254781223

254781223

intrrupted gp229, phage associated protein

GeneID in NCBI database:8210248Locus tag:CLIBASIA_05650
Protein GI in NCBI database:254781223Protein Accession:YP_003065636.1
Gene range:+(1222345, 1222677)Protein Length:110aa
Gene description:intrrupted gp229, phage associated protein
COG prediction:[M] Acyl-[acyl carrier protein]--UDP-N-acetylglucosamine O-acyltransferase
KEGG prediction:intrrupted GP229, phage associated protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110
MYDNAVVRDCATVIDDARVSGNASVSRFAQVKSNAEVSDNTYVRDNAKVGGYAKVSGNASVGGNAIVRDTAEVGGDAFVIGFTVISGNARVRGNAVVGGDTVVEGDTVLE
cccccEEEEEEEEEEcccccccEEEEEEEEEcccccccccEEEEEcccEEEEEEEcccEEEEcHHEEEHHHHccccEEEEEEEEEEcccEEEEEEEEcccEEEcccEEEc
cccccEEccccEEEcccEEEcccEEEcccEEEccEEEEccEEEEcccEEEEEEEEEccEEEEccEEEEcccEEEccEEEEccEEEEccEEEEEEEEEccccEEccccEcc
MYDNAVVRDCATVIDdarvsgnasVSRFAQVKsnaevsdntyvrdnakvggyakvsgnasvggnaivrdtaevggdAFVIGFTVISgnarvrgnavvggdtvvegdtvle
mydnavvrdcatviddarvsgnasvsrfaqvksnaevsdntyvrdNAKVGGYAKVSGNASVGGNAIVRDTAEVGGDAFVIGFTVisgnarvrgnavvggdtvvegdtvle
MYDNAVVRDCATVIDDARVSGNASVSRFAQVKSNAEVSDNTYVRDNAKVGGYAKVSGNASVGGNAIVRDTAEVGGDAFVIGFTVISGNARVRGNAvvggdtvvegdtvLE
MYDNAVVRDCATVIDDARVSGNASVSRFAQVKSNAEVSDNTYVRDNAKVGGYAKVSGNASVGGNAIVRDTAEVGGDAFVIGFTVISGNARVRGNAVVGGDTVVEGDTVL*
MYDNAVVRDCATVIDDARVSGNASVSRFAQVKSNAEVSDNTYVRDNAKVGGYAKVSGNASVGGNAIVRDTAEVGGDAFVIGFTVISGNARVRGNAVVGGDTVVEGDTVLE
MYDNAVVRDCATVIDDARVSGNASVSRFAQVKSNAEVSDNTYVRDNAKVGGYAKVSGNASVGGNAIVRDTAEVGGDAFVIGFTVISGNARVRGNAVVGGDTVVEGDTVL*
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYDNAVVRDCATVIDDARVSGNASVSRFAQVKSNAEVSDNTYVRDNAKVGGYAKVSGNASVGGNAIVRDTAEVGGDAFVIGFTVISGNARVRGNAVVGGDTVVEGDTVLE
MYDNAVVRDCATVIDDARVSGNASVSRFAQVKSNAEVSDNTYVRDNAKVGGYAKVSGNASVGGNAIVRDTAEVGGDAFVIGFTVISGNARVRGNAVVGGDTVVEGDTVLE
MYDNAVVRDCATVIDDARVSGNASVSRFAQVKSNAEVSDNTYVRDNAKVGGYAKVSGNASVGGNAIVRDTAEVGGDAFVIGFTVISGNARVRGNAVVGGDTVVEGDTVLE

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

Original result of BLAST against C. L. asiaticus genome

IdentityAlignment graphLength Definition E-value
Target110 intrrupted gp229, phage associated protein [Candidatus
255764481 271 UDP-N-acetylglucosamine acyltransferase [Candidatu 0.007
>gi|255764481|ref|YP_003065182.2| UDP-N-acetylglucosamine acyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 271 Back     alignment 
 Score = 30.8 bits (68), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 46/110 (41%), Gaps = 7/110 (6%)

Query: 1   MYDNAVVRDCATVIDDARVSGNASVSRFAQVKSNAEVS------DNTYVRDNAKVGGYAK 54
           M +N ++   A V + A +  N+ +  F  V S  E+        +  V    K+G + K
Sbjct: 4   MGNNPIIHPLALVEEGAVIGPNSLIGPFCCVGSEVEIGAGVELISHCVVAGKTKIGDFTK 63

Query: 55  VSGNASVGGNAIVRDTAEVGGDAFVIGFTVISGNARV-RGNAVVGGDTVV 103
           V   A +GG+   +    VG +  V    VI     + RG    GG T+V
Sbjct: 64  VFPMAVLGGDTQSKYHNFVGTELLVGKKCVIREGVTINRGTVEYGGKTIV 113

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

Original result of PSI-BLAST first 2 iterations

IdentityAlignment graphLength Definition Round E-value
Target110 intrrupted gp229, phage associated protein [Candidatus
317120687134 hypothetical protein SC1_gp150 [Liberibacter phage SC1] 1 2e-48
331090083235 hypothetical protein HMPREF1025_02555 [Lachnospiraceae 1 1e-11
331090083235 hypothetical protein HMPREF1025_02555 [Lachnospiraceae 1 2e-07
331090083 235 hypothetical protein HMPREF1025_02555 [Lachnospiraceae 1 3e-05
229828956274 hypothetical protein GCWU000342_01041 [Shuttleworthia s 1 3e-11
229828956274 hypothetical protein GCWU000342_01041 [Shuttleworthia s 1 1e-09
229828956274 hypothetical protein GCWU000342_01041 [Shuttleworthia s 1 2e-09
229828956 274 hypothetical protein GCWU000342_01041 [Shuttleworthia s 1 4e-09
229828956 274 hypothetical protein GCWU000342_01041 [Shuttleworthia s 1 9e-09
229828956 274 hypothetical protein GCWU000342_01041 [Shuttleworthia s 1 6e-08
>gi|317120687|gb|ADV02510.1| hypothetical protein SC1_gp150 [Liberibacter phage SC1] Length = 134 Back     alignment and organism information
 Score =  195 bits (495), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 110/134 (82%), Positives = 110/134 (82%), Gaps = 24/134 (17%)

Query: 1   MYDNAVVRDCATVIDDARVSGNASVSRFAQVKSNAEVSDNTYVRDNAK------------ 48
           MYDNAVVRDCATVIDDARVSGNASVSRFAQVKSNAEVSDNTYVRDNAK            
Sbjct: 1   MYDNAVVRDCATVIDDARVSGNASVSRFAQVKSNAEVSDNTYVRDNAKVGGYAKVSGNAS 60

Query: 49  ------------VGGYAKVSGNASVGGNAIVRDTAEVGGDAFVIGFTVISGNARVRGNAV 96
                       VGGYAKVSGNASVGGNAIVRDTAEVGGDAFVIGFTVISGNARVRGNAV
Sbjct: 61  VGGNAIVRDTAEVGGYAKVSGNASVGGNAIVRDTAEVGGDAFVIGFTVISGNARVRGNAV 120

Query: 97  VGGDTVVEGDTVLE 110
           VGGDTVVEGDTVLE
Sbjct: 121 VGGDTVVEGDTVLE 134



Species: Liberibacter phage SC1
Genus: 
Family: Podoviridae
Order: Caudovirales
Class: 
Phylum: 
Superkingdom: Viruses
>gi|331090083|ref|ZP_08338972.1| hypothetical protein HMPREF1025_02555 [Lachnospiraceae bacterium 3_1_46FAA] Length = 235 Back     alignment and organism information
>gi|331090083|ref|ZP_08338972.1| hypothetical protein HMPREF1025_02555 [Lachnospiraceae bacterium 3_1_46FAA] Length = 235 Back     alignment and organism information
>gi|331090083|ref|ZP_08338972.1| hypothetical protein HMPREF1025_02555 [Lachnospiraceae bacterium 3_1_46FAA] Length = 235 Back     alignment and organism information
>gi|229828956|ref|ZP_04455025.1| hypothetical protein GCWU000342_01041 [Shuttleworthia satelles DSM 14600] Length = 274 Back     alignment and organism information
>gi|229828956|ref|ZP_04455025.1| hypothetical protein GCWU000342_01041 [Shuttleworthia satelles DSM 14600] Length = 274 Back     alignment and organism information
>gi|229828956|ref|ZP_04455025.1| hypothetical protein GCWU000342_01041 [Shuttleworthia satelles DSM 14600] Length = 274 Back     alignment and organism information
>gi|229828956|ref|ZP_04455025.1| hypothetical protein GCWU000342_01041 [Shuttleworthia satelles DSM 14600] Length = 274 Back     alignment and organism information
>gi|229828956|ref|ZP_04455025.1| hypothetical protein GCWU000342_01041 [Shuttleworthia satelles DSM 14600] Length = 274 Back     alignment and organism information
>gi|229828956|ref|ZP_04455025.1| hypothetical protein GCWU000342_01041 [Shuttleworthia satelles DSM 14600] Length = 274 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

