Q13043_STK4 | Serine/threonine-protein kinase 4
ProteinAtlas
Cosmic
Proviz
Swissmodel
- Reference DB: NESdb:68 validNES:P073
- PMIDs: 11805089
- Species: Homo sapiens (Human)
- Evidence: LMB Sensitive
- Mutation(export): M368A/I370A/W439A/V441A, M368A/I370A/V441A/L444A
- Mutation(bind): Unknown
- Functional seq: 323DEMDSGTMVRAVGDEMGTVRVASTMTDGANTMIEHDDTLPSQLGTMVINAEDEEEEGTM381,430DGDYEFLKSWTVEDLQKRLLALDPMMEQEIE460
- Sites: 365-370; 439-444
| # | candidates | uniprotID | start# | sequence | secondary | class | loc_DISO | loc_CDD | beta | Ebind | Score(NES) | Cosmic | Score(Cosmic) | TOTALscore(Ebind|Stars) |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 1 | nes_ord | Q13043 | 44 | VYKAIHKETGQIVAIKQ | EEEEEECCCCCEEEEEE | c1c-AT-4 | ORD | boundary|STKc_MST1_2; boundary|S_TKc; | 0.38 | NA |  |
cosmic_spacer | | |
| 2 | nes_ord | Q13043 | 63 | VESDLQEIIKEISIMQ | CCCHHHHHHHHHHHHH | c1a-4 | ORD | middle|STKc_MST1_2; middle|S_TKc; | 0.0 | Bad: -27.892 | |
cosmic_phi_to_LIVMF | | |
| 3 | nes_ord | Q13043 | 66 | DLQEIIKEISIMQQ | HHHHHHHHHHHHHH | c3-4 | ORD | middle|STKc_MST1_2; middle|S_TKc; | 0.0 | Weak: -30.249  | |
cosmic_spacer | | |
| 4 | nes_ord | Q13043 | 129 | ILQSTLKGLEYLHFMR | HHHHHHHHHHHHHHCC | c1a-AT-5 | ORD | middle|STKc_MST1_2; middle|S_TKc; | 0.0 | NA | |
cosmic_spacer | | |
| 5 | nes_ord | Q13043 | 130 | LQSTLKGLEYLHFMR | HHHHHHHHHHHHHCC | c1b-4 | ORD | middle|STKc_MST1_2; middle|S_TKc; | 0.0 | NA | |
cosmic_spacer | | |
| 6 | nes_ord | Q13043 | 138 | EYLHFMRKIHRDIKAGN | HHHHHCCCCCCCCHHHH | c1cR-4 | ORD | middle|STKc_MST1_2; middle|S_TKc; | 0.0 | Bad: -19.932 | |
cosmic_phi | | |
| 7 | nes_ord | Q13043 | 146 | IHRDIKAGNILLNT | CCCCCHHHHEEECC | c2-AT-4 | ORD | middle|STKc_MST1_2; middle|S_TKc; | 0.14 | NA | |
cosmic_spacer | | |
| 8 | nes_ord | Q13043 | 159 | TEGHAKLADFGVAG | CCCCCCEECCCCCH | c2-AT-4 | ORD | middle|STKc_MST1_2; middle|S_TKc; | 0.29 | NA | |
cosmic_spacer | | |
| 9 | nes_ord | Q13043 | 166 | ADFGVAGQLTDTMAKRN | ECCCCCHHHCCCHHHCC | c1cR-4 | ORD | middle|STKc_MST1_2; middle|S_TKc; | 0.0 | Bad: -28.836 | |
cosmic_spacer | | |
| 10 | nes_ord | Q13043 | 206 | DIWSLGITAIEMAE | HHHHHCHHHHHHHC | c2-5 | ORD | middle|STKc_MST1_2; middle|S_TKc; | 0.0 | Bad: -29.767 | |
| ||
| 11 | nes_ord | Q13043 | 223 | PYADIHPMRAIFMIPT | CHHHCCCCEEEHHCCC | c1d-4 | ORD | middle|STKc_MST1_2; middle|S_TKc; | 0.43 | Bad: -22.075 | |
| ||
| 12 | nes_ord | Q13043 | 223 | PYADIHPMRAIFMIP | CHHHCCCCEEEHHCC | c1b-4 | ORD | middle|STKc_MST1_2; middle|S_TKc; | 0.43 | Bad: -20.704 | |
| ||
| 13 | nes_diso | Q13043 | 276 | LQHPFVRSAKGVSILR | HCCHHHHCCCCCHHHH | c1a-AT-4 | boundary | boundary|STKc_MST1_2; boundary|S_TKc; | 0.0 | NA | |
cosmic_spacer | | |
| 14 | nes_diso | Q13043 | 286 | GVSILRDLINEAMDVKL | CCHHHHHHHHHHHHHHH | c1c-5 | DISO | boundary|STKc_MST1_2; boundary|S_TKc; | 0.0 | Medium: -33.454 | |
