HOME Exp-NES Cancer-NES Human-NES Documentation Contact
Q14145_KEAP1 | Kelch-like ECH-associated protein 1ProteinAtlasCosmicProvizSwissmodel
  • Cosmic Cancer Gene Census (CGC)
  • Reference DB: NESdb:187 validNES:P103
  • PMIDs: 15899855
  • Species: Homo sapiens (Human)
  • Evidence: LMB Sensitive
  • Mutation(export): L301A, I304A, L308A, L310A
  • Mutation(bind): Unknown
  • Functional seq: 272RCHSLTPNFLQMQLQKCEILQSDSRCKDYLVKIFEELTLHKPTQ315
  • Sites: 272-312


# candidates uniprotID start# sequence secondary class loc_DISO loc_CDD beta Ebind Score(NES) Cosmic Score(Cosmic) TOTALscore(Ebind|Stars)
1 nes_diso Q14145 52 FSYTLEDHTKQAFGIMN EEECCHHHHHHHHHHHH c1c-AT-4 boundary boundary|BTB_POZ_KLHL19_KEAP1; 0.0 NA cosmic_spacer
2 nes_diso Q14145 59 HTKQAFGIMNELRLSQ HHHHHHHHHHHHHHCC c1a-AT-4 boundary boundary|BTB_POZ_KLHL19_KEAP1; boundary|PHA03098; 0.0 NA cosmic_spacer
3 nes_diso Q14145 60 TKQAFGIMNELRLSQ HHHHHHHHHHHHHCC c1b-4 boundary boundary|BTB_POZ_KLHL19_KEAP1; boundary|PHA03098; 0.0 NA cosmic_phi_to_LIVMF
4 nes_diso Q14145 68 NELRLSQQLCDVTLQV HHHHHCCCCCCEEEEE c1a-4 boundary boundary|BTB_POZ_KLHL19_KEAP1; boundary|PHA03098; 0.0 Medium: -36.236 cosmic_phi_to_LIVMF Medium|
5 nes_beta_ord Q14145 86 QDAPAAQFMAHKVVLAS CCCCCCEEEEEEHHHHC c1c-AT-4 ORD middle|BTB_POZ_KLHL19_KEAP1; boundary|PHA03098; 0.75 NA cosmic_spacer
6 nes_ord Q14145 186 GIANFAEQIGCVELHQ HHHHHHHHHCCHHHHH c1a-5 ORD boundary|BTB_POZ_KLHL19_KEAP1; middle|PHA03098; boundary|BACK_KLHL19_KEAP1; 0.0 NA cosmic_phi
7 nes_ord Q14145 195 GCVELHQRAREYIYMHF CCHHHHHHHHHHHHHHH c1c-AT-4 ORD boundary|BTB_POZ_KLHL19_KEAP1; middle|PHA03098; boundary|BACK_KLHL19_KEAP1; 0.0 NA cosmic_spacer_Pro
8 nes_ord Q14145 260 RRFYVQALLRAVRCHS
            ....
HHHHHHHHHHHCCCCC c1aR-4 ORD middle|PHA03098; boundary|BACK_KLHL19_KEAP1; 0.0 NA cosmic_phi_to_LIVMF
9 nes_ord Q14145 272 RCHSLTPNFLQMQLQK
................
CCCCCCHHHHHHHHHC c1a-4 ORD middle|PHA03098; boundary|BACK_KLHL19_KEAP1; 0.0 NA cosmic_spacer_Pro
10 ExpNES_diso Q14145 297 CKDYLVKIFEELTLHK
....*..*...*.*..
HHHHHHHHHHHHHCCC c1a-4 boundary middle|PHA03098; boundary|BACK_KLHL19_KEAP1; 0.0 Medium: -38.486 cosmic_phi Medium|
11 nes_ord Q14145 349 DGTWLRLADLQVPR CCEEEECCCCCCCC c2-4 ORD middle|PHA03098; 0.43 NA cosmic_phi
12 nes_beta_ord Q14145 417 GVGVIDGHIYAVGG EEEEECCEEEEECC c3-4 ORD middle|PHA03098; 0.71 NA cosmic_phi_to_LIVMF
13 nes_ord Q14145 449 EWHLVAPMLTRRIGVGV EEEEECCCCCCCCCCEE c1c-4 ORD middle|PHA03098; 0.12 NA cosmic_phi_to_LIVMF
14 nes_ord Q14145 453 VAPMLTRRIGVGVAVLN ECCCCCCCCCCEEEEEC c1c-4 ORD middle|PHA03098; 0.12 NA cosmic_spacer_Pro
15 nes_beta_ord Q14145 464 GVAVLNRLLYAVGG EEEEECCEEEEECC c3-4 ORD middle|PHA03098; 0.71 NA cosmic_phi_to_LIVMF
16 nes_beta_ord Q14145 467 VLNRLLYAVGGFDG EECCEEEEECCCCC c3-4 ORD middle|PHA03098; 0.71 NA cosmic_phi_to_LIVMF
  • candidates: if the segment is located in the disordered or boundary region, flagged with "_diso"; if the segment is located in the ordered region, flagged with "_ord"; if the segment's beta-strand content is over 0.5, flagged with "_beta"; if the segment is annotated as NES in the NESdb or validNES, flagged with "ExpNES_" instead of "nes_".
  • sequence: Hydrophobic positions are colored in red.
  • class: NES classes 1a, 1b, 1c, 1d, 1aR (reverse class of 1a), 1cR, 2, 2-rev (Rev type class 2), 3, and 4. The first letter "c" is for "class", and the number after hyphen ("-") is for the number of key hydrophobic positions. For example, c1a-4 means class 1a with the non-hydrophobic phi0 position. c1a-5 is for class 1a which have all hydrophobic residues in their phi0-4 positions.
  • loc_DISO: location of the segment with respect to the ordered/disordered regions
  • loc_CDD: location of the segment with respect to the conserved region annotated in the Conserved Domain Database (CDD)
  • beta: beta-strand content in the middle of the segment
  • Ebind: binding energy; Strong (less than -40.0), Medium (-40.0~-33.0), Weak (-33.0~-30.0), or Bad (higher than -30.0); Generated models can be downloaded via icon.
  • Score(NES): how many passes for the criteria: i) not located in the ordered region, ii) do not have beta strand in the middle, and iii) Strong, Medium, or Weak Ebind scores
  • Cosmic: if the key hydrophobic residues are mapped to the COSMIC mutation position, flagged with "cosmic_phi"; when the changed amino acid of the mutation position is L, I, V, M, or F, flagged with "cosmic_phi_to_LIVMF"; if the spacer residues are mapped to the mutation position, flagged with "cosmic_spacer"
  • Score(Cosmic): 2 stars with "cosmic_phi" and the changed amino acid is not L, I, V, M, or F; 1 star for "cosmic_phi_to_LIVMF" or "cosmic_spacer" (Score(Cosmic) is present for only segments with the 3 stars of Score(NES))
  • TOTALscore: Score(NES)+Score(Cosmic); The Ebind category (Strong, Medium, or Weak) is annotated together.