Original result of RPS-BLASTagainst CDD database part II

IdentityAlignment graphLength Definition E-value
Target110 intrrupted gp229, phage associated protein [Candidatus
COG2171271 COG2171, DapD, Tetrahydrodipicolinate N-succinyltransfe 0.002
COG4801 277 COG4801, COG4801, Predicted acyltransferase [General fu 0.004
PRK05293380 PRK05293, glgC, glucose-1-phosphate adenylyltransferase 0.004
COG1044 338 COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] 6e-05
>gnl|CDD|32354 COG2171, DapD, Tetrahydrodipicolinate N-succinyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|34410 COG4801, COG4801, Predicted acyltransferase [General function prediction only] Back     alignment and domain information
>gnl|CDD|179997 PRK05293, glgC, glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|31246 COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

Original result of HHsearch against CDD database

IdentityAlignment graphLength Definition Probability
Target 110 intrrupted gp229, phage associated protein [Candidatus
cd04745155 LbH_paaY_like paaY-like: This group is composed by unch 99.86
cd04645153 LbH_gamma_CA_like Gamma carbonic anhydrase-like: This f 99.85
cd00710167 LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbonic a 99.85
cd04646164 LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynactin is 99.84
cd04650154 LbH_FBP Ferripyochelin Binding Protein (FBP): FBP is an 99.83
TIGR03570201 NeuD_NnaD sugar O-acyltransferase, sialic acid O-acetyl 99.83
PRK13627196 carnitine operon protein CaiE; Provisional 99.83
TIGR01852 257 lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-acetylg 99.83
cd03360197 LbH_AT_putative Putative Acyltransferase (AT), Left-han 99.82
cd03351254 LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltransfe 99.8
cd03350139 LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-dicarb 99.79
COG0663176 PaaY Carbonic anhydrases/acetyltransferases, isoleucine 99.77
TIGR03532231 DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- 99.77
TIGR01852257 lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-acetylg 99.75
cd03359161 LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynactin is 99.7
cd03358119 LbH_WxcM_N_like WcxM-like, Left-handed parallel beta-He 99.69
TIGR03570201 NeuD_NnaD sugar O-acyltransferase, sialic acid O-acetyl 99.68
cd03360197 LbH_AT_putative Putative Acyltransferase (AT), Left-han 99.66
cd03352205 LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferase (Lp 99.65
cd03350139 LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-dicarb 99.63
cd03359161 LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynactin is 99.59
cd04645153 LbH_gamma_CA_like Gamma carbonic anhydrase-like: This f 99.58
TIGR02287193 PaaY phenylacetic acid degradation protein PaaY; InterP 99.58
cd04745155 LbH_paaY_like paaY-like: This group is composed by unch 99.54
cd04650154 LbH_FBP Ferripyochelin Binding Protein (FBP): FBP is an 99.5
TIGR03532231 DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- 99.48
COG1207460 GlmU N-acetylglucosamine-1-phosphate uridyltransferase 99.47
cd04646164 LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynactin is 99.46
PRK10502179 putative colanic acid biosynthesis acetyltransferase Wc 99.45
cd00710167 LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbonic a 99.43
COG2171271 DapD Tetrahydrodipicolinate N-succinyltransferase [Amin 99.43
cd04647109 LbH_MAT_like Maltose O-acyltransferase (MAT)-like: This 99.42
cd03358119 LbH_WxcM_N_like WcxM-like, Left-handed parallel beta-He 99.36
cd0020878 LbetaH Left-handed parallel beta-Helix (LbetaH or LbH) 99.35
cd03354101 LbH_SAT Serine acetyltransferase (SAT): SAT catalyzes t 99.34
PRK11830265 dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succi 99.34
COG0663176 PaaY Carbonic anhydrases/acetyltransferases, isoleucine 99.3
PRK09677192 putative lipopolysaccharide biosynthesis O-acetyl trans 99.3
cd03357169 LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and Galac 99.29
KOG1461 673 consensus 99.28
cd05825107 LbH_wcaF_like wcaF-like: This group is composed of the 99.28
PRK09527203 lacA galactoside O-acetyltransferase; Reviewed 99.21
KOG1461 673 consensus 99.19
PRK10092183 maltose O-acetyltransferase; Provisional 99.17
COG1208358 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylase inv 99.13
cd03349145 LbH_XAT Xenobiotic acyltransferase (XAT): The XAT class 99.12
cd0020878 LbetaH Left-handed parallel beta-Helix (LbetaH or LbH) 99.08
COG2171271 DapD Tetrahydrodipicolinate N-succinyltransferase [Amin 99.05
cd03354101 LbH_SAT Serine acetyltransferase (SAT): SAT catalyzes t 99.04
cd04647109 LbH_MAT_like Maltose O-acyltransferase (MAT)-like: This 99.03
TIGR03308204 phn_thr-fam phosphonate metabolim protein, transferase 99.01
cd05635101 LbH_unknown Uncharacterized proteins, Left-handed paral 98.97
cd0465281 LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal Left 98.95
PRK11830265 dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succi 98.93
TIGR02287193 PaaY phenylacetic acid degradation protein PaaY; InterP 98.92
PRK10502179 putative colanic acid biosynthesis acetyltransferase Wc 98.92
TIGR01172163 cysE serine O-acetyltransferase; InterPro: IPR005881 Th 98.91
PRK10092183 maltose O-acetyltransferase; Provisional 98.91
TIGR00965275 dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-suc 98.9
COG1208358 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylase inv 98.89
COG0110190 WbbJ Acetyltransferase (isoleucine patch superfamily) [ 98.84
cd05825107 LbH_wcaF_like wcaF-like: This group is composed of the 98.8
PRK10191146 putative colanic acid biosynthesis acetyltransferase Wc 98.71
COG1045194 CysE Serine acetyltransferase [Amino acid transport and 98.65
TIGR01172163 cysE serine O-acetyltransferase; InterPro: IPR005881 Th 98.63
cd04649147 LbH_THP_succinylT_putative Putative 2,3,4,5-tetrahydrop 98.6
KOG1322371 consensus 98.49
KOG3121184 consensus 98.47
TIGR00965275 dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-suc 98.45
PRK10191146 putative colanic acid biosynthesis acetyltransferase Wc 98.42
KOG1462433 consensus 98.33
KOG4750269 consensus 98.29
PRK11132273 cysE serine acetyltransferase; Provisional 98.22
KOG3121184 consensus 98.05
COG4801 277 Predicted acyltransferase [General function prediction 97.99
TIGR01208361 rmlA_long glucose-1-phosphate thymidylyltransferase; In 97.96
TIGR02091421 glgC glucose-1-phosphate adenylyltransferase; InterPro: 97.77
COG4801 277 Predicted acyltransferase [General function prediction 97.68
KOG4750269 consensus 97.18
TIGR03536341 DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N 96.87
TIGR03535319 DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarboxylat 96.63
TIGR01853 336 lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N 99.85
PRK00892 343 lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltra 99.84
cd03351 254 LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltransfe 99.81
PRK05289 261 UDP-N-acetylglucosamine acyltransferase; Provisional 99.81
PRK12461 256 UDP-N-acetylglucosamine acyltransferase; Provisional 99.81
cd03352205 LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferase (Lp 99.81
PRK05289 261 UDP-N-acetylglucosamine acyltransferase; Provisional 99.8
PRK12461 256 UDP-N-acetylglucosamine acyltransferase; Provisional 99.8
PRK00892 343 lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltra 99.8
COG1044 338 LpxD UDP-3-O-[3-hydroxymyristoyl] 99.78
COG1044338 LpxD UDP-3-O-[3-hydroxymyristoyl] 99.74
cd05636163 LbH_G1P_TT_C_like Putative glucose-1-phosphate thymidyl 99.73
cd05636163 LbH_G1P_TT_C_like Putative glucose-1-phosphate thymidyl 99.69
cd03353193 LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyltrans 99.66
cd03353193 LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyltrans 99.65
PRK09451456 glmU bifunctional N-acetylglucosamine-1-phosphate uridy 99.59
TIGR01173461 glmU UDP-N-acetylglucosamine pyrophosphorylase; InterPr 99.54
cd0582480 LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltransfe 99.25
COG1207460 GlmU N-acetylglucosamine-1-phosphate uridyltransferase 99.23
cd0578779 LbH_eIF2B_epsilon eIF-2B epsilon subunit, central Left- 99.08
cd0335679 LbH_G1P_AT_C_like Left-handed parallel beta-Helix (LbH) 98.95
PRK02862429 glgC glucose-1-phosphate adenylyltransferase; Provision 98.56
cd04649147 LbH_THP_succinylT_putative Putative 2,3,4,5-tetrahydrop 98.08
KOG1322371 consensus 97.95
KOG4042190 consensus 97.93
TIGR01208361 rmlA_long glucose-1-phosphate thymidylyltransferase; In 97.36
TIGR01173461 glmU UDP-N-acetylglucosamine pyrophosphorylase; InterPr 99.71
PRK09451456 glmU bifunctional N-acetylglucosamine-1-phosphate uridy 99.69
COG1043 260 LpxA Acyl-[acyl carrier protein] 99.64
TIGR03308204 phn_thr-fam phosphonate metabolim protein, transferase 99.54
PRK05293381 glgC glucose-1-phosphate adenylyltransferase; Provision 99.05
cd05635101 LbH_unknown Uncharacterized proteins, Left-handed paral 99.0
COG1045194 CysE Serine acetyltransferase [Amino acid transport and 98.89
