subsp} Back     alignment and structure
>3hnn_A Putative diflavin flavoprotein A 5; PSI-2, protein structure initiative, northeast structural genomics consortium, NESG, NSR435A, DFA5; 1.80A {Nostoc SP} Back     alignment and structure
>3dha_A N-acyl homoserine lactone hydrolase; zinc bimetallohydrolase, quorum quenching, alternative binding site, product complex; HET: C6L GOL; 0.95A {Bacillus thuringiensis serovarkurstaki} PDB: 3dhb_A* 3dhc_A* 2a7m_A* 2br6_A 2btn_A Back     alignment and structure
>2r2d_A AGR_PTI_140P, Zn-dependent hydrolases; lactonase, N-acyl hompserine lactone, DI-nuclear zinc center, quorum quenching, AIIB, phosphate; HET: PO4; 1.75A {Agrobacterium tumefaciens} Back     alignment and structure
>1ztc_A Hypothetical protein TM0894; structural genomics, PSI, protein structure initiative, joint center for structural genomics, JCSG; HET: MSE; 2.10A {Thermotoga maritima} SCOP: d.157.1.11 Back     alignment and structure
>1p9e_A Methyl parathion hydrolase; Zn containing; 2.40A {Pseudomonas SP} SCOP: d.157.1.5 Back     alignment and structure
>2bib_A CBPE, teichoic acid phosphorylcholine esterase/ choline binding protein; PCE, hydrolase; HET: PC BTB; 1.92A {Streptococcus pneumoniae} SCOP: b.109.1.1 d.157.1.8 PDB: 1wra_A* Back     alignment and structure
>3kl7_A Putative metal-dependent hydrolase; structural genomics, joint center for structural genomics, JCSG; 2.30A {Parabacteroides distasonis atcc 8503} Back     alignment and structure
>3bv6_A Metal-dependent hydrolase; metallo protein, beta-lactamase like fold, MCSG, structural genomics, PSI-2; 1.80A {Vibrio cholerae o1 biovar eltor str} Back     alignment and structure
>1vjn_A Zn-dependent hydrolase of metallo-beta-lactamase superfamily TM0207; structural genomics, JCSG, PSI, protein structure initiative; 2.00A {Thermotoga maritima} SCOP: d.157.1.4 Back     alignment and structure
>3bk2_A RNAse J, metal dependent hydrolase; endoribonuclease, exoribonuclease, metallo-beta-lactamase; HET: U5P; 2.10A {Thermus thermophilus HB27} PDB: 3bk1_A* Back     alignment and structure
>3af5_A Putative uncharacterized protein PH1404; archaeal CPSF, beta-CAsp family, KH domain, ribonuclease, ME beta-lactamase superfamily, archaea; 2.60A {Pyrococcus horikoshii} PDB: 3af6_A* Back     alignment and structure
>2i7t_A Cleavage and polyadenylation specificity factor 73 kDa subunit; metallo-B-lactamase, PRE-mRNA processing, artemis, V(D)J recombination; 2.10A {Homo sapiens} SCOP: d.157.1.10 PDB: 2i7v_A Back     alignment and structure
>2xr1_A Cleavage and polyadenylation specificity factor 1 subunit; hydrolase, metallo-beta-lactamase, beta-CAsp, RNA processing; 2.59A {Methanosarcina mazei} Back     alignment and structure
>2az4_A Hypothetical protein EF2904; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.00A {Enterococcus faecalis V583} SCOP: d.157.1.10 Back     alignment and structure
>2i7x_A Protein CFT2; polyadenylation, metallo-B-lactamase, PRE-mRNA processing, artemis, V(D)J recombination, double-strand break repair; 2.50A {Saccharomyces cerevisiae} SCOP: d.157.1.10 Back     alignment and structure
>1zkp_A Hypothetical protein BA1088; zinc binding protein, structural genomics, PSI, protein structure initiative; 1.50A {Bacillus anthracis str} SCOP: d.157.1.9 Back     alignment and structure
>3g1p_A Protein PHNP; C-P lyase, phosphodiesterase, phosphonate utilization, alkylphosphonate uptake; 1.40A {Escherichia coli} Back     alignment and structure
>2wyl_A L-ascorbate-6-phosphate lactonase ULAG; hydrolase; 2.59A {Escherichia coli} PDB: 2wym_A* Back     alignment and structure
>2p4z_A Metal-dependent hydrolases of the beta-lactamase superfamily II; 2.10A {Thermoanaerobacter tengcongensis MB4} Back     alignment and structure
>3jxp_A Coenzyme PQQ synthesis protein B; alpha-beta protein, PQQ biosynthesis, transport, biosyntheti; 2.20A {Pseudomonas putida KT2440} PDB: 1xto_A Back     alignment and structure
>2cbn_A Ribonuclease Z; phosphodiesterase beta lactamase tRNAse Z, hydrolase, metal- binding, endonuclease, tRNA processing, zinc; 2.9A {Escherichia coli} SCOP: d.157.1.7 Back     alignment and structure
>3h3e_A Uncharacterized protein TM1679; structural genomics, surface entropy reduction, ISFI, beta- lactamase superfamily, PSI-2; 2.75A {Thermotoga maritima} Back     alignment and structure
>1y44_A Ribonuclease Z; zinc-dependent metal hydrolase; HET: MES; 2.10A {Bacillus subtilis} SCOP: d.157.1.7 PDB: 2fk6_A* Back     alignment and structure
>3md7_A Beta-lactamase-like; ssgcid, hydrolase, structural genomics, seattle structural genomics center for infectious disease; HET: 5GP TLA; 1.27A {Brucella melitensis biovar abortus} Back     alignment and structure
>2e7y_A TRNAse Z; tRNA maturation, metallo-beta-lactaMSe, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.97A {Thermotoga maritima} SCOP: d.157.1.7 PDB: 1ww1_A Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

