HOME Exp-NES Cancer-NES Human-NES Documentation Contact
Q16236_NF2L2 | Nuclear factor erythroid 2-related factor 2   ProteinAtlas   Cosmic   Proviz   Swissmodel
  • Cosmic Cancer Gene Census (CGC)
  • Reference DB: NESdb:108
  • PMIDs: 15917227;16790425
  • Species: Homo sapiens (Human)
  • Evidence: LMB Sensitive, Binds CRM1
  • Mutation(export): L200A, L553A, L557A, L560A, L562A
  • Mutation(bind): L553A/L557A/L560A/L562A
  • Functional seq: 178DGMQQDIEQVWEELLSIPELQCLNIENDKLVETTMVPSPEAKLTEVDNYHFYSSIPSMEKEVGNCSPHFLNAFEDSFSSILSTEDPNQLTVNSLNSDATVNTDFGDEFYSAFIAEPSISNSMPSPATLSHSLSE311,503RRGKNKVAAQNCRKRKLENIVELEQDLDHLKDEKEKLLKEKGENDKSLHLLKKQLSTLYLEVFSM567,
  • Sites: -


# candidates uniprotID start# sequence secondary class loc_DISO loc_CDD beta Ebind Score(NES) Cosmic Score(Cosmic) TOTALscore(Ebind|Stars)
1 nes_diso Q16236 65 EQEKAFFAQLQLDE HHHHHHHHHHCCCH c2-AT-4 DISO 0.0 NA cosmic_spacer
2 nes_diso Q16236 118 DCMQLLAQTFPFVD HHHHHHHHHCCCCC c2-AT-4 DISO 0.0 NA cosmic_spacer
3 nes_diso Q16236 173 APVDLDGMQQDIEQVW
     ...........		 CCCCCCCCCCCHHHHH c1aR-5 DISO 0.0 Bad: -28.091 cosmic_spacer
4 nes_diso Q16236 176 DLDGMQQDIEQVWE
  ............		 CCCCCCCCHHHHHH c3-4 DISO 0.0 Medium: -34.403 cosmic_spacer Medium|
5 nes_diso Q16236 183 DIEQVWEELLSIPE
..............		 CHHHHHHHHHCCHH c3-4 DISO 0.0 Bad: -25.394 cosmic_spacer
6 ExpNES_diso Q16236 193 SIPELQCLNIEN
.......*....		 CCHHHHHCCCCC c2-rev DISO 0.0 Weak: -31.233 cosmic_phi_to_LIVMF Weak|
7 nes_diso Q16236 246 FLNAFEDSFSSILS
..............		 HHHCCCCCCCCCCC c3-4 DISO 0.0 Medium: -34.245 cosmic_phi Medium|
8 nes_diso Q16236 313 LNGPIDVSDLSLCK HCCCCCHHHHCCCC c2-4 DISO 0.0 Bad: -24.766 cosmic_spacer
9 nes_diso Q16236 455 TRDELRAKALHIPF CHHHHHHHHHCCCC c2-AT-4 DISO 0.0 NA cosmic_spacer
10 nes_diso Q16236 462 KALHIPFPVEKIINLPV HHHCCCCCHHHHHCCCH c1c-4 DISO boundary|bZIP_NFE2-like; boundary|BRLZ; 0.0 Strong: -48.928 cosmic_phi_to_LIVMF Strong|
11 nes_diso Q16236 521 NIVELEQDLDHLKD
..............		 HHHHHHHHHHHHHH c3-4 DISO middle|bZIP_NFE2-like; middle|BRLZ; 0.0 Medium: -38.321 cosmic_phi_to_LIVMF Medium|
12 ExpNES_diso Q16236 549 SLHLLKKQLSTLYLEV
....*...*..*.*..		 HHHHHHHHHHHHHHHH c1a-5 boundary boundary|bZIP_NFE2-like; boundary|BRLZ; 0.0 Weak: -32.875 cosmic_spacer Weak|
13 ExpNES_diso Q16236 556 QLSTLYLEVFSMLR
.*..*.*.....  		 HHHHHHHHHHHHCC c2-5 boundary boundary|bZIP_NFE2-like; boundary|BRLZ; 0.0 Weak: -30.275 cosmic_spacer Weak|
14 nes_diso Q16236 556 QLSTLYLEVFSMLR
.*..*.*.....  		 HHHHHHHHHHHHCC c3-4 boundary boundary|bZIP_NFE2-like; boundary|BRLZ; 0.0 Bad: -25.846 cosmic_spacer
  • candidates: if the segment is located in the disordered or boundary region, flagged with "_diso"; if the segment is located in the ordered region, flagged with "_ord"; if the segment's beta-strand content is over 0.5, flagged with "_beta"; if the segment is annotated as NES in the NESdb or validNES, flagged with "ExpNES_" instead of "nes_".
  • sequence: Hydrophobic positions are colored in red.
  • class: NES classes 1a, 1b, 1c, 1d, 1aR (reverse class of 1a), 1cR, 2, 2-rev (Rev type class 2), 3, and 4. The first letter "c" is for "class", and the number after hyphen ("-") is for the number of key hydrophobic positions. For example, c1a-4 means class 1a with the non-hydrophobic phi0 position. c1a-5 is for class 1a which have all hydrophobic residues in their phi0-4 positions.
  • loc_DISO: location of the segment with respect to the ordered/disordered regions
  • loc_CDD: location of the segment with respect to the conserved region annotated in the Conserved Domain Database (CDD)
  • beta: beta-strand content in the middle of the segment
  • Ebind: binding energy; Strong (less than -40.0), Medium (-40.0~-33.0), Weak (-33.0~-30.0), or Bad (higher than -30.0); Generated models can be downloaded via icon.
  • Score(NES): how many passes for the criteria: i) not located in the ordered region, ii) do not have beta strand in the middle, and iii) Strong, Medium, or Weak Ebind scores
  • Cosmic: if the key hydrophobic residues are mapped to the COSMIC mutation position, flagged with "cosmic_phi"; when the changed amino acid of the mutation position is L, I, V, M, or F, flagged with "cosmic_phi_to_LIVMF"; if the spacer residues are mapped to the mutation position, flagged with "cosmic_spacer"
  • Score(Cosmic): 2 stars with "cosmic_phi" and the changed amino acid is not L, I, V, M, or F; 1 star for "cosmic_phi_to_LIVMF" or "cosmic_spacer" (Score(Cosmic) is present for only segments with the 3 stars of Score(NES))
  • TOTALscore: Score(NES)+Score(Cosmic); The Ebind category (Strong, Medium, or Weak) is annotated together.