PRK09677192 putative lipopolysaccharide biosynthesis O-acetyl trans 98.85
cd03357169 LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and Galac 98.72
PRK11132273 cysE serine acetyltransferase; Provisional 98.59
PRK02862429 glgC glucose-1-phosphate adenylyltransferase; Provision 98.49
cd03349145 LbH_XAT Xenobiotic acyltransferase (XAT): The XAT class 98.41
PRK03282406 consensus 98.38
PRK00844409 glgC glucose-1-phosphate adenylyltransferase; Provision 98.33
cd04651104 LbH_G1P_AT_C Glucose-1-phosphate adenylyltransferase, C 98.29
PRK00844409 glgC glucose-1-phosphate adenylyltransferase; Provision 98.16
PRK04928405 consensus 98.11
PRK03282406 consensus 98.09
COG0110190 WbbJ Acetyltransferase (isoleucine patch superfamily) [ 98.03
COG0448393 GlgC ADP-glucose pyrophosphorylase [Carbohydrate transp 98.03
PRK01884435 consensus 98.03
PRK03701431 consensus 97.95
PRK00725431 glgC glucose-1-phosphate adenylyltransferase; Provision 97.88
PRK01884435 consensus 97.83
KOG1462433 consensus 97.79
PRK03701431 consensus 97.74
TIGR02353 719 NRPS_term_dom non-ribosomal peptide synthetase terminal 97.6
COG0448393 GlgC ADP-glucose pyrophosphorylase [Carbohydrate transp 97.54
TIGR02091421 glgC glucose-1-phosphate adenylyltransferase; InterPro: 97.44
PRK00725431 glgC glucose-1-phosphate adenylyltransferase; Provision 97.38
TIGR02353719 NRPS_term_dom non-ribosomal peptide synthetase terminal 97.34
TIGR02092383 glgD glucose-1-phosphate adenylyltransferase, GlgD subu 96.81
TIGR02092383 glgD glucose-1-phosphate adenylyltransferase, GlgD subu 96.57
COG1043 260 LpxA Acyl-[acyl carrier protein] 99.5
PRK13627196 carnitine operon protein CaiE; Provisional 99.32
cd0582480 LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltransfe 99.3
cd0578779 LbH_eIF2B_epsilon eIF-2B epsilon subunit, central Left- 99.18
cd0335679 LbH_G1P_AT_C_like Left-handed parallel beta-Helix (LbH) 99.02
cd0465281 LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal Left 98.97
PRK09527203 lacA galactoside O-acetyltransferase; Reviewed 98.7
cd04651104 LbH_G1P_AT_C Glucose-1-phosphate adenylyltransferase, C 98.3
KOG1460407 consensus 98.27
KOG1460407 consensus 98.23
KOG4042190 consensus 97.53
PRK05293381 glgC glucose-1-phosphate adenylyltransferase; Provision 99.08
>cd04745 LbH_paaY_like paaY-like: This group is composed by uncharacterized proteins with similarity to the protein product of the E Back     alignment and domain information
>cd04645 LbH_gamma_CA_like Gamma carbonic anhydrase-like: This family is composed of gamma carbonic anhydrase (CA), Ferripyochelin Binding Protein (FBP), E Back     alignment and domain information
>cd00710 LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbonic anhydrases are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism, involving the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide, followed by the regeneration of the active site by ionization of the zinc-bound water molecule and removal of a proton from the active site Back     alignment and domain information
>cd04646 LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport Back     alignment and domain information
>cd04650 LbH_FBP Ferripyochelin Binding Protein (FBP): FBP is an outer membrane protein which plays a role in iron acquisition Back     alignment and domain information
>TIGR03570 NeuD_NnaD sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family Back     alignment and domain information
>PRK13627 carnitine operon protein CaiE; Provisional Back     alignment and domain information
>TIGR01852 lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase; InterPro: IPR010137 This entry describes LpxA, an enzyme for the biosynthesis of lipid A, a component of lipopolysaccharide (LPS) in the outer membrane outer leaflet of most Gram-negative bacteria Back     alignment and domain information
>cd03360 LbH_AT_putative Putative Acyltransferase (AT), Left-handed parallel beta-Helix (LbH) domain; This group is composed of mostly uncharacterized proteins containing an N-terminal helical subdomain followed by a LbH domain Back     alignment and domain information
>cd03351 LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltransferase (UDP-GlcNAc acyltransferase): Proteins in this family catalyze the transfer of (R)-3-hydroxymyristic acid from its acyl carrier protein thioester to UDP-GlcNAc Back     alignment and domain information
>cd03350 LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (also called THP succinyltransferase): THDP N-succinyltransferase catalyzes the conversion of tetrahydrodipicolinate and succinyl-CoA to N-succinyltetrahydrodipicolinate and CoA Back     alignment and domain information
>COG0663 PaaY Carbonic anhydrases/acetyltransferases, isoleucine patch superfamily [General function prediction only] Back     alignment and domain information
>TIGR03532 DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase Back     alignment and domain information
>TIGR01852 lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase; InterPro: IPR010137 This entry describes LpxA, an enzyme for the biosynthesis of lipid A, a component of lipopolysaccharide (LPS) in the outer membrane outer leaflet of most Gram-negative bacteria Back     alignment and domain information
>cd03359 LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport Back     alignment and domain information
>cd03358 LbH_WxcM_N_like WcxM-like, Left-handed parallel beta-Helix (LbH) N-terminal domain: This group is composed of Xanthomonas campestris WcxM and proteins with similarity to the WcxM N-terminal domain Back     alignment and domain information
>TIGR03570 NeuD_NnaD sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family Back     alignment and domain information
>cd03360 LbH_AT_putative Putative Acyltransferase (AT), Left-handed parallel beta-Helix (LbH) domain; This group is composed of mostly uncharacterized proteins containing an N-terminal helical subdomain followed by a LbH domain Back     alignment and domain information
>cd03352 LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc Back     alignment and domain information
>cd03350 LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (also called THP succinyltransferase): THDP N-succinyltransferase catalyzes the conversion of tetrahydrodipicolinate and succinyl-CoA to N-succinyltetrahydrodipicolinate and CoA Back     alignment and domain information
>cd03359 LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport Back     alignment and domain information
>cd04645 LbH_gamma_CA_like Gamma carbonic anhydrase-like: This family is composed of gamma carbonic anhydrase (CA), Ferripyochelin Binding Protein (FBP), E Back     alignment and domain information
>TIGR02287 PaaY phenylacetic acid degradation protein PaaY; InterPro: IPR011974 Members of this family are located next to other genes organised into apparent operons for phenylacetic acid degradation Back     alignment and domain information
>cd04745 LbH_paaY_like paaY-like: This group is composed by uncharacterized proteins with similarity to the protein product of the E Back     alignment and domain information
>cd04650 LbH_FBP Ferripyochelin Binding Protein (FBP): FBP is an outer membrane protein which plays a role in iron acquisition Back     alignment and domain information
>TIGR03532 DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase Back     alignment and domain information
>COG1207 GlmU N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd04646 LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport Back     alignment and domain information
>PRK10502 putative colanic acid biosynthesis acetyltransferase WcaF; Provisional Back     alignment and domain information
>cd00710 LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbonic anhydrases are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism, involving the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide, followed by the regeneration of the active site by ionization of the zinc-bound water molecule and removal of a proton from the active site Back     alignment and domain information
>COG2171 DapD Tetrahydrodipicolinate N-succinyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>cd04647 LbH_MAT_like Maltose O-acyltransferase (MAT)-like: This family is composed of maltose O-acetyltransferase, galactoside O-acetyltransferase (GAT), xenobiotic acyltransferase (XAT) and similar proteins Back     alignment and domain information
>cd03358 LbH_WxcM_N_like WcxM-like, Left-handed parallel beta-Helix (LbH) N-terminal domain: This group is composed of Xanthomonas campestris WcxM and proteins with similarity to the WcxM N-terminal domain Back     alignment and domain information
>cd00208 LbetaH Left-handed parallel beta-Helix (LbetaH or LbH) domain: The alignment contains 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) Back     alignment and domain information
