P42566_EPS15 | Epidermal growth factor receptor substrate 15
ProteinAtlas
Cosmic
Proviz
Swissmodel
- Cosmic Cancer Gene Census (CGC)
- Reference DB: NESdb:24 validNES:P013
- PMIDs: 11777906;11425879
- Species: Homo sapiens (Human)
- Evidence: LMB Sensitive, Binds CRM1
- Mutation(export): L882A/L884A, I886A/L888A, I893A
- Mutation(bind): Unknown
- Functional seq: 766DEPPALPPKIGTPTRPCPLPPGKRSINKLDSPDPFKLNDPFQPFPGNDSPKEKDPEIFCDPFTSATTTTNKEADPSNFANFSAYPSEEDMIEWAKRESEREEEQRLARLNQQEQEDLELAIALSKSEISEA896
- Sites: 766-896
| # | candidates | uniprotID | start# | sequence | secondary | class | loc_DISO | loc_CDD | beta | Ebind | Score(NES) | Cosmic | Score(Cosmic) | TOTALscore(Ebind|Stars) |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 1 | nes_diso | P42566 | 75 | VALRLVACAQNGLEVSL | HHHHHHHHHHCCCCCCH | c1c-AT-4 | boundary | boundary|EH; | 0.0 | NA |  |
cosmic_spacer | | |
| 2 | nes_diso | P42566 | 83 | AQNGLEVSLSSLNLAV | HHCCCCCCHHHHCCCC | c1a-4 | boundary | boundary|EH; | 0.0 | Medium: -34.909  | |
Medium| | ||
| 3 | nes_diso | P42566 | 85 | NGLEVSLSSLNLAV | CCCCCCHHHHCCCC | c2-4 | boundary | boundary|EH; | 0.0 | Weak: -31.341 | |
Weak| | ||
| 4 | nes_diso | P42566 | 87 | LEVSLSSLNLAVPPPR | CCCCHHHHCCCCCCCC | c1aR-4 | boundary | boundary|EH; boundary|EH; | 0.0 | Bad: -19.907 | |
| ||
| 5 | nes_diso | P42566 | 181 | DRDEFAVAMFLVYC | CHHHHHHHHHHHHH | c2-4 | boundary | boundary|EH; | 0.0 | Bad: -28.944 | |
cosmic_spacer | | |
| 6 | nes_diso | P42566 | 185 | FAVAMFLVYCALEKEP | HHHHHHHHHHHHCCCC | c1aR-4 | boundary | boundary|EH; boundary|EH; | 0.0 | Weak: -31.198 | |
cosmic_spacer |  | Weak| |
| 7 | nes_diso | P42566 | 235 | TDKDMDGFVSGLEVRE | CCCCCCCCCCHHHHHH | c1a-4 | DISO | boundary|EH; boundary|EH; | 0.0 | Medium: -34.91 | |
cosmic_phi_to_LIVMF | | Medium| |
| 8 | nes_diso | P42566 | 242 | FVSGLEVREIFLKT | CCCHHHHHHHHHHH | c2-5 | DISO | boundary|EH; middle|EH; | 0.0 | Bad: -28.783 | |
cosmic_phi_to_LIVMF | | |
| 9 | nes_diso | P42566 | 282 | FALAFHLISQKLIKGI | HHHHHHHHHHHHHCCC | c1aR-4 | DISO | boundary|EH; | 0.0 | Bad: -26.766 | |
| ||
| 10 | nes_diso | P42566 | 334 | ELDTLNNEIVDLQR | HHHHCCHHHHHHHH | c3-4 | DISO | boundary|EH; boundary|SPEC superfamily; | 0.0 | Weak: -31.697 | |
Weak| | ||
| 11 | nes_diso | P42566 | 488 | EISSMQMKLMEMKD | HHHHHHHHHHHHHH | c2-5 | DISO | boundary|SPEC superfamily; | 0.0 | Medium: -37.132 | |
cosmic_spacer | | Medium| |
| 12 | nes_diso | P42566 | 488 | EISSMQMKLMEMKD | HHHHHHHHHHHHHH | c3-4 | DISO | boundary|SPEC superfamily; | 0.0 | Medium: -33.454 | |
cosmic_spacer | | Medium| |
| 13 | nes_diso | P42566 | 739 | FRSATSSSVSNVVITK | CCCCCCCCCCCCCCCC | c1a-AT-4 | DISO | 0.0 | NA | |
|
- candidates: if the segment is located in the disordered or boundary region, flagged with "_diso"; if the segment is located in the ordered region, flagged with "_ord"; if the segment's beta-strand content is over 0.5, flagged with "_beta"; if the segment is annotated as NES in the NESdb or validNES, flagged with "ExpNES_" instead of "nes_".
- sequence: Hydrophobic positions are colored in red.
- class: NES classes 1a, 1b, 1c, 1d, 1aR (reverse class of 1a), 1cR, 2, 2-rev (Rev type class 2), 3, and 4. The first letter "c" is for "class", and the number after hyphen ("-") is for the number of key hydrophobic positions. For example, c1a-4 means class 1a with the non-hydrophobic phi0 position. c1a-5 is for class 1a which have all hydrophobic residues in their phi0-4 positions.
- loc_DISO: location of the segment with respect to the ordered/disordered regions
- loc_CDD: location of the segment with respect to the conserved region annotated in the Conserved Domain Database (CDD)
- beta: beta-strand content in the middle of the segment
- Ebind: binding energy; Strong (less than -40.0), Medium (-40.0~-33.0), Weak (-33.0~-30.0), or Bad (higher than -30.0); Generated models can be downloaded via icon.
- Score(NES): how many passes for the criteria: i) not located in the ordered region, ii) do not have beta strand in the middle, and iii) Strong, Medium, or Weak Ebind scores
- Cosmic: if the key hydrophobic residues are mapped to the COSMIC mutation position, flagged with "cosmic_phi"; when the changed amino acid of the mutation position is L, I, V, M, or F, flagged with "cosmic_phi_to_LIVMF"; if the spacer residues are mapped to the mutation position, flagged with "cosmic_spacer"
- Score(Cosmic): 2 stars with "cosmic_phi" and the changed amino acid is not L, I, V, M, or F; 1 star for "cosmic_phi_to_LIVMF" or "cosmic_spacer" (Score(Cosmic) is present for only segments with the 3 stars of Score(NES))
- TOTALscore: Score(NES)+Score(Cosmic); The Ebind category (Strong, Medium, or Weak) is annotated together.