HOME Exp-NES Cancer-NES Human-NES Documentation Contact
P14373_TRI27 | Zinc finger protein RFP   ProteinAtlas   Cosmic   Proviz   Swissmodel
  • Cosmic Cancer Gene Census (CGC)
  • Reference DB: NESdb:43 validNES:P036
  • PMIDs: 11591718
  • Species: Homo sapiens (Human)
  • Evidence: LMB Sensitive
  • Mutation(export): L204A/L207A/L209A
  • Mutation(bind): Unknown
  • Functional seq: 132LEEAVEGFKEQIQNQLDHLKRVKDLKKRRRAQGEQARAELLSLTQMEREKIVWEFEQLYHSLKEHEYRLLARLEELDLAIYNSINGAITQFSCNISHLSSLIAQLEEKQQQPTRELLQDIGDTL255
  • Sites: 204-209


# candidates uniprotID start# sequence secondary class loc_DISO loc_CDD beta Ebind Score(NES) Cosmic Score(Cosmic) TOTALscore(Ebind|Stars)
1 nes_diso P14373 16 CPVCLQYFAEPMMLDC CCCHHHHCCCCCCCCC c1aR-4 boundary small|RING-HC_TRIM11_like_C-IV; 0.0 Bad: -28.98
2 nes_diso P14373 70 HLANVTQLVKQLRT HHHHHHHHHHHHCC c3-4 boundary 0.0 Weak: -31.398 Weak|
3 nes_ord P14373 128 SVLPLEEAVEGFKE
    ..........		 EEEEHHHHHHHHHH c3-4 ORD 0.14 Bad: -23.804
4 ExpNES_diso P14373 196 HEYRLLARLEELDLAI
........*++*+*..		 HHHHHHHHHHHHHHHH c1a-4 boundary 0.0 Weak: -32.102 Weak|
5 nes_diso P14373 218 AITQFSCNISHLSS
..............		 HHHHHHHHHHHHHH c3-4 boundary 0.0 Bad: -25.072
6 nes_diso P14373 225 NISHLSSLIAQLEE
..............		 HHHHHHHHHHHHHH c3-4 boundary 0.0 Weak: -31.641 Weak|
7 nes_diso P14373 265 EPWITPPDLQEKIHIFA CCCCCCHHHHHHHCCHH c1c-AT-4 boundary 0.0 NA
8 nes_diso P14373 273 LQEKIHIFAQKCLFLTE HHHHHCCHHHHHHHHHH c1c-AT-4 __ 0.0 NA
9 nes_diso P14373 307 ELREAQLYSVDVTL HHHHHHCEECCCEE c2-AT-5 boundary boundary|SPRY_PRY_TRIM27; 0.29 NA
10 nes_diso P14373 425 TALPLRTPLQRVGIFL CCCCCCCCCCEEEEEE c1a-4 boundary middle|SPRY_PRY_TRIM27; 0.14 Medium: -38.031 cosmic_phi_to_LIVMF Medium|
11 nes_diso P14373 436 VGIFLDYDAGEVSFYN EEEEEECCCCEEEEEE c1a-AT-4 __ middle|SPRY_PRY_TRIM27; 0.43 NA
  • candidates: if the segment is located in the disordered or boundary region, flagged with "_diso"; if the segment is located in the ordered region, flagged with "_ord"; if the segment's beta-strand content is over 0.5, flagged with "_beta"; if the segment is annotated as NES in the NESdb or validNES, flagged with "ExpNES_" instead of "nes_".
  • sequence: Hydrophobic positions are colored in red.
  • class: NES classes 1a, 1b, 1c, 1d, 1aR (reverse class of 1a), 1cR, 2, 2-rev (Rev type class 2), 3, and 4. The first letter "c" is for "class", and the number after hyphen ("-") is for the number of key hydrophobic positions. For example, c1a-4 means class 1a with the non-hydrophobic phi0 position. c1a-5 is for class 1a which have all hydrophobic residues in their phi0-4 positions.
  • loc_DISO: location of the segment with respect to the ordered/disordered regions
  • loc_CDD: location of the segment with respect to the conserved region annotated in the Conserved Domain Database (CDD)
  • beta: beta-strand content in the middle of the segment
  • Ebind: binding energy; Strong (less than -40.0), Medium (-40.0~-33.0), Weak (-33.0~-30.0), or Bad (higher than -30.0); Generated models can be downloaded via icon.
  • Score(NES): how many passes for the criteria: i) not located in the ordered region, ii) do not have beta strand in the middle, and iii) Strong, Medium, or Weak Ebind scores
  • Cosmic: if the key hydrophobic residues are mapped to the COSMIC mutation position, flagged with "cosmic_phi"; when the changed amino acid of the mutation position is L, I, V, M, or F, flagged with "cosmic_phi_to_LIVMF"; if the spacer residues are mapped to the mutation position, flagged with "cosmic_spacer"
  • Score(Cosmic): 2 stars with "cosmic_phi" and the changed amino acid is not L, I, V, M, or F; 1 star for "cosmic_phi_to_LIVMF" or "cosmic_spacer" (Score(Cosmic) is present for only segments with the 3 stars of Score(NES))
  • TOTALscore: Score(NES)+Score(Cosmic); The Ebind category (Strong, Medium, or Weak) is annotated together.