>cd03354 LbH_SAT Serine acetyltransferase (SAT): SAT catalyzes the CoA-dependent acetylation of the side chain hydroxyl group of L-serine to form O-acetylserine, as the first step of a two-step biosynthetic pathway in bacteria and plants leading to the formation of L-cysteine Back     alignment and domain information
>PRK11830 dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase; Provisional Back     alignment and domain information
>COG0663 PaaY Carbonic anhydrases/acetyltransferases, isoleucine patch superfamily [General function prediction only] Back     alignment and domain information
>PRK09677 putative lipopolysaccharide biosynthesis O-acetyl transferase WbbJ; Provisional Back     alignment and domain information
>cd03357 LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates Back     alignment and domain information
>KOG1461 consensus Back     alignment and domain information
>cd05825 LbH_wcaF_like wcaF-like: This group is composed of the protein product of the E Back     alignment and domain information
>PRK09527 lacA galactoside O-acetyltransferase; Reviewed Back     alignment and domain information
>KOG1461 consensus Back     alignment and domain information
>PRK10092 maltose O-acetyltransferase; Provisional Back     alignment and domain information
>COG1208 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd03349 LbH_XAT Xenobiotic acyltransferase (XAT): The XAT class of hexapeptide acyltransferases is composed of a large number of microbial enzymes that catalyze the CoA-dependent acetylation of a variety of hydroxyl-bearing acceptors such as chloramphenicol and streptogramin, among others Back     alignment and domain information
>cd00208 LbetaH Left-handed parallel beta-Helix (LbetaH or LbH) domain: The alignment contains 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) Back     alignment and domain information
>COG2171 DapD Tetrahydrodipicolinate N-succinyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>cd03354 LbH_SAT Serine acetyltransferase (SAT): SAT catalyzes the CoA-dependent acetylation of the side chain hydroxyl group of L-serine to form O-acetylserine, as the first step of a two-step biosynthetic pathway in bacteria and plants leading to the formation of L-cysteine Back     alignment and domain information
>cd04647 LbH_MAT_like Maltose O-acyltransferase (MAT)-like: This family is composed of maltose O-acetyltransferase, galactoside O-acetyltransferase (GAT), xenobiotic acyltransferase (XAT) and similar proteins Back     alignment and domain information
>TIGR03308 phn_thr-fam phosphonate metabolim protein, transferase hexapeptide repeat family Back     alignment and domain information
>cd05635 LbH_unknown Uncharacterized proteins, Left-handed parallel beta-Helix (LbH) domain: Members in this group are uncharacterized bacterial proteins containing a LbH domain with multiple turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) Back     alignment and domain information
>cd04652 LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) Back     alignment and domain information
>PRK11830 dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase; Provisional Back     alignment and domain information
>TIGR02287 PaaY phenylacetic acid degradation protein PaaY; InterPro: IPR011974 Members of this family are located next to other genes organised into apparent operons for phenylacetic acid degradation Back     alignment and domain information
>PRK10502 putative colanic acid biosynthesis acetyltransferase WcaF; Provisional Back     alignment and domain information
>TIGR01172 cysE serine O-acetyltransferase; InterPro: IPR005881 The biosynthesis of L-cysteine is the predominant way by which inorganic sulphur is incorporated into organic compounds Back     alignment and domain information
>PRK10092 maltose O-acetyltransferase; Provisional Back     alignment and domain information
>TIGR00965 dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase; InterPro: IPR005664 Bacteria, plants and fungi metabolise aspartic acid to produce four amino acids - lysine, threonine, methionine and isoleucine - in a series of reactions known as the aspartate pathway Back     alignment and domain information
>COG1208 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0110 WbbJ Acetyltransferase (isoleucine patch superfamily) [General function prediction only] Back     alignment and domain information
>cd05825 LbH_wcaF_like wcaF-like: This group is composed of the protein product of the E Back     alignment and domain information
>PRK10191 putative colanic acid biosynthesis acetyltransferase WcaB; Provisional Back     alignment and domain information
>COG1045 CysE Serine acetyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01172 cysE serine O-acetyltransferase; InterPro: IPR005881 The biosynthesis of L-cysteine is the predominant way by which inorganic sulphur is incorporated into organic compounds Back     alignment and domain information
>cd04649 LbH_THP_succinylT_putative Putative 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (THP succinyltransferase), C-terminal left-handed parallel alpha-helix (LbH) domain: This group is composed of mostly uncharacterized proteins containing an N-terminal domain of unknown function and a C-terminal LbH domain with similarity to THP succinyltransferase LbH Back     alignment and domain information
>KOG1322 consensus Back     alignment and domain information
>KOG3121 consensus Back     alignment and domain information
>TIGR00965 dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase; InterPro: IPR005664 Bacteria, plants and fungi metabolise aspartic acid to produce four amino acids - lysine, threonine, methionine and isoleucine - in a series of reactions known as the aspartate pathway Back     alignment and domain information
>PRK10191 putative colanic acid biosynthesis acetyltransferase WcaB; Provisional Back     alignment and domain information
>KOG1462 consensus Back     alignment and domain information
>KOG4750 consensus Back     alignment and domain information
>PRK11132 cysE serine acetyltransferase; Provisional Back     alignment and domain information
>KOG3121 consensus Back     alignment and domain information
>COG4801 Predicted acyltransferase [General function prediction only] Back     alignment and domain information
>TIGR01208 rmlA_long glucose-1-phosphate thymidylyltransferase; InterPro: IPR005908 Synonym: dTDP-D-glucose synthase This group of proteins comprises a tightly conserved but broadly distributed subfamily of known and putative bacterial glucose-1-phosphate thymidylyltransferases (2 Back     alignment and domain information
>TIGR02091 glgC glucose-1-phosphate adenylyltransferase; InterPro: IPR011831 This enzyme, glucose-1-phosphate adenylyltransferase, is also called ADP-glucose pyrophosphorylase Back     alignment and domain information
>COG4801 Predicted acyltransferase [General function prediction only] Back     alignment and domain information
>KOG4750 consensus Back     alignment and domain information
>TIGR03536 DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase Back     alignment and domain information
>TIGR03535 DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase Back     alignment and domain information
>TIGR01853 lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; InterPro: IPR007691 UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase (2 Back     alignment and domain information
>PRK00892 lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; Provisional Back     alignment and domain information
>cd03351 LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltransferase (UDP-GlcNAc acyltransferase): Proteins in this family catalyze the transfer of (R)-3-hydroxymyristic acid from its acyl carrier protein thioester to UDP-GlcNAc Back     alignment and domain information
>PRK05289 UDP-N-acetylglucosamine acyltransferase; Provisional Back     alignment and domain information
>PRK12461 UDP-N-acetylglucosamine acyltransferase; Provisional Back     alignment and domain information
>cd03352 LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc Back     alignment and domain information
>PRK05289 UDP-N-acetylglucosamine acyltransferase; Provisional Back     alignment and domain information
>PRK12461 UDP-N-acetylglucosamine acyltransferase; Provisional Back     alignment and domain information
>PRK00892 lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; Provisional Back     alignment and domain information
>COG1044 LpxD UDP-3-O-[3-hydroxymyristoyl] Back     alignment and domain information
>COG1044 LpxD UDP-3-O-[3-hydroxymyristoyl] Back     alignment and domain information
>cd05636 LbH_G1P_TT_C_like Putative glucose-1-phosphate thymidylyltransferase, C-terminal Left-handed parallel beta-Helix (LbH) domain: Proteins in this family show simlarity to glucose-1-phosphate adenylyltransferases in that they contain N-terminal catalytic domains that resemble a dinucleotide-binding Rossmann fold and C-terminal LbH fold domains Back     alignment and domain information
