HOME Exp-NES Cancer-NES Human-NES Documentation Contact
P55265_DSRAD | Double-stranded RNA-specific adenosine deaminase   ProteinAtlas   Cosmic   Proviz   Swissmodel
  • Reference DB: NESdb:110
  • PMIDs: 11604520
  • Species: Homo sapiens (Human)
  • Evidence: LMB Sensitive, Binds CRM1
  • Mutation(export): L133A/I135A
  • Mutation(bind): Unknown
  • Functional seq: 1MNPRQGYSLSGYYTHPFQGYEHRQLRYQQPGPGSSPSSFLLKQIEFLKGQLPEAPVIGKQTPSLPPSLPGLRPRFPVLLASSTRGRQVDIRGVPRGVHLGSQGLQRGFQHPSPRGRSLPQRGVDCLSSHFQELSIYQDQEQRILKFLEELGEGKATTAHDLSGKLGTPKKEINRVLYSLAKKGKLQKEAGTPPLWKIAVSTQAWNQHSGVVRPDGHSQGAPNSDPSLEPEDRNSTSVSEDLLEPFIAVSAQAWNQHSGVVRPDSHSQGS269
  • Sites: -


# candidates uniprotID start# sequence secondary class loc_DISO loc_CDD beta Ebind Score(NES) Cosmic Score(Cosmic) TOTALscore(Ebind|Stars)
1 nes_diso P55265 35 SPSSFLLKQIEFLK
..............		 CHHHHHHHHHHHHC c2-4 DISO 0.0 Bad: -22.702 cosmic_spacer
2 ExpNES_diso P55265 122 GVDCLSSHFQELSIYQ
...........*.*..		 CCCHHHHHHHCCCCCH c1a-5 boundary boundary|z-alpha; 0.0 Medium: -39.821 cosmic_phi Medium|
3 nes_diso P55265 283 STSALEDPLEFLDMAE CCCCCCCCHHHCCHHH c1a-4 __ boundary|z-alpha; 0.0 Medium: -34.441 cosmic_spacer Medium|
4 nes_diso P55265 292 EFLDMAEIKEKICDYL HHCCHHHHHHHHHHHH c1aR-4 boundary boundary|z-alpha; 0.0 Bad: -27.695 cosmic_spacer
5 nes_diso P55265 326 KARDINAVLIDMER CCHHHHHHHHHHHH c2-AT-4 boundary boundary|z-alpha; 0.0 NA cosmic_spacer
6 nes_diso P55265 465 SIRAAPGEFRAIMEMPS HCCCCCCCHHHHHCCCC c1c-AT-5 DISO 0.0 NA
7 nes_diso P55265 510 EYAQFASQTCEFNMIE HHHHHHCCCEEEEEEE c1a-AT-4 boundary boundary|DSRM; boundary|DSRM; 0.29 NA cosmic_spacer
8 nes_diso P55265 557 AKQDAAMKAMTILL HHHHHHHHHHHHHH c2-AT-4 boundary boundary|DSRM; boundary|DSRM; 0.0 NA cosmic_spacer
9 nes_diso P55265 559 QDAAMKAMTILLEE HHHHHHHHHHHHHH c2-AT-4 boundary boundary|DSRM; boundary|DSRM; 0.0 NA cosmic_spacer
10 nes_diso P55265 615 PVTTLLECMHKLGN HHHHHHHHHHHHCC c3-4 boundary boundary|DSRM; boundary|DSRM; 0.0 Weak: -32.67 cosmic_phi_to_LIVMF Weak|
11 nes_diso P55265 712 KVRKIGELVRYLNT CCCCCHHHHHHCCC c3-4 boundary boundary|DSRM; boundary|DSRM; boundary|DSRM; boundary|DSRM; 0.0 Weak: -32.086 cosmic_spacer Weak|
12 nes_diso P55265 807 VTPVTGASLRRTMLLLS CCCCCCCHHHHHHHCCC c1c-AT-4 DISO boundary|DSRM; boundary|DSRM; boundary|ADEAMc; 0.0 NA cosmic_spacer
13 nes_diso P55265 832 TLPLTGSTFHDQIAMLS CCCCCCCCHHHHHHHHH c1c-AT-5 __ boundary|ADEAMc; 0.0 NA cosmic_spacer
14 nes_diso P55265 860 QPSLLGRKILAAIIMKK CCCCCCCCEEEEEEEEC c1c-4 boundary middle|ADEAMc; 0.5 Bad: -28.763 cosmic_spacer
15 nes_diso P55265 947 EKLQIKKTVSFHLYIST CCEEECCCEEEEEEEEE c1c-4 boundary middle|ADEAMc; 0.62 Medium: -37.126 cosmic_spacer Medium|
16 nes_ord P55265 1056 FLQPIYLKSVTLGY HHHHHHHHHHEECC c2-5 ORD middle|ADEAMc; 0.0 Bad: -28.875 cosmic_spacer
17 nes_diso P55265 1160 NIFLLFKKLCSFRY HHHHHHHHHHHHHC c3-4 boundary middle|ADEAMc; 0.0 Bad: -27.17
  • candidates: if the segment is located in the disordered or boundary region, flagged with "_diso"; if the segment is located in the ordered region, flagged with "_ord"; if the segment's beta-strand content is over 0.5, flagged with "_beta"; if the segment is annotated as NES in the NESdb or validNES, flagged with "ExpNES_" instead of "nes_".
  • sequence: Hydrophobic positions are colored in red.
  • class: NES classes 1a, 1b, 1c, 1d, 1aR (reverse class of 1a), 1cR, 2, 2-rev (Rev type class 2), 3, and 4. The first letter "c" is for "class", and the number after hyphen ("-") is for the number of key hydrophobic positions. For example, c1a-4 means class 1a with the non-hydrophobic phi0 position. c1a-5 is for class 1a which have all hydrophobic residues in their phi0-4 positions.
  • loc_DISO: location of the segment with respect to the ordered/disordered regions
  • loc_CDD: location of the segment with respect to the conserved region annotated in the Conserved Domain Database (CDD)
  • beta: beta-strand content in the middle of the segment
  • Ebind: binding energy; Strong (less than -40.0), Medium (-40.0~-33.0), Weak (-33.0~-30.0), or Bad (higher than -30.0); Generated models can be downloaded via icon.
  • Score(NES): how many passes for the criteria: i) not located in the ordered region, ii) do not have beta strand in the middle, and iii) Strong, Medium, or Weak Ebind scores
  • Cosmic: if the key hydrophobic residues are mapped to the COSMIC mutation position, flagged with "cosmic_phi"; when the changed amino acid of the mutation position is L, I, V, M, or F, flagged with "cosmic_phi_to_LIVMF"; if the spacer residues are mapped to the mutation position, flagged with "cosmic_spacer"
  • Score(Cosmic): 2 stars with "cosmic_phi" and the changed amino acid is not L, I, V, M, or F; 1 star for "cosmic_phi_to_LIVMF" or "cosmic_spacer" (Score(Cosmic) is present for only segments with the 3 stars of Score(NES))
  • TOTALscore: Score(NES)+Score(Cosmic); The Ebind category (Strong, Medium, or Weak) is annotated together.