Medium| | ||
| 15 | nes_diso | Q13043 | 330 | MVRAVGDEMGTVRVAS ................ |
EEECCCCCCCEEEECC | c1a-5 | DISO | 0.14 | Medium: -39.183 | |
cosmic_spacer |  | Medium| | |
| 16 | ExpNES_diso | Q13043 | 357 | HDDTLPSQLGTMVINA ........+++*+*.. |
CCCCCHHHCCCEEECC | c1a-4 | DISO | 0.0 | Medium: -36.349 | |
cosmic_spacer | | Medium| | |
| 17 | nes_diso | Q13043 | 440 | TVEDLQKRLLALDPMMEQ +*++*............. |
CHHHHHHHHHHCCHHHHH | c4-5 | DISO | small|Mst1_SARAH; | 0.0 | Medium: -33.887 | |
cosmic_phi_to_LIVMF | | Medium| |
| 18 | nes_diso | Q13043 | 440 | TVEDLQKRLLALDP +*++*......... |
CHHHHHHHHHHCCH | c3-4 | DISO | small|Mst1_SARAH; | 0.0 | Medium: -36.793 | |
cosmic_spacer | | Medium| |
- candidates: if the segment is located in the disordered or boundary region, flagged with "_diso"; if the segment is located in the ordered region, flagged with "_ord"; if the segment's beta-strand content is over 0.5, flagged with "_beta"; if the segment is annotated as NES in the NESdb or validNES, flagged with "ExpNES_" instead of "nes_".
- sequence: Hydrophobic positions are colored in red.
- class: NES classes 1a, 1b, 1c, 1d, 1aR (reverse class of 1a), 1cR, 2, 2-rev (Rev type class 2), 3, and 4. The first letter "c" is for "class", and the number after hyphen ("-") is for the number of key hydrophobic positions. For example, c1a-4 means class 1a with the non-hydrophobic phi0 position. c1a-5 is for class 1a which have all hydrophobic residues in their phi0-4 positions.
- loc_DISO: location of the segment with respect to the ordered/disordered regions
- loc_CDD: location of the segment with respect to the conserved region annotated in the Conserved Domain Database (CDD)
- beta: beta-strand content in the middle of the segment
- Ebind: binding energy; Strong (less than -40.0), Medium (-40.0~-33.0), Weak (-33.0~-30.0), or Bad (higher than -30.0); Generated models can be downloaded via icon.
- Score(NES): how many passes for the criteria: i) not located in the ordered region, ii) do not have beta strand in the middle, and iii) Strong, Medium, or Weak Ebind scores
- Cosmic: if the key hydrophobic residues are mapped to the COSMIC mutation position, flagged with "cosmic_phi"; when the changed amino acid of the mutation position is L, I, V, M, or F, flagged with "cosmic_phi_to_LIVMF"; if the spacer residues are mapped to the mutation position, flagged with "cosmic_spacer"
- Score(Cosmic): 2 stars with "cosmic_phi" and the changed amino acid is not L, I, V, M, or F; 1 star for "cosmic_phi_to_LIVMF" or "cosmic_spacer" (Score(Cosmic) is present for only segments with the 3 stars of Score(NES))
- TOTALscore: Score(NES)+Score(Cosmic); The Ebind category (Strong, Medium, or Weak) is annotated together.