>cd05636 LbH_G1P_TT_C_like Putative glucose-1-phosphate thymidylyltransferase, C-terminal Left-handed parallel beta-Helix (LbH) domain: Proteins in this family show simlarity to glucose-1-phosphate adenylyltransferases in that they contain N-terminal catalytic domains that resemble a dinucleotide-binding Rossmann fold and C-terminal LbH fold domains Back     alignment and domain information
>cd03353 LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyltransferase (GlmU), C-terminal left-handed beta-helix (LbH) acetyltransferase domain: GlmU is also known as UDP-N-acetylglucosamine pyrophosphorylase Back     alignment and domain information
>cd03353 LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyltransferase (GlmU), C-terminal left-handed beta-helix (LbH) acetyltransferase domain: GlmU is also known as UDP-N-acetylglucosamine pyrophosphorylase Back     alignment and domain information
>PRK09451 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>TIGR01173 glmU UDP-N-acetylglucosamine pyrophosphorylase; InterPro: IPR005882 N-Acetylglucosamine-1-PO(4) uridyltransferase (GlmU, 2 Back     alignment and domain information
>cd05824 LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Mannose-1-phosphate guanylyltransferase is also known as GDP-mannose pyrophosphorylase Back     alignment and domain information
>COG1207 GlmU N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd05787 LbH_eIF2B_epsilon eIF-2B epsilon subunit, central Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) Back     alignment and domain information
>cd03356 LbH_G1P_AT_C_like Left-handed parallel beta-Helix (LbH) domain of a group of proteins with similarity to glucose-1-phosphate adenylyltransferase: Included in this family are glucose-1-phosphate adenylyltransferase, mannose-1-phosphate guanylyltransferase, and the eukaryotic translation initiation factor eIF-2B subunits, epsilon and gamma Back     alignment and domain information
>PRK02862 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>cd04649 LbH_THP_succinylT_putative Putative 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (THP succinyltransferase), C-terminal left-handed parallel alpha-helix (LbH) domain: This group is composed of mostly uncharacterized proteins containing an N-terminal domain of unknown function and a C-terminal LbH domain with similarity to THP succinyltransferase LbH Back     alignment and domain information
>KOG1322 consensus Back     alignment and domain information
>KOG4042 consensus Back     alignment and domain information
>TIGR01208 rmlA_long glucose-1-phosphate thymidylyltransferase; InterPro: IPR005908 Synonym: dTDP-D-glucose synthase This group of proteins comprises a tightly conserved but broadly distributed subfamily of known and putative bacterial glucose-1-phosphate thymidylyltransferases (2 Back     alignment and domain information
>TIGR01173 glmU UDP-N-acetylglucosamine pyrophosphorylase; InterPro: IPR005882 N-Acetylglucosamine-1-PO(4) uridyltransferase (GlmU, 2 Back     alignment and domain information
>PRK09451 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>COG1043 LpxA Acyl-[acyl carrier protein] Back     alignment and domain information
>TIGR03308 phn_thr-fam phosphonate metabolim protein, transferase hexapeptide repeat family Back     alignment and domain information
>PRK05293 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>cd05635 LbH_unknown Uncharacterized proteins, Left-handed parallel beta-Helix (LbH) domain: Members in this group are uncharacterized bacterial proteins containing a LbH domain with multiple turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) Back     alignment and domain information
>COG1045 CysE Serine acetyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09677 putative lipopolysaccharide biosynthesis O-acetyl transferase WbbJ; Provisional Back     alignment and domain information
>cd03357 LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates Back     alignment and domain information
>PRK11132 cysE serine acetyltransferase; Provisional Back     alignment and domain information
>PRK02862 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>cd03349 LbH_XAT Xenobiotic acyltransferase (XAT): The XAT class of hexapeptide acyltransferases is composed of a large number of microbial enzymes that catalyze the CoA-dependent acetylation of a variety of hydroxyl-bearing acceptors such as chloramphenicol and streptogramin, among others Back     alignment and domain information
>PRK03282 consensus Back     alignment and domain information
>PRK00844 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>cd04651 LbH_G1P_AT_C Glucose-1-phosphate adenylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Glucose-1-phosphate adenylyltransferase is also known as ADP-glucose synthase or ADP-glucose pyrophosphorylase Back     alignment and domain information
>PRK00844 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>PRK04928 consensus Back     alignment and domain information
>PRK03282 consensus Back     alignment and domain information
>COG0110 WbbJ Acetyltransferase (isoleucine patch superfamily) [General function prediction only] Back     alignment and domain information
>COG0448 GlgC ADP-glucose pyrophosphorylase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK01884 consensus Back     alignment and domain information
>PRK03701 consensus Back     alignment and domain information
>PRK00725 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>PRK01884 consensus Back     alignment and domain information
>KOG1462 consensus Back     alignment and domain information
>PRK03701 consensus Back     alignment and domain information
>TIGR02353 NRPS_term_dom non-ribosomal peptide synthetase terminal domain of unknown function; InterPro: IPR012728 This domain is found exclusively in non-ribosomal peptide synthetases and always as the final domain in the polypeptide Back     alignment and domain information
>COG0448 GlgC ADP-glucose pyrophosphorylase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02091 glgC glucose-1-phosphate adenylyltransferase; InterPro: IPR011831 This enzyme, glucose-1-phosphate adenylyltransferase, is also called ADP-glucose pyrophosphorylase Back     alignment and domain information
>PRK00725 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>TIGR02353 NRPS_term_dom non-ribosomal peptide synthetase terminal domain of unknown function; InterPro: IPR012728 This domain is found exclusively in non-ribosomal peptide synthetases and always as the final domain in the polypeptide Back     alignment and domain information
>TIGR02092 glgD glucose-1-phosphate adenylyltransferase, GlgD subunit; InterPro: IPR011832 This family is GlgD, an apparent regulatory protein that appears in an alpha2/beta2 heterotetramer with GlgC (glucose-1-phosphate adenylyltransferase, IPR011831 from INTERPRO) in a subset of bacteria that use GlgC for glycogen biosynthesis Back     alignment and domain information
>TIGR02092 glgD glucose-1-phosphate adenylyltransferase, GlgD subunit; InterPro: IPR011832 This family is GlgD, an apparent regulatory protein that appears in an alpha2/beta2 heterotetramer with GlgC (glucose-1-phosphate adenylyltransferase, IPR011831 from INTERPRO) in a subset of bacteria that use GlgC for glycogen biosynthesis Back     alignment and domain information
>COG1043 LpxA Acyl-[acyl carrier protein] Back     alignment and domain information
>PRK13627 carnitine operon protein CaiE; Provisional Back     alignment and domain information
>cd05824 LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Mannose-1-phosphate guanylyltransferase is also known as GDP-mannose pyrophosphorylase Back     alignment and domain information
>cd05787 LbH_eIF2B_epsilon eIF-2B epsilon subunit, central Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) Back     alignment and domain information
>cd03356 LbH_G1P_AT_C_like Left-handed parallel beta-Helix (LbH) domain of a group of proteins with similarity to glucose-1-phosphate adenylyltransferase: Included in this family are glucose-1-phosphate adenylyltransferase, mannose-1-phosphate guanylyltransferase, and the eukaryotic translation initiation factor eIF-2B subunits, epsilon and gamma Back     alignment and domain information
>cd04652 LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) Back     alignment and domain information
>PRK09527 lacA galactoside O-acetyltransferase; Reviewed Back     alignment and domain information
>cd04651 LbH_G1P_AT_C Glucose-1-phosphate adenylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Glucose-1-phosphate adenylyltransferase is also known as ADP-glucose synthase or ADP-glucose pyrophosphorylase Back     alignment and domain information
>KOG1460 consensus Back     alignment and domain information
>KOG1460 consensus Back     alignment and domain information
>KOG4042 consensus Back     alignment and domain information
>PRK05293 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