IdentityAlignment graphLength Definition E-value
Target 216 hypothetical protein CLIBASIA_03225 [Candidatus Liberib
d1xm8a_254 d.157.1.2 (A:) Glyoxalase II (hydroxyacylglutathione hy 3e-24
d2qeda1251 d.157.1.2 (A:1-251) Glyoxalase II (hydroxyacylglutathio 2e-18
d2gmna1264 d.157.1.1 (A:29-292) Zn metallo-beta-lactamase {Bradyrh 6e-18
d1k07a_262 d.157.1.1 (A:) Zn metallo-beta-lactamase {Fluoribacter 1e-17
d2p97a1200 d.157.1.12 (A:1-200) Hypothetical protein Ava3068 {Anab 7e-17
d1ko3a_230 d.157.1.1 (A:) Zn metallo-beta-lactamase {Pseudomonas a 7e-17
d2q0ia1298 d.157.1.14 (A:1-298) Quinolone signal response protein 9e-17
d2aioa1266 d.157.1.1 (A:23-311) Zn metallo-beta-lactamase {Xanthom 2e-16
d1jjta_220 d.157.1.1 (A:) Zn metallo-beta-lactamase {Pseudomonas a 5e-16
d1mqoa_221 d.157.1.1 (A:) Zn metallo-beta-lactamase {Bacillus cere 1e-15
d1znba_230 d.157.1.1 (A:) Zn metallo-beta-lactamase {Bacteroides f 2e-14
d1qh5a_260 d.157.1.2 (A:) Glyoxalase II (hydroxyacylglutathione hy 8e-14
d1x8ha_228 d.157.1.1 (A:) Zn metallo-beta-lactamase {Aeromonas hyd 1e-12
d1m2xa_219 d.157.1.1 (A:) Zn metallo-beta-lactamase {Chryseobacter 1e-12
d1ycga2249 d.157.1.3 (A:2-250) Nitric oxide reductase N-terminal d 4e-10
d1vmea2250 d.157.1.3 (A:1-250) ROO-like flavoprotein TM0755, N-ter 1e-08
d2cfua2 505 d.157.1.13 (A:20-524) Alkylsulfatase SdsA1 {Pseudomonas 3e-08
d1p9ea_294 d.157.1.5 (A:) Methyl parathion hydrolase {Pseudomonas 1e-07
d1ztca1207 d.157.1.11 (A:1-207) Hypothetical protein TM0894 {Therm 5e-07
d2az4a1183 d.157.1.10 (A:56-238) Hypothetical protein EF2904 {Ente 4e-06
>d1xm8a_ d.157.1.2 (A:) Glyoxalase II (hydroxyacylglutathione hydrolase) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 254 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Metallo-hydrolase/oxidoreductase
superfamily: Metallo-hydrolase/oxidoreductase
family: Glyoxalase II (hydroxyacylglutathione hydrolase)
domain: Glyoxalase II (hydroxyacylglutathione hydrolase)
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

 Score =  105 bits (262), Expect = 3e-24
 Identities = 62/246 (25%), Positives = 94/246 (38%), Gaps = 60/246 (24%)

Query: 7   HIVQVTPFKQNCTFL-FDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHV 65
            I  V   K N  ++  DE++    VVDP  + + I D ++    ++  I  TH H DH 
Sbjct: 2   QIELVPCLKDNYAYILHDEDTGTVGVVDPS-EAEPIIDSLKRSGRNLTYILNTHHHYDHT 60

Query: 66  GGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGT 125
           GG  +LK+     +IG   D   + G                    D  L+DGD  +   
Sbjct: 61  GGNLELKDRYGAKVIGSAMDKDRIPGI-------------------DMALKDGDKWMFAG 101

Query: 126 HIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILP 185
           H   V   PGH+ GH+      +     GDT+F  S G+  +  G  +Q++ S+  KI  
Sbjct: 102 HEVHVMDTPGHTKGHISLYFPGSRAIFTGDTMFSLSCGK--LFEGTPKQMLASL-QKITS 158

Query: 186 LGDEISFVCGHGPN------------------------------------STIGRERRLN 209
           L D+ S  CGH                                       +T+  E+  N
Sbjct: 159 LPDDTSIYCGHEYTLSNSKFALSLEPNNEVLQSYAAHVAELRSKKLPTIPTTVKMEKACN 218

Query: 210 PFLKSN 215
           PFL+S+
Sbjct: 219 PFLRSS 224
>d2qeda1 d.157.1.2 (A:1-251) Glyoxalase II (hydroxyacylglutathione hydrolase) {Salmonella typhimurium [TaxId: 90371]} Length = 251 Back     information, alignment and structure
>d2gmna1 d.157.1.1 (A:29-292) Zn metallo-beta-lactamase {Bradyrhizobium japonicum [TaxId: 375]} Length = 264 Back     information, alignment and structure