Original result of PSI-BLAST

IdentityAlignment graphLength Definition E-value
Target110 intrrupted gp229, phage associated protein [Candidatus
1v3w_A173 Structure Of Ferripyochelin Binding Protein From Py 4e-04
1xhd_A173 X-Ray Crystal Structure Of Putative Acetyltransfera 0.001
gi|39655008|pdb|1V3W|A Chain A, Structure Of Ferripyochelin Binding Protein From Pyrococcus Horikoshii Ot3 Length = 173 Back     alignment and structure 
 Score = 48.1 bits (112), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 18/109 (16%), Positives = 39/109 (35%)

Query: 1   MYDNAVVRDCATVIDDARVSGNASVSRFAQVKSNAEVSDNTYVRDNAKVGGYAKVSGNAS 60
           ++ +A V + A VI D  +    SV   A ++ + E        +           G  +
Sbjct: 13  IHPSAFVDENAVVIGDVVLEEKTSVWPSAVLRGDIEQIYVGKYSNVQDNVSIHTSHGYPT 72

Query: 61  VGGNAIVRDTAEVGGDAFVIGFTVISGNARVRGNAVVGGDTVVEGDTVL 109
             G  +      +   A V  + +I  ++ +   A +G   ++    V+
Sbjct: 73  EIGEYVTIGHNAMVHGAKVGNYVIIGISSVILDGAKIGDHVIIGAGAVV 121
>gi|56554528|pdb|1XHD|A Chain A, X-Ray Crystal Structure Of Putative Acetyltransferase, Product Of Bc4754 Gene [bacillus Cereus] Length = 173 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

IdentityAlignment graphLength Definition E-value
Target110 intrrupted gp229, phage associated protein [Candidatus
2pig_A334 Putative transferase; SCR6, NESG, YDCK, structural geno 4e-09
2pig_A334 Putative transferase; SCR6, NESG, YDCK, structural geno 2e-07
2pig_A 334 Putative transferase; SCR6, NESG, YDCK, structural geno 5e-06
2pig_A 334 Putative transferase; SCR6, NESG, YDCK, structural geno 1e-05
2pig_A334 Putative transferase; SCR6, NESG, YDCK, structural geno 3e-05
3fs8_A 273 QDTC; acetyltransferase, natural product, deoxysugar; H 0.003
1yp2_A451 Glucose-1-phosphate adenylyltransferase small subunit; 0.001
3c8v_A 496 Putative acetyltransferase; YP_390128.1, structural gen 0.001
3gos_A276 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succiny 0.001
1hv9_A456 UDP-N-acetylglucosamine pyrophosphorylase; LEFT-handed 0.004
2v0h_A456 Bifunctional protein GLMU; cell WALL, magnesium, cell s 0.004
2pig_A334 Putative transferase; SCR6, NESG, YDCK, structural geno 1e-04
3fs8_A 273 QDTC; acetyltransferase, natural product, deoxysugar; H 5e-04
3hsq_A 259 Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O 0.001
1j2z_A 270 Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O 0.003
>2pig_A Putative transferase; SCR6, NESG, YDCK, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.38A {Salmonella paratyphi} PDB: 2f9c_A Length = 334 Back     alignment and structure
 Score = 54.9 bits (131), Expect = 4e-09
 Identities = 20/110 (18%), Positives = 43/110 (39%), Gaps = 3/110 (2%)

Query: 1   MYDNAVVRDCATVIDDARVSGNASVSRFAQVKSNAEVSDNTYVRDNAKV-GGYAKVSGNA 59
           +          T+   ++V+ +A +     +K +  V  +  VR    +      + G+A
Sbjct: 216 VIAGTEEDAIPTLRYSSQVAEHALIEGNCVLKHHVLVGGHAEVRGGPILLDDRVLIEGHA 275

Query: 60  SVGGNAIVRDTAEVGGDAFVIGFTVISGNARVRGNAVVGGDTVVEGDTVL 109
            + G  ++    E+ G A VI F        +RG  V+ G+  +    ++
Sbjct: 276 CIQGEILIERQVEISGRAAVIAFD--DNTIHLRGPKVINGEDRITRTPLV 323
>2pig_A Putative transferase; SCR6, NESG, YDCK, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.38A {Salmonella paratyphi} PDB: 2f9c_A Length = 334 Back     alignment and structure
>2pig_A Putative transferase; SCR6, NESG, YDCK, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.38A {Salmonella paratyphi} PDB: 2f9c_A Length = 334 Back     alignment and structure
>2pig_A Putative transferase; SCR6, NESG, YDCK, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.38A {Salmonella paratyphi} PDB: 2f9c_A Length = 334 Back     alignment and structure
>2pig_A Putative transferase; SCR6, NESG, YDCK, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.38A {Salmonella paratyphi} PDB: 2f9c_A Length = 334 Back     alignment and structure
>3fs8_A QDTC; acetyltransferase, natural product, deoxysugar; HET: ACO; 1.70A {Thermoanaerobacteriumthermosaccharolyticum} PDB: 3fsb_A* 3fsc_A* Length = 273 Back     alignment and structure
>1yp2_A Glucose-1-phosphate adenylyltransferase small subunit; ADP-glucose synthase, ADP-glucose pyrophosphorylase, agpase B; HET: PMB; 2.11A {Solanum tuberosum} SCOP: b.81.1.4 c.68.1.6 PDB: 1yp3_A* 1yp4_A* Length = 451 Back     alignment and structure
>3c8v_A Putative acetyltransferase; YP_390128.1, structural genomics, joint center for structural genomics, JCSG; 2.28A {Desulfovibrio desulfuricans subsp} Length = 496 Back     alignment and structure
>3gos_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; 2,3,4,5-tetrahydropyridine-2-carboxylate N- succinyltransferase; 1.80A {Yersinia pestis} PDB: 1kgq_A* 1kgt_A* 2tdt_A* 3tdt_A* 3bxy_A 1tdt_A Length = 276 Back     alignment and structure
>1hv9_A UDP-N-acetylglucosamine pyrophosphorylase; LEFT-handed parallel beta-helix, transferase; HET: COA UD1; 2.10A {Escherichia coli} SCOP: b.81.1.4 c.68.1.5 PDB: 2oi5_A* 2oi6_A* 2oi7_A* 3fww_A 1fxj_A* 1fwy_A* Length = 456 Back     alignment and structure
>2v0h_A Bifunctional protein GLMU; cell WALL, magnesium, cell shape, transferase, peptidoglycan synthesis, associative mechanism; 1.79A {Haemophilus influenzae} PDB: 2v0i_A* 2v0j_A* 2v0k_A* 2v0l_A* 2vd4_A* Length = 456 Back     alignment and structure
>2pig_A Putative transferase; SCR6, NESG, YDCK, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.38A {Salmonella paratyphi} PDB: 2f9c_A Length = 334 Back     alignment and structure
>3fs8_A QDTC; acetyltransferase, natural product, deoxysugar; HET: ACO; 1.70A {Thermoanaerobacteriumthermosaccharolyticum} PDB: 3fsb_A* 3fsc_A* Length = 273 Back     alignment and structure
>3hsq_A Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O-acyltransferase; L.interrogans LPXA, LPXA, LPXA acyltransferase; 2.10A {Leptospira interrogans} PDB: 3i3a_A* 3i3x_A* Length = 259 Back     alignment and structure
>1j2z_A Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O-acyltransferase; UDP-N-acetylglucosamine acyltransferase, LPXA; HET: SOG TLA; 2.10A {Helicobacter pylori} SCOP: b.81.1.1 Length = 270 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

Original result of HHsearch against PDB70 database

IdentityAlignment graphLength Definition Probability
Target110 intrrupted gp229, phage associated protein [Candidatus
2qia_A 262 UDP-N-acetylglucosamine acyltransferase; LEFT-handed pa 99.82
1j2z_A 270 Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O 99.79
2qia_A 262 UDP-N-acetylglucosamine acyltransferase; LEFT-handed pa 99.77
2iu8_A 374 LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr 99.77
3eh0_A 341 UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltransfe 99.77
3hsq_A 259 Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O 99.76
3hsq_A 259 Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O 99.75
3eh0_A 341 UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltransfe 99.75
3fs8_A 273 QDTC; acetyltransferase, natural product, deoxysugar; H 99.74
2iu8_A 374 LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr 99.67
2pig_A 334 Putative transferase; SCR6, NESG, YDCK, structural geno 99.62
3kwd_A213 Carbon dioxide concentrating mechanism protein; LEFT-ha 99.51
2ggo_A401 401AA long hypothetical glucose-1-phosphate thymidylylt 99.51
1qre_A247 Carbonic anhydrase; beta-helix, lyase; 1.46A {Methanosa 99.8
3kwd_A213 Carbon dioxide concentrating mechanism protein; LEFT-ha 99.8
3cj8_A236 2,3,4,5-tetrahydropyridine-2-carboxylate N- succinyltra 99.79
3ixc_A191 Hexapeptide transferase family protein; niaid, ssgcid, 99.79
3bfp_A194 Acetyltransferase; LEFT-handed beta helix, COA binding 99.75
1j2z_A270 Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O 99.75
3mqg_A192 Lipopolysaccharides biosynthesis acetyltransferas; beta 99.72
3mqg_A192 Lipopolysaccharides biosynthesis acetyltransferas; beta 99.72
1xhd_A173 Putative acetyltransferase/acyltransferase; structural 99.71
1krr_A203 Galactoside O-acetyltransferase; LEFT-handed parallel b 99.71
1v3w_A173 Ferripyochelin binding protein; beta-helix, carbonic an 99.68
3c8v_A 496 Putative acetyltransferase; YP_390128.1, structural gen 99.68
3nz2_A195 Hexapeptide-repeat containing-acetyltransferase; struct 99.68
3hjj_A190 Maltose O-acetyltransferase; LEFT-handed beta-helix, ac 99.66
2p2o_A185 Maltose transacetylase; GK1921, GKA001001921.1, geobaci 99.64
3ftt_A199 Putative acetyltransferase sacol2570; galactoside O-ace 99.64
3bfp_A194 Acetyltransferase; LEFT-handed beta helix, COA binding 99.6
2v0h_A456 Bifunctional protein GLMU; cell WALL, magnesium, cell s 99.59
3cj8_A236 2,3,4,5-tetrahydropyridine-2-carboxylate N- succinyltra 99.57
1ocx_A182 Maltose O-acetyltransferase; LEFT-handed parallel beta- 99.57
3jqy_B252 NEUO, polysialic acid O-acetyltransferase; LEFT-handed 99.56
3c8v_A 496 Putative acetyltransferase; YP_390128.1, structural gen 99.56
1hm9_A468 GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltransfe 99.55
1qre_A247 Carbonic anhydrase; beta-helix, lyase; 1.46A {Methanosa 99.55
3eg4_A304 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succiny 99.54
1hv9_A456 UDP-N-acetylglucosamine pyrophosphorylase; LEFT-handed 99.53
3fsy_A332 Tetrahydrodipicolinate N-succinyltransferase; beta heli 99.51
3gos_A276 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succiny 99.5
1mr7_A209 Streptogramin A acetyltransferase; LEFT-handed parallel 99.46
3ixc_A191 Hexapeptide transferase family protein; niaid, ssgcid, 99.44
2v0h_A456 Bifunctional protein GLMU; cell WALL, magnesium, cell s 99.41
3nz2_A195 Hexapeptide-repeat containing-acetyltransferase; struct 99.41
1krr_A203 Galactoside O-acetyltransferase; LEFT-handed parallel b 99.41
2rij_A387 Putative 2,3,4,5-tetrahydropyridine-2- carboxylate N- s 99.4
3f1x_A310 Serine acetyltransferase; NESG X-RAY BVR62 A6KZB9 A6KZB 99.4
3eg4_A304 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succiny 99.39
3hjj_A190 Maltose O-acetyltransferase; LEFT-handed beta-helix, ac 99.36
1ocx_A182 Maltose O-acetyltransferase; LEFT-handed parallel beta- 99.35
1mr7_A209 Streptogramin A acetyltransferase; LEFT-handed parallel 99.33
1v3w_A173 Ferripyochelin binding protein; beta-helix, carbonic an 99.3
3jqy_B252 NEUO, polysialic acid O-acetyltransferase; LEFT-handed 99.27
3gos_A276 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succiny 99.21
3mc4_A287 WW/RSP5/WWP domain:bacterial transferase hexapeptide re 99.16
3f1x_A310 Serine acetyltransferase; NESG X-RAY BVR62 A6KZB9 A6KZB 99.16
3fsy_A332 Tetrahydrodipicolinate N-succinyltransferase; beta heli 99.14
1ssq_A267 SAT, serine acetyltransferase; LEFT-handed parallel bet 99.11
3brk_X420 Glucose-1-phosphate adenylyltransferase; ADP-glucose py 99.04
3brk_X420 Glucose-1-phosphate adenylyltransferase; ADP-glucose py 98.9
3mc4_A287 WW/RSP5/WWP domain:bacterial transferase hexapeptide re 98.8
1ssq_A267 SAT, serine acetyltransferase; LEFT-handed parallel bet 98.76
3fs8_A273 QDTC; acetyltransferase, natural product, deoxysugar; H 99.73
2ggo_A401 401AA long hypothetical glucose-1-phosphate thymidylylt 99.56
1xhd_A173 Putative acetyltransferase/acyltransferase; structural 99.43
1xat_A212 Xenobiotic acetyltransferase; chloramphenicol, LEFT-han 99.32
1t3d_A289 SAT, serine acetyltransferase; LEFT-handed-beta-helix, 99.27
1hm9_A468 GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltransfe 99.27
2wlg_A215 Polysialic acid O-acetyltransferase; enzyme, LEFT-hande 99.26
3eev_A212 Chloramphenicol acetyltransferase; beta-helix, structur 99.23
1yp2_A451 Glucose-1-phosphate adenylyltransferase small subunit; 99.23
1yp2_A451 Glucose-1-phosphate adenylyltransferase small subunit; 99.19
3dk5_A495 Bifunctional protein GLMU; acetyltransferase, pyrophosp 99.18
1t3d_A289 SAT, serine acetyltransferase; LEFT-handed-beta-helix, 98.96
3eev_A212 Chloramphenicol acetyltransferase; beta-helix, structur 98.9
2wlg_A215 Polysialic acid O-acetyltransferase; enzyme, LEFT-hande 98.9
2rij_A387 Putative 2,3,4,5-tetrahydropyridine-2- carboxylate N- s 98.89
1xat_A212 Xenobiotic acetyltransferase; chloramphenicol, LEFT-han 98.82
2i5k_A488 UTP--glucose-1-phosphate uridylyltransferase; LEFT-hand 93.83
2pig_A 334 Putative transferase; SCR6, NESG, YDCK, structural geno 99.54
3ftt_A199 Putative acetyltransferase sacol2570; galactoside O-ace 99.24
3dk5_A495 Bifunctional protein GLMU; acetyltransferase, pyrophosp 99.51
1hv9_A456 UDP-N-acetylglucosamine pyrophosphorylase; LEFT-handed 99.36
2p2o_A185 Maltose transacetylase; GK1921, GKA001001921.1, geobaci 99.32
>2qia_A UDP-N-acetylglucosamine acyltransferase; LEFT-handed parallel beta helix; HET: U20; 1.74A {Escherichia coli K12} SCOP: b.81.1.1 PDB: 1lxa_A 2jf3_A* 2aq9_A* 2qiv_X* 2jf2_A Back     alignment and structure
Probab=99.82  E-value=1.5e-20  Score=101.29  Aligned_cols=61  Identities=23%  Similarity=0.395  Sum_probs=42.0

Q ss_pred             CCCCEEECCCEEECCCCEECCCCEECCCCCCCCCCCCCCCCCEEEEEEEECCCCCCCCCCC
Q ss_conf             9687698897099288399798154575432311222222210011355202211112221
Q gi|254781223|r    1 MYDNAVVRDCATVIDDARVSGNASVSRFAQVKSNAEVSDNTYVRDNAKVGGYAKVSGNASV   61 (110)
Q Consensus         1 i~~n~~I~~~a~I~~~~~I~~n~~I~~~~~i~~~~~i~~~~~i~~~~~i~~~~~i~~~~~i   61 (110)
                      |+++++|+|+|.|.++++|++|+.|+|++.|++++.|++++.+..++.++.++.++.++.+
T Consensus         2 I~~~a~IhptAvI~~~a~IG~~V~IGp~~vIg~~v~IG~~~~I~~~v~I~~~~~ig~~~~i   62 (262)
T 2qia_A            2 IDKSAFVHPTAIVEEGASIGANAHIGPFCIVGPHVEIGEGTVLKSHVVVNGHTKIGRDNEI   62 (262)
T ss_dssp             BCTTCEECTTCEECTTCEECTTCEECTTCEECTTEEECTTCEECSSCEECSEEEECSSCEE
T ss_pred             CCCCCEECCCCEECCCCEECCCCEECCCCEECCCCEECCCCEEECCEEECCCCEECCCCCC
T ss_conf             5898899999899999999998999999999999999999989198899389454135421
>1j2z_A Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O-acyltransferase; UDP-N-acetylglucosamine acyltransferase, LPXA; HET: SOG TLA; 2.10A {Helicobacter pylori} SCOP: b.81.1.1 Back     alignment and structure
>2qia_A UDP-N-acetylglucosamine acyltransferase; LEFT-handed parallel beta helix; HET: U20; 1.74A {Escherichia coli K12} SCOP: b.81.1.1 PDB: 1lxa_A 2jf3_A* 2aq9_A* 2qiv_X* 2jf2_A Back     alignment and structure
>2iu8_A LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; UDP-3- O-acyl-glucosamine N-acyltransferase, lipid A biosynthesis; HET: PLM UD1; 2.2A {Chlamydia trachomatis} PDB: 2iu9_A* 2iua_A* Back     alignment and structure
>3eh0_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltransferase; LPXD, LEFT-handed parallel beta helix, acyl carrier protein, antibiotic resistance; 2.60A {Escherichia coli} Back     alignment and structure
>3hsq_A Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O-acyltransferase; L.interrogans LPXA, LPXA, LPXA acyltransferase; 2.10A {Leptospira interrogans} PDB: 3i3a_A* 3i3x_A* Back     alignment and structure
>3hsq_A Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O-acyltransferase; L.interrogans LPXA, LPXA, LPXA acyltransferase; 2.10A {Leptospira interrogans} PDB: 3i3a_A* 3i3x_A* Back     alignment and structure
>3eh0_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltransferase; LPXD, LEFT-handed parallel beta helix, acyl carrier protein, antibiotic resistance; 2.60A {Escherichia coli} Back     alignment and structure
>3fs8_A QDTC; acetyltransferase, natural product, deoxysugar; HET: ACO; 1.70A {Thermoanaerobacteriumthermosaccharolyticum} PDB: 3fsb_A* 3fsc_A* Back     alignment and structure
>2iu8_A LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; UDP-3- O-acyl-glucosamine N-acyltransferase, lipid A biosynthesis; HET: PLM UD1; 2.2A {Chlamydia trachomatis} PDB: 2iu9_A* 2iua_A* Back     alignment and structure
>2pig_A Putative transferase; SCR6, NESG, YDCK, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.38A {Salmonella paratyphi} PDB: 2f9c_A Back     alignment and structure
>3kwd_A Carbon dioxide concentrating mechanism protein; LEFT-handed beta helix, gamma carbonic anhydrase; 1.10A {Thermosynechococcus elongatus} PDB: 3kwe_A 3kwc_A Back     alignment and structure
>2ggo_A 401AA long hypothetical glucose-1-phosphate thymidylyltransferase; beta barrel; 1.80A {Sulfolobus tokodaii} PDB: 2ggq_A* Back     alignment and structure
>1qre_A Carbonic anhydrase; beta-helix, lyase; 1.46A {Methanosarcina thermophila} SCOP: b.81.1.5 PDB: 1qq0_A 1qrf_A 1qrg_A 1qrm_A 1qrl_A 1thj_A Back     alignment and structure
>3kwd_A Carbon dioxide concentrating mechanism protein; LEFT-handed beta helix, gamma carbonic anhydrase; 1.10A {Thermosynechococcus elongatus} PDB: 3kwe_A 3kwc_A Back     alignment and structure
>3cj8_A 2,3,4,5-tetrahydropyridine-2-carboxylate N- succinyltransferase; APC86892, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.95A {Enterococcus faecalis V583} Back     alignment and structure
>3ixc_A Hexapeptide transferase family protein; niaid, ssgcid, seattle structural genomics center for infectious disease; 1.61A {Anaplasma phagocytophilum} Back     alignment and structure
>3bfp_A Acetyltransferase; LEFT-handed beta helix, COA binding protein, N-glycan biosynthesis, bacillosamine, structural genomics, MKBSGI; HET: FLC; 1.75A {Campylobacter jejuni} SCOP: b.81.1.8 PDB: 2vhe_A* 3bsw_A* 3bss_A* 3bsy_A* 2npo_A Back     alignment and structure
>1j2z_A Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O-acyltransferase; UDP-N-acetylglucosamine acyltransferase, LPXA; HET: SOG TLA; 2.10A {Helicobacter pylori} SCOP: b.81.1.1 Back     alignment and structure
>3mqg_A Lipopolysaccharides biosynthesis acetyltransferas; beta helix, acetyl transferase, transferase; HET: ACO U5P UDP PE4; 1.43A {Bordetella petrii} PDB: 3mqh_A* Back     alignment and structure
>3mqg_A Lipopolysaccharides biosynthesis acetyltransferas; beta helix, acetyl transferase, transferase; HET: ACO U5P UDP PE4; 1.43A {Bordetella petrii} PDB: 3mqh_A* Back     alignment and structure
>1xhd_A Putative acetyltransferase/acyltransferase; structural genomics, protein structure initiative, medwest center for structural genomics; 1.90A {Bacillus cereus atcc 14579} SCOP: b.81.1.5 PDB: 2eg0_A Back     alignment and structure
>1krr_A Galactoside O-acetyltransferase; LEFT-handed parallel beta helix; HET: ACO; 2.50A {Escherichia coli} SCOP: b.81.1.3 PDB: 1kqa_A* 1kru_A* 1krv_A* Back     alignment and structure
>1v3w_A Ferripyochelin binding protein; beta-helix, carbonic anhydrase, structural genomics, riken structural genomics/proteomics initiative; 1.50A {Pyrococcus horikoshii OT3} SCOP: b.81.1.5 PDB: 1v67_A 2fko_A Back     alignment and structure
>3c8v_A Putative acetyltransferase; YP_390128.1, structural genomics, joint center for structural genomics, JCSG; 2.28A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>3nz2_A Hexapeptide-repeat containing-acetyltransferase; structural genomics, center for structural genomics of infec diseases, csgid; HET: ACO; 2.35A {Vibrio cholerae o1 biovar eltor} PDB: 3ect_A* Back     alignment and structure
>3hjj_A Maltose O-acetyltransferase; LEFT-handed beta-helix, acyltransferase, structural genomics; 2.15A {Bacillus anthracis} PDB: 3igj_A* Back     alignment and structure
>2p2o_A Maltose transacetylase; GK1921, GKA001001921.1, geobacillus kaustophilus structural genomics, PSI, protein structure initiative; 1.74A {Geobacillus kaustophilus HTA426} PDB: 2ic7_A Back     alignment and structure
>3ftt_A Putative acetyltransferase sacol2570; galactoside O-acetyltransferase, enzyme, structural genomics, acyltransferase; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>3bfp_A Acetyltransferase; LEFT-handed beta helix, COA binding protein, N-glycan biosynthesis, bacillosamine, structural genomics, MKBSGI; HET: FLC; 1.75A {Campylobacter jejuni} SCOP: b.81.1.8 PDB: 2vhe_A* 3bsw_A* 3bss_A* 3bsy_A* 2npo_A Back     alignment and structure
>2v0h_A Bifunctional protein GLMU; cell WALL, magnesium, cell shape, transferase, peptidoglycan synthesis, associative mechanism; 1.79A {Haemophilus influenzae} PDB: 2v0i_A* 2v0j_A* 2v0k_A* 2v0l_A* 2vd4_A* 2w0v_A* 2w0w_A* Back     alignment and structure
>3cj8_A 2,3,4,5-tetrahydropyridine-2-carboxylate N- succinyltransferase; APC86892, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.95A {Enterococcus faecalis V583} Back     alignment and structure
>1ocx_A Maltose O-acetyltransferase; LEFT-handed parallel beta-helix; 2.15A {Escherichia coli} SCOP: b.81.1.3 Back     alignment and structure
>3jqy_B NEUO, polysialic acid O-acetyltransferase; LEFT-handed beta-helix polysia; HET: PEG; 1.70A {Escherichia coli} Back     alignment and structure
>3c8v_A Putative acetyltransferase; YP_390128.1, structural genomics, joint center for structural genomics, JCSG; 2.28A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>1hm9_A GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltransferase; acetyltransferase, bifunctional, crystallography, drug design; HET: ACO UD1; 1.75A {Streptococcus pneumoniae} SCOP: b.81.1.4 c.68.1.5 PDB: 1hm8_A* 1hm0_A* 1g97_A* 1g95_A* Back     alignment and structure
>1qre_A Carbonic anhydrase; beta-helix, lyase; 1.46A {Methanosarcina thermophila} SCOP: b.81.1.5 PDB: 1qq0_A 1qrf_A 1qrg_A 1qrm_A 1qrl_A 1thj_A Back     alignment and structure
>3eg4_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; ssgcid, beta helix, acyltransferase, amino-acid biosynthesis, cytoplasm; 1.87A {Brucella suis} Back     alignment and structure
>1hv9_A UDP-N-acetylglucosamine pyrophosphorylase; LEFT-handed parallel beta-helix, transferase; HET: COA UD1; 2.10A {Escherichia coli} SCOP: b.81.1.4 c.68.1.5 PDB: 2oi5_A* 2oi6_A* 2oi7_A* 3fww_A 1fxj_A* 1fwy_A* Back     alignment and structure
>3fsy_A Tetrahydrodipicolinate N-succinyltransferase; beta helix, L beta H domain, acyltransferase; HET: SCA; 1.97A {Mycobacterium tuberculosis} PDB: 3fsx_A* Back     alignment and structure
>3gos_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; 2,3,4,5-tetrahydropyridine-2-carboxylate N- succinyltransferase; 1.80A {Yersinia pestis} PDB: 1kgq_A* 1kgt_A* 2tdt_A* 3tdt_A* 3bxy_A 1tdt_A Back     alignment and structure
>1mr7_A Streptogramin A acetyltransferase; LEFT-handed parallel beta-helix domain; 1.80A {Enterococcus faecium} SCOP: b.81.1.3 PDB: 1khr_A* 1kk5_A 1kk4_A 1kk6_A 1mr9_A* 1mrl_A* 3dho_A* Back     alignment and structure
>3ixc_A Hexapeptide transferase family protein; niaid, ssgcid, seattle structural genomics center for infectious disease; 1.61A {Anaplasma phagocytophilum} Back     alignment and structure
>2v0h_A Bifunctional protein GLMU; cell WALL, magnesium, cell shape, transferase, peptidoglycan synthesis, associative mechanism; 1.79A {Haemophilus influenzae} PDB: 2v0i_A* 2v0j_A* 2v0k_A* 2v0l_A* 2vd4_A* 2w0v_A* 2w0w_A* Back     alignment and structure
>3nz2_A Hexapeptide-repeat containing-acetyltransferase; structural genomics, center for structural genomics of infec diseases, csgid; HET: ACO; 2.35A {Vibrio cholerae o1 biovar eltor} PDB: 3ect_A* Back     alignment and structure
>1krr_A Galactoside O-acetyltransferase; LEFT-handed parallel beta helix; HET: ACO; 2.50A {Escherichia coli} SCOP: b.81.1.3 PDB: 1kqa_A* 1kru_A* 1krv_A* Back     alignment and structure
>2rij_A Putative 2,3,4,5-tetrahydropyridine-2- carboxylate N- succinyltransferase; NP_282733.1, structural genomics; HET: MSE CIT; 1.90A {Campylobacter jejuni} Back     alignment and structure
>3f1x_A Serine acetyltransferase; NESG X-RAY BVR62 A6KZB9 A6KZB9_BACV8, structural genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>3eg4_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; ssgcid, beta helix, acyltransferase, amino-acid biosynthesis, cytoplasm; 1.87A {Brucella suis} Back     alignment and structure
>3hjj_A Maltose O-acetyltransferase; LEFT-handed beta-helix, acyltransferase, structural genomics; 2.15A {Bacillus anthracis} PDB: 3igj_A* Back     alignment and structure
>1ocx_A Maltose O-acetyltransferase; LEFT-handed parallel beta-helix; 2.15A {Escherichia coli} SCOP: b.81.1.3 Back     alignment and structure
>1mr7_A Streptogramin A acetyltransferase; LEFT-handed parallel beta-helix domain; 1.80A {Enterococcus faecium} SCOP: b.81.1.3 PDB: 1khr_A* 1kk5_A 1kk4_A 1kk6_A 1mr9_A* 1mrl_A* 3dho_A* Back     alignment and structure
>1v3w_A Ferripyochelin binding protein; beta-helix, carbonic anhydrase, structural genomics, riken structural genomics/proteomics initiative; 1.50A {Pyrococcus horikoshii OT3} SCOP: b.81.1.5 PDB: 1v67_A 2fko_A Back     